--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Dec 09 12:49:11 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/444/Zyx-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3882.16 -3889.71 2 -3882.47 -3890.31 -------------------------------------- TOTAL -3882.30 -3890.05 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.192018 0.000230 0.164019 0.223078 0.191201 1501.00 1501.00 1.000 r(A<->C){all} 0.094366 0.000348 0.060480 0.131674 0.093236 1010.08 1125.91 1.000 r(A<->G){all} 0.266440 0.000907 0.210801 0.327079 0.265084 1121.78 1126.55 1.000 r(A<->T){all} 0.105062 0.000300 0.071603 0.138665 0.104578 1210.21 1230.27 1.000 r(C<->G){all} 0.099944 0.000650 0.055093 0.154201 0.097318 957.00 961.47 1.000 r(C<->T){all} 0.314798 0.001116 0.251491 0.382323 0.314590 1091.55 1092.00 1.000 r(G<->T){all} 0.119390 0.000546 0.075072 0.164635 0.118413 1123.00 1174.28 1.000 pi(A){all} 0.344832 0.000119 0.324132 0.366266 0.344944 1144.65 1202.19 1.001 pi(C){all} 0.199577 0.000081 0.183092 0.217414 0.199489 1042.93 1137.10 1.001 pi(G){all} 0.189009 0.000080 0.171448 0.205791 0.189023 1052.59 1247.20 1.000 pi(T){all} 0.266582 0.000097 0.246605 0.285338 0.266432 1152.41 1212.68 1.000 alpha{1,2} 0.336077 0.054126 0.000227 0.724996 0.289816 1272.04 1314.83 1.000 alpha{3} 1.336119 0.394169 0.389948 2.634542 1.199624 1228.14 1315.02 1.000 pinvar{all} 0.133372 0.009649 0.000012 0.322162 0.116036 1247.67 1251.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3772.264471 Model 2: PositiveSelection -3772.264471 Model 0: one-ratio -3787.116874 Model 3: discrete -3772.185444 Model 7: beta -3772.220273 Model 8: beta&w>1 -3772.220802 Model 0 vs 1 29.704805999999735 Model 2 vs 1 0.0 Model 8 vs 7 0.0010579999998299172
>C1 MESVAQQLRELSLPKGDTGSPLVCIGHGKVAKLVAKISNNQNASVKRRLD IPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRKYL SSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAKPT QPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYSNV NETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSELRH ATLEFNKPIDYLQNNQTTNPLQIYANQYAMQHDATGKSSSTYDSIYEPIN PRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIHGNA RTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLGESS GCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSV CMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDF HKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSS EAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHoo >C2 MESVAQQLRGLSLPKGDTGSPPVCIGHGKVAEIVAEISKKQNASLNRRLD IPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKMRGHMPFRKYLS SEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAKPTQ PLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYSNVH ETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSELRHA TLEFNKPIDYLQNNQTSNPLQIYANQYALQHDATGKSSYTYDSIYEPINP RPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIHGNAK TTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLGESSG CTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVC MEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFH KKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSE AEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo >C3 MESVAQQLRGLSLPKGDTGSPPVCIGHGKVAEIVAKISKKQNASVNRRLD IPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKMRGHMPFRKYLS SEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAKPTQ PLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYSNVH ETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSELRHA TLEFNKPIDYLQNNQTSNPLQIYANQYALQHDATGKSSYTYDSIYEPINP RPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIHGNAR TTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLGESSG CTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVC MEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFH KKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSE AEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE PINPRPSADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIHG NARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLGE SSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKC SVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCIT DFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLLL SSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE PINPRPSADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIHG NAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLGE SSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEKC SVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCIT DFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLL SSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=591 C1 MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR C2 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR C3 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR *******:: :**.*.: ** *********::*.:**:.** *: :* C1 LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK C2 LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK C3 LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK C4 SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK C5 LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK * *** ****:*********** *************.** : ****** C1 YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK C2 YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK C3 YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK C4 YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK C5 YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK * :****.***::***:*****************************: ** C1 PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS C2 PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS C3 PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS C4 PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA C5 PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA ***..:**::************.**. ::. : ** *: * :*.**: C1 NVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSEL C2 NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL C3 NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL C4 NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL C5 NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL **:*:*:.*. **:*:*: *******:** *:****************** C1 RHATLEFNKPIDYLQNNQTTNP-LQIYANQYAMQHDATGKSSSTYDSIYE C2 RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE C3 RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE C4 RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE C5 RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE *:** ***********::*:** ********::***. .**: ******* C1 PINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIH C2 PINPRPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH C3 PINPRPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH C4 PINPRPS-ADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIH C5 PINPRPS-ADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIH ******. .* :***. *::****.*. *.*.:: ** ***:**** *** C1 GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLG C2 GNAKTTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG C3 GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG C4 GNARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLG C5 GNAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLG ***:*.**. .: ****:*****::**.*:****:*************** C1 ESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK C2 ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK C3 ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK C4 ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK C5 ESSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEK ************** ****:****************************** C1 CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI C2 CSVCMEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI C3 CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI C4 CSVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI C5 CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI *****:*********:********************************** C1 TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL C2 TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL C3 TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL C4 TDFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLL C5 TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL ******************** ***************************** C1 LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHoo- C2 LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo C3 LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo C4 LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- C5 LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- ************************:******:****** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 587 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 587 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12030] Library Relaxation: Multi_proc [72] Relaxation Summary: [12030]--->[11942] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/Zyx-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.353 Mb, Max= 30.859 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTTNP-LQIYANQYAMQHDATGKSSSTYDSIYE PINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHoo- >C2 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNAKTTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo >C3 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE PINPRPS-ADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIH GNARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE PINPRPS-ADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIH GNAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- FORMAT of file /tmp/tmp1515332791273949425aln Not Supported[FATAL:T-COFFEE] >C1 MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTTNP-LQIYANQYAMQHDATGKSSSTYDSIYE PINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHoo- >C2 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNAKTTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo >C3 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE PINPRPS-ADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIH GNARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE PINPRPS-ADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIH GNAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:591 S:99 BS:591 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 93.34 C1 C2 93.34 TOP 1 0 93.34 C2 C1 93.34 BOT 0 2 94.20 C1 C3 94.20 TOP 2 0 94.20 C3 C1 94.20 BOT 0 3 85.27 C1 C4 85.27 TOP 3 0 85.27 C4 C1 85.27 BOT 0 4 85.96 C1 C5 85.96 TOP 4 0 85.96 C5 C1 85.96 BOT 1 2 98.81 C2 C3 98.81 TOP 2 1 98.81 C3 C2 98.81 BOT 1 3 83.53 C2 C4 83.53 TOP 3 1 83.53 C4 C2 83.53 BOT 1 4 84.56 C2 C5 84.56 TOP 4 1 84.56 C5 C2 84.56 BOT 2 3 83.88 C3 C4 83.88 TOP 3 2 83.88 C4 C3 83.88 BOT 2 4 84.73 C3 C5 84.73 TOP 4 2 84.73 C5 C3 84.73 BOT 3 4 90.29 C4 C5 90.29 TOP 4 3 90.29 C5 C4 90.29 AVG 0 C1 * 89.69 AVG 1 C2 * 90.06 AVG 2 C3 * 90.40 AVG 3 C4 * 85.74 AVG 4 C5 * 86.39 TOT TOT * 88.46 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGAGTCTGTGGCCCAGCAACTTAGAGAGCTGTCGCTTCCAAAAGGTGA C2 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA C3 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA C4 ATGGAGTCAGTGGCCCAGCAAATTAGAGAGATGTCGCTTTCAAAAGACGA C5 ATGGAGTCAGTGGCCCAGCAACTTAAAGAGCTGTCGCTTTCAAAAGACGA ********:************.***.**.*.* ****** ******. ** C1 CACAGGC------TCACCGCTTGTATGTATTGGACATGGAAAAGTTGCGA C2 CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG C3 CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG C4 AATATTAAAAAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTGGCAG C5 AACATTAAATAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTTGCAG .* * . ******* ************************ **.. C1 AGCTAGTCGCCAAGATAAGTAATAATCAAAATGCATCAGTAAAGAGGAGA C2 AGATAGTCGCCGAGATAAGTAAAAAGCAAAATGCATCATTAAACAGGAGA C3 AGATAGTCGCCAAGATAAGTAAAAAGCAAAATGCATCAGTAAACAGGAGA C4 AGTTAGTCGGCAAGATAAGTCAAAAGCAAAATGAATCTGTATACAGGAGA C5 AGTTAGTCGGCAAGATAAGTCAAAGGCAAAATGATTCCGTATATAAGAGA ** ****** *.********.*:*. *******.:** **:* *.**** C1 TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT C2 TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT C3 TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT C4 TCGGATACACCTCCTAAGCTGCCGATAAAATATAATGAAATGCCTCAGGT C5 TTGGATACACCTCCTAAGCCGCCGATAAAATATAAGGAAATGCCTCAGGT * ***** *********** *************** ************** C1 TCCATCAAGCAGACAGGTTTTGTGTTCGCGGGAACCACTATATTCACAAC C2 TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC C3 TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC C4 TCCATCAAGCCGACAGGTTTCGTGTTCGAGGGAACCACTTTACTCACAAC C5 TCCATCAAGCAGACAGGTTTTATGTTCGCGGGAACCACTTTATTCACAAC **********.********* .******.**********:** ******* C1 CTCTGATTGGAGTCGAGAAAACAATGAGGGGGCATATGCCTTTTAGAAAA C2 CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA C3 CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA C4 CTCTGATTGGAGCCGAGAAAACAATAAGTGTGCATATGCCTTTTAGAAAA C5 CGCTGATTGGAGTCGAGAAAACAATAAGTGGGCATATGCCTTTTAGAAAA * ********** ******* **.** * ******************* C1 TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATAAACAGAAAAAC C2 TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC C3 TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC C4 TACCATACCTCTGAATTTGGAGTTGCTGATACTGAAATAAACAGAAAATC C5 TACCTTAGCTCTGAATTCGGAGCTGCTGATACTGAAATGAACAGAAAAAC ****: * ********* **** ********** ****.*********:* C1 AACTTTAGATAATCCGGCAATTTTGGAACAGCAATTAGAAGCTCTTGCTT C2 AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT C3 AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT C4 AACTTTGGATAATCCAGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT C5 AACTTTGGATAATCCGGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ******.********.*****: ******************* ** **** C1 ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTACAAGCTAAG C2 ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA C3 ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA C4 ACCACAAACTTCAAATGGAAAAGAAGGGTCTTTTGGGAGTACCAGCTAAA C5 ACCACAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGTCTACAAGCTAAA **** *****************.**************: **..******. C1 CCAACACAACCTCTCAACAGCTTTACAAAGCCCCTTTCAAAGACTTTAAG C2 CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG C3 CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG C4 CCAACACAATCTTTCAACAGCTTTTCAGAGCCACTTTCAAAGACTTTAAG C5 CCAACACAATCTGTAAACAGCTTTTCAGAGCCTCTTTCAAAGACTTTGAG ********. ** *.**.******:**.**** ********.*****.** C1 CAAAAGCTTAATATATTCTAATTTAGGTTCTGTTCGCAAAGAAATAGAAA C2 CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA C3 CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA C4 CAAAAGCTTAATATATTGTAATTTAGATTCTGTACACAAAAGTGAAAATA C5 CAAAAGCTTAATATATTGCAATTTAGATTCTGTACACAAAAGTGCAGAAA ***************** *******. * **::*.***:..:. *.*:* C1 CATTAGAACTATTAACAGACGAAACTAAGATTTCTGCGAGTACATATTCA C2 TATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA C3 CATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA C4 GATCAGAACTATTAACAGAGGAAACTCCGATTGCTGCAAATACATATGCA C5 GATCAGAACTATTTACAGAGACAACTAAGATTACTGCAAGTACATACGCA ** ******* :***** ..****..** : *:**.*.***.** ** C1 AACGTTAATGAAACTGCAATGGACTCTTCTCATAGCTCAACGCAAAAGAT C2 AACGTTCATGAAACCGCAATGGACTCTCCTCTTAGCTCAGCGCAAAAGAT C3 AACGTTCATGAAACCGCAATGGACTCTCCTCTTAGCTCAGCGCAAAAGAT C4 AATGTTCATGAAGCCGCAGTGGGCTCGTCTCATAGCTCAACTCAAAAGAT C5 AATGTTCATGAAGCTGCAGTGGGCTCTTCTCTTAGCTCGACGCAAAATAT ** ***.*****.* ***.***.*** ***:******..* ***** ** C1 GCTATCCGTCTGCACTAATTTTATTTCAGACAACGAAAAAGATGAGTTAC C2 GCTATTTGTCTGCACTAACTTTATTTCAGACAACGAAAAAGATGAGTTAC C3 GCTATTTGTCTGCACTAACTTTATTTCAGACAACGAAAAAGATGAGTTAC C4 GATATCCGTCTGCACTAACTTTATTTCAAACAACGAAATAGATGACTTAC C5 GATATCCGTCTGCACTAACTTTATTTCAGACAACGAAATAGATGACTTAC *.*** *********** *********.*********:****** **** C1 CGCCACCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT C2 CGCCCCCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT C3 CGCCCCCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT C4 CGCCACCTCCTAGTCCAGAGAGCGCTGTGAGCTCTTCATACAGCGAGCTT C5 CGCCACCACCTAGTCCAGAAAGCGCTGTGAGTTCTTCATACAGCGAGCTT ****.**:***********.*********** *********** ****** C1 CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA C2 CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA C3 CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA C4 CGGCGCGCCACTTCGGAATTTAACAAACCAATTGATTATTTGCAAAATGA C5 CGGCGTGCCACTTCGGAATTTAACAAGCCAATTGATTATTTGCAAAATGA ** *. ******* ****** *****.**************.******.* C1 CCAGACAACGAATCCT---TTACAAATATATGCAAACCAATATGCGATGC C2 CCAGACATCGAATCCT---TTGCAAATATATGCAAACCAATATGCGTTGC C3 CCAGACATCGAATCCT---TTGCAAATATATGCAAACCAATATGCGTTGC C4 CCAGACATCGAATCCTTCTTTGCAAATATATGCAAACCAATATTCGTTGC C5 CGAGACATCGAATCCTTCTTTACAAATATATGCAAACCAATATGCGTTGC * *****:******** **.********************* **:*** C1 AGCATGATGCCACAGGCAAGAGCTCTTCTACATATGATTCAATATATGAA C2 AACATGATGCCACAGGCAAGAGCTCTTATACATATGATTCAATATATGAA C3 AACATGATGCCACAGGCAAGAGCTCTTATACATATGATTCAATATATGAA C4 AGCATGATCCCATTAGCAAGAGCTCTTCAACATATGATTCAATATATGAA C5 AGCATGATGCCATAAGCAAGAGCACTTCTACATATGATTCAATATATGAG *.****** *** :.********:***.:********************. C1 CCTATAAACCCTCGACCCTGTGTTGCAGATACGCTGCCTCGTGAAAGTTA C2 CCTATAAACCCTCGACCCTGTGTTGTAGATACGCTGCCTCGTGAAAGTTG C3 CCTATAAACCCTCGACCCTGTGTTGTAGATACGCTGCCTCGTGAAAATTG C4 CCTATAAACCCACGACCCTCT---GCAGATATGTTTCCTCGTGAAAGTTG C5 CCTATAAACCCGCGACCGTCT---GCAGATATGTTGCCTCGTGAAACTTG *********** ***** * * * ***** * * ********** **. C1 TAATCTGCATAATTCATACGTTAATGATAATAATCCAAACATTTCCCATG C2 TAATCTGCATAATTCATACGTCAATGATAATAATCCAAACATTTGCCATG C3 TAATCTGCATAATTCATACGTCAATGATAATAATCCAAACATTTGCCATG C4 TAATATGTATAATTCATACGTCAATGATAATACTCCAAGCATTTCCAACA C5 TAATCTGTATAATTCATACGTCAGTGATAGTATTCCAAGCATTTCCAATG ****.** ************* *.*****.** *****.***** *.* . C1 AATACAATATTTCGAATTCGATTGAAGCTAACCAAACACTATACATACAT C2 AATACAATATTTCGAATTCGATTGATGCTAACCAAACACTATACATACAT C3 AATACAATATTTCGAATTCGATTGATGCTAACCAAACACTATACATACAT C4 AATTAAATATTTTAAATTCGATCGAAGCGAACCAAACACTATACATACAT C5 AATTAAATATTTTAAATTCGATTGAAGCAAACCAAACAGCATACATACAT ***:.******* .******** **:** ********* ********** C1 GGTAATGCTAGAACTACATTTTATGACGTGAACAGCATCCATAGAAATGA C2 GGTAATGCTAAAACTACATTTTATGACGTGAACACCATACATAGAAATGA C3 GGTAATGCTAGAACTACATTTTATGACGTGAACTCCATACATAGAAATGA C4 GGTAACGCTAGAACTAAATTTTATAAAGGGAGCACTGATCATAGAAATGA C5 GGTAATGCTAAAACAAAATTTTATAACTTGAACACTGTCCATAGAAATGA ***** ****.***:*.*******.*. **.*: .: *********** C1 TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG C2 TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG C3 TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG C4 TAAGGAAGGTCTAAAAAACTACATTTCAATAACCACCGATCCAGTTCAAG C5 TAATGAAGGTCTAAAAAACTTCGTTTCAATACCCACCGATCCAGTTCAAG *** ************** *:*.********.*******:**.******* C1 AATTGGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA C2 AATTTGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA C3 AATTTGAAAACTACGGTAGATGTGTCAAATGCAATTCACGTGTACTTGGA C4 AATTAGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTGCTTGGA C5 AATTAGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA **** **************.***********************.****** C1 GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCACATATTTTGCTT C2 GAAAGTAGCGGATGTACAGCAATGGATCAAATATACCACATATCTTGCTT C3 GAAAGTAGCGGATGTACAGCAATGGATCAAATATACCACATATCTTGCTT C4 GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCATATATCTTGCTT C5 GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCATATAACTTGCTT ******** ***************************** ***: ****** C1 CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCTTTCTATGCAT C2 CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCATTTTATGCAT C3 CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCATTTTATGCAT C4 CACATGTACGGATTGCCAAATTAACTTACAGGGAAAACCATTCTATGCAC C5 CACATGTGCAGATTGTCAAATTAATTTGCAGGGAAAACCATTCTATGCAT *******.*.***** ******** **.***********:** ****** C1 TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA C2 TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA C3 TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA C4 TAGACGGCAAACCTTATTGCGAATATGATTATTTACAAACACTGGAAAAA C5 TAGACGGCAAACCGTATTGCGAATATGATTATTTACAAACACTGGAAAAA ************* ************************************ C1 TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGG C2 TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTTCTGG C3 TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGG C4 TGCTCTGTTTGCATGAAACCTATTTTAGAGAGAATTCTTAGAGCTACTGG C5 TGCTCTGTTTGTATGGAACCTATTTTAGAGAGAATTCTTAGAGCTACTGG *********** ***.****:************************:**** C1 AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT C2 AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT C3 AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT C4 AAAACCATATCATCCGCAATGTTTTACATGTGTCGTATGCGGAAAAAGCT C5 AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT ********************************* **************** C1 TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA C2 TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA C3 TAGATGGACTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA C4 TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA C5 TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA *******.****************************************** C1 ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC C2 ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC C3 ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC C4 ACAGATTTTCATAAAAAATTTGCTCCTCGCTGTTGTGTCTGCAAGCAACC C5 ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC *********************** ************************** C1 AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAG C2 AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAG C3 AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAG C4 AATTATGCCATTTCCAGGACAAGAAGAAACGATCAGGGTAGTGGCCCTAG C5 AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAG ********** :************************.******** **** C1 ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA C2 ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA C3 ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA C4 ATCGAAGTTTTCACCTAGAATGTTATAAGTGCGAGGACTGCGGGCTTTTA C5 ATCGAAGTTTTCACCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA ************* ***************** ******** ***** *** C1 CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCATGT C2 CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGT C3 CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGT C4 CTGTCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGT C5 CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGT **.***************************************** ** ** C1 TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA C2 TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA C3 TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA C4 TCTATGTAAAAGCTGCAATGCACAACGAGTTCAGGCTTTAACGAAGCGCA C5 TCTATGTAAAAGCTGTAATGCACAACGAGTTCAGGCTTTAACGAAGCGCA *************** ******.**.*.**************.** **** C1 TGACGTCAGAACAT--------- C2 TGACGTCAGAACAT--------- C3 TGACGTCAGAACAT--------- C4 TGACATCAGAACAT--------- C5 TGACGTCAGAACAT--------- ****.********* >C1 ATGGAGTCTGTGGCCCAGCAACTTAGAGAGCTGTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCTTGTATGTATTGGACATGGAAAAGTTGCGA AGCTAGTCGCCAAGATAAGTAATAATCAAAATGCATCAGTAAAGAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTGTGTTCGCGGGAACCACTATATTCACAAC CTCTGATTGGAGTCGAGAAAACAATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATAAACAGAAAAAC AACTTTAGATAATCCGGCAATTTTGGAACAGCAATTAGAAGCTCTTGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTACAAGCTAAG CCAACACAACCTCTCAACAGCTTTACAAAGCCCCTTTCAAAGACTTTAAG CAAAAGCTTAATATATTCTAATTTAGGTTCTGTTCGCAAAGAAATAGAAA CATTAGAACTATTAACAGACGAAACTAAGATTTCTGCGAGTACATATTCA AACGTTAATGAAACTGCAATGGACTCTTCTCATAGCTCAACGCAAAAGAT GCTATCCGTCTGCACTAATTTTATTTCAGACAACGAAAAAGATGAGTTAC CGCCACCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA CCAGACAACGAATCCT---TTACAAATATATGCAAACCAATATGCGATGC AGCATGATGCCACAGGCAAGAGCTCTTCTACATATGATTCAATATATGAA CCTATAAACCCTCGACCCTGTGTTGCAGATACGCTGCCTCGTGAAAGTTA TAATCTGCATAATTCATACGTTAATGATAATAATCCAAACATTTCCCATG AATACAATATTTCGAATTCGATTGAAGCTAACCAAACACTATACATACAT GGTAATGCTAGAACTACATTTTATGACGTGAACAGCATCCATAGAAATGA TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG AATTGGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCACATATTTTGCTT CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCTTTCTATGCAT TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAG ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCATGT TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA TGACGTCAGAACAT--------- >C2 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCGAGATAAGTAAAAAGCAAAATGCATCATTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA TATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGCAATGGACTCTCCTCTTAGCTCAGCGCAAAAGAT GCTATTTGTCTGCACTAACTTTATTTCAGACAACGAAAAAGATGAGTTAC CGCCCCCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA CCAGACATCGAATCCT---TTGCAAATATATGCAAACCAATATGCGTTGC AACATGATGCCACAGGCAAGAGCTCTTATACATATGATTCAATATATGAA CCTATAAACCCTCGACCCTGTGTTGTAGATACGCTGCCTCGTGAAAGTTG TAATCTGCATAATTCATACGTCAATGATAATAATCCAAACATTTGCCATG AATACAATATTTCGAATTCGATTGATGCTAACCAAACACTATACATACAT GGTAATGCTAAAACTACATTTTATGACGTGAACACCATACATAGAAATGA TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG AATTTGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGCGGATGTACAGCAATGGATCAAATATACCACATATCTTGCTT CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCATTTTATGCAT TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTTCTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAG ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGT TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA TGACGTCAGAACAT--------- >C3 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCAAGATAAGTAAAAAGCAAAATGCATCAGTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA CATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGCAATGGACTCTCCTCTTAGCTCAGCGCAAAAGAT GCTATTTGTCTGCACTAACTTTATTTCAGACAACGAAAAAGATGAGTTAC CGCCCCCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA CCAGACATCGAATCCT---TTGCAAATATATGCAAACCAATATGCGTTGC AACATGATGCCACAGGCAAGAGCTCTTATACATATGATTCAATATATGAA CCTATAAACCCTCGACCCTGTGTTGTAGATACGCTGCCTCGTGAAAATTG TAATCTGCATAATTCATACGTCAATGATAATAATCCAAACATTTGCCATG AATACAATATTTCGAATTCGATTGATGCTAACCAAACACTATACATACAT GGTAATGCTAGAACTACATTTTATGACGTGAACTCCATACATAGAAATGA TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG AATTTGAAAACTACGGTAGATGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGCGGATGTACAGCAATGGATCAAATATACCACATATCTTGCTT CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCATTTTATGCAT TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGACTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAG ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGT TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA TGACGTCAGAACAT--------- >C4 ATGGAGTCAGTGGCCCAGCAAATTAGAGAGATGTCGCTTTCAAAAGACGA AATATTAAAAAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTGGCAG AGTTAGTCGGCAAGATAAGTCAAAAGCAAAATGAATCTGTATACAGGAGA TCGGATACACCTCCTAAGCTGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCCGACAGGTTTCGTGTTCGAGGGAACCACTTTACTCACAAC CTCTGATTGGAGCCGAGAAAACAATAAGTGTGCATATGCCTTTTAGAAAA TACCATACCTCTGAATTTGGAGTTGCTGATACTGAAATAAACAGAAAATC AACTTTGGATAATCCAGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAGAAGGGTCTTTTGGGAGTACCAGCTAAA CCAACACAATCTTTCAACAGCTTTTCAGAGCCACTTTCAAAGACTTTAAG CAAAAGCTTAATATATTGTAATTTAGATTCTGTACACAAAAGTGAAAATA GATCAGAACTATTAACAGAGGAAACTCCGATTGCTGCAAATACATATGCA AATGTTCATGAAGCCGCAGTGGGCTCGTCTCATAGCTCAACTCAAAAGAT GATATCCGTCTGCACTAACTTTATTTCAAACAACGAAATAGATGACTTAC CGCCACCTCCTAGTCCAGAGAGCGCTGTGAGCTCTTCATACAGCGAGCTT CGGCGCGCCACTTCGGAATTTAACAAACCAATTGATTATTTGCAAAATGA CCAGACATCGAATCCTTCTTTGCAAATATATGCAAACCAATATTCGTTGC AGCATGATCCCATTAGCAAGAGCTCTTCAACATATGATTCAATATATGAA CCTATAAACCCACGACCCTCT---GCAGATATGTTTCCTCGTGAAAGTTG TAATATGTATAATTCATACGTCAATGATAATACTCCAAGCATTTCCAACA AATTAAATATTTTAAATTCGATCGAAGCGAACCAAACACTATACATACAT GGTAACGCTAGAACTAAATTTTATAAAGGGAGCACTGATCATAGAAATGA TAAGGAAGGTCTAAAAAACTACATTTCAATAACCACCGATCCAGTTCAAG AATTAGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTGCTTGGA GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCATATATCTTGCTT CACATGTACGGATTGCCAAATTAACTTACAGGGAAAACCATTCTATGCAC TAGACGGCAAACCTTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGAAACCTATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTCGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCTCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCATTTCCAGGACAAGAAGAAACGATCAGGGTAGTGGCCCTAG ATCGAAGTTTTCACCTAGAATGTTATAAGTGCGAGGACTGCGGGCTTTTA CTGTCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGT TCTATGTAAAAGCTGCAATGCACAACGAGTTCAGGCTTTAACGAAGCGCA TGACATCAGAACAT--------- >C5 ATGGAGTCAGTGGCCCAGCAACTTAAAGAGCTGTCGCTTTCAAAAGACGA AACATTAAATAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTTGCAG AGTTAGTCGGCAAGATAAGTCAAAGGCAAAATGATTCCGTATATAAGAGA TTGGATACACCTCCTAAGCCGCCGATAAAATATAAGGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTATGTTCGCGGGAACCACTTTATTCACAAC CGCTGATTGGAGTCGAGAAAACAATAAGTGGGCATATGCCTTTTAGAAAA TACCTTAGCTCTGAATTCGGAGCTGCTGATACTGAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGTCTACAAGCTAAA CCAACACAATCTGTAAACAGCTTTTCAGAGCCTCTTTCAAAGACTTTGAG CAAAAGCTTAATATATTGCAATTTAGATTCTGTACACAAAAGTGCAGAAA GATCAGAACTATTTACAGAGACAACTAAGATTACTGCAAGTACATACGCA AATGTTCATGAAGCTGCAGTGGGCTCTTCTCTTAGCTCGACGCAAAATAT GATATCCGTCTGCACTAACTTTATTTCAGACAACGAAATAGATGACTTAC CGCCACCACCTAGTCCAGAAAGCGCTGTGAGTTCTTCATACAGCGAGCTT CGGCGTGCCACTTCGGAATTTAACAAGCCAATTGATTATTTGCAAAATGA CGAGACATCGAATCCTTCTTTACAAATATATGCAAACCAATATGCGTTGC AGCATGATGCCATAAGCAAGAGCACTTCTACATATGATTCAATATATGAG CCTATAAACCCGCGACCGTCT---GCAGATATGTTGCCTCGTGAAACTTG TAATCTGTATAATTCATACGTCAGTGATAGTATTCCAAGCATTTCCAATG AATTAAATATTTTAAATTCGATTGAAGCAAACCAAACAGCATACATACAT GGTAATGCTAAAACAAAATTTTATAACTTGAACACTGTCCATAGAAATGA TAATGAAGGTCTAAAAAACTTCGTTTCAATACCCACCGATCCAGTTCAAG AATTAGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCATATAACTTGCTT CACATGTGCAGATTGTCAAATTAATTTGCAGGGAAAACCATTCTATGCAT TAGACGGCAAACCGTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGTATGGAACCTATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAG ATCGAAGTTTTCACCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGT TCTATGTAAAAGCTGTAATGCACAACGAGTTCAGGCTTTAACGAAGCGCA TGACGTCAGAACAT--------- >C1 MESVAQQLRELSLPKGDTGooSPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTTNPoLQIYANQYAMQHDATGKSSSTYDSIYE PINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH >C2 MESVAQQLRGLSLPKGDTGooSPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKoMRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNPoLQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNAKTTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH >C3 MESVAQQLRGLSLPKGDTGooSPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKoMRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNPoLQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE PINPRPSoADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIH GNARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE PINPRPSoADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIH GNAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1773 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481287376 Setting output file names to "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 970953905 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1004151151 Seed = 583305228 Swapseed = 1481287376 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 47 unique site patterns Division 2 has 52 unique site patterns Division 3 has 70 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4841.435321 -- -25.624409 Chain 2 -- -4861.623730 -- -25.624409 Chain 3 -- -4859.134117 -- -25.624409 Chain 4 -- -4843.427774 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4843.190804 -- -25.624409 Chain 2 -- -4841.435321 -- -25.624409 Chain 3 -- -4843.427774 -- -25.624409 Chain 4 -- -4890.072229 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4841.435] (-4861.624) (-4859.134) (-4843.428) * [-4843.191] (-4841.435) (-4843.428) (-4890.072) 500 -- [-3917.535] (-3930.613) (-3938.996) (-3925.396) * (-3914.981) (-3921.709) (-3933.881) [-3915.582] -- 0:00:00 1000 -- (-3902.802) (-3901.716) (-3914.958) [-3890.974] * (-3906.164) (-3898.024) [-3906.828] (-3893.846) -- 0:00:00 1500 -- (-3895.197) (-3895.965) (-3903.546) [-3884.659] * (-3897.275) (-3898.336) (-3884.924) [-3882.771] -- 0:00:00 2000 -- (-3899.733) (-3895.629) (-3889.951) [-3881.030] * (-3892.512) (-3899.062) (-3885.465) [-3885.657] -- 0:00:00 2500 -- (-3891.255) (-3882.276) (-3901.317) [-3883.438] * (-3885.294) [-3894.920] (-3887.336) (-3887.336) -- 0:00:00 3000 -- [-3888.856] (-3890.090) (-3898.749) (-3889.174) * [-3884.358] (-3892.803) (-3881.351) (-3891.817) -- 0:05:32 3500 -- (-3890.993) (-3903.864) [-3891.674] (-3885.152) * (-3884.907) (-3893.650) [-3881.121] (-3882.054) -- 0:04:44 4000 -- [-3884.340] (-3901.070) (-3884.694) (-3884.357) * [-3887.498] (-3889.691) (-3882.103) (-3881.538) -- 0:04:09 4500 -- (-3883.541) (-3890.642) [-3885.134] (-3882.438) * (-3888.133) (-3887.509) [-3883.098] (-3880.764) -- 0:03:41 5000 -- (-3892.805) (-3888.345) (-3886.842) [-3884.814] * (-3883.998) (-3885.059) (-3885.867) [-3882.273] -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-3889.056) [-3882.394] (-3889.158) (-3881.286) * (-3891.530) [-3887.116] (-3881.320) (-3883.151) -- 0:03:00 6000 -- (-3883.925) (-3881.237) (-3885.625) [-3885.658] * (-3896.320) (-3883.104) [-3880.522] (-3883.221) -- 0:02:45 6500 -- (-3878.818) [-3879.686] (-3887.838) (-3882.192) * [-3887.240] (-3889.933) (-3883.287) (-3883.779) -- 0:05:05 7000 -- (-3882.599) (-3881.529) [-3881.702] (-3882.058) * [-3882.982] (-3887.758) (-3883.705) (-3882.528) -- 0:04:43 7500 -- (-3883.201) (-3883.448) [-3886.329] (-3890.732) * (-3888.374) [-3888.474] (-3883.093) (-3883.124) -- 0:04:24 8000 -- (-3887.154) (-3887.126) (-3883.788) [-3883.557] * (-3891.227) [-3883.063] (-3884.286) (-3885.117) -- 0:04:08 8500 -- [-3884.659] (-3886.386) (-3886.670) (-3885.181) * (-3892.063) [-3886.012] (-3883.475) (-3885.734) -- 0:03:53 9000 -- [-3883.599] (-3890.081) (-3888.627) (-3883.937) * (-3891.377) (-3884.240) (-3885.235) [-3882.990] -- 0:03:40 9500 -- (-3886.265) [-3887.997] (-3885.385) (-3884.020) * (-3890.187) [-3883.888] (-3882.840) (-3883.354) -- 0:03:28 10000 -- [-3884.096] (-3885.535) (-3888.643) (-3884.728) * (-3891.564) (-3887.223) [-3883.694] (-3888.625) -- 0:04:57 Average standard deviation of split frequencies: 0.000000 10500 -- (-3889.286) (-3885.623) [-3887.806] (-3883.530) * (-3883.006) [-3885.327] (-3884.436) (-3882.774) -- 0:04:42 11000 -- (-3888.034) [-3881.226] (-3883.200) (-3883.751) * (-3887.297) (-3885.691) (-3881.363) [-3886.346] -- 0:04:29 11500 -- [-3887.272] (-3881.989) (-3885.324) (-3889.981) * (-3879.943) [-3884.465] (-3881.582) (-3881.252) -- 0:04:17 12000 -- (-3883.725) (-3884.387) [-3886.041] (-3887.052) * (-3886.640) (-3882.448) [-3882.733] (-3885.757) -- 0:04:07 12500 -- (-3894.186) (-3888.361) [-3882.473] (-3888.896) * [-3882.607] (-3886.411) (-3889.357) (-3888.216) -- 0:03:57 13000 -- (-3885.319) [-3885.562] (-3885.833) (-3891.058) * (-3891.175) [-3881.700] (-3882.778) (-3886.408) -- 0:03:47 13500 -- [-3883.932] (-3889.954) (-3883.905) (-3890.965) * (-3890.763) (-3882.851) (-3896.059) [-3883.606] -- 0:04:52 14000 -- (-3887.076) (-3885.192) [-3880.113] (-3893.468) * (-3886.188) (-3881.814) (-3892.460) [-3881.863] -- 0:04:41 14500 -- (-3882.778) [-3884.086] (-3882.421) (-3887.826) * [-3884.582] (-3885.783) (-3885.071) (-3883.772) -- 0:04:31 15000 -- (-3880.702) [-3882.540] (-3881.205) (-3891.775) * (-3886.100) (-3884.616) (-3885.746) [-3886.801] -- 0:04:22 Average standard deviation of split frequencies: 0.000000 15500 -- (-3886.978) (-3886.662) (-3880.763) [-3890.701] * (-3886.094) (-3882.080) (-3888.388) [-3886.902] -- 0:04:14 16000 -- [-3887.802] (-3884.610) (-3888.870) (-3890.432) * (-3889.581) (-3883.994) [-3889.349] (-3888.085) -- 0:04:06 16500 -- (-3889.965) (-3883.881) [-3885.499] (-3891.039) * (-3884.880) [-3889.460] (-3883.259) (-3883.091) -- 0:03:58 17000 -- (-3895.515) [-3885.655] (-3888.090) (-3887.080) * [-3883.008] (-3881.321) (-3883.802) (-3885.646) -- 0:04:49 17500 -- (-3889.718) (-3886.026) [-3883.227] (-3896.615) * (-3883.787) (-3879.074) (-3890.289) [-3883.616] -- 0:04:40 18000 -- (-3891.685) (-3884.460) [-3880.361] (-3893.795) * (-3882.431) (-3886.737) [-3881.588] (-3882.528) -- 0:04:32 18500 -- [-3882.317] (-3881.200) (-3883.284) (-3891.085) * (-3884.973) [-3880.348] (-3883.777) (-3882.209) -- 0:04:25 19000 -- [-3882.598] (-3882.929) (-3887.649) (-3886.152) * (-3879.585) (-3885.069) [-3886.464] (-3883.085) -- 0:04:18 19500 -- [-3884.099] (-3882.309) (-3884.537) (-3885.677) * (-3882.883) (-3880.534) [-3890.209] (-3882.827) -- 0:04:11 20000 -- (-3890.042) [-3880.479] (-3882.610) (-3887.719) * (-3885.814) [-3888.583] (-3885.129) (-3891.064) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 20500 -- [-3883.628] (-3887.032) (-3888.559) (-3882.586) * [-3886.438] (-3881.651) (-3887.973) (-3883.282) -- 0:04:46 21000 -- [-3885.012] (-3885.369) (-3890.667) (-3884.536) * [-3881.064] (-3886.548) (-3882.485) (-3886.648) -- 0:04:39 21500 -- (-3888.989) (-3884.454) [-3886.131] (-3887.182) * (-3881.848) [-3893.358] (-3882.248) (-3885.472) -- 0:04:33 22000 -- (-3884.364) (-3882.870) [-3884.866] (-3881.457) * (-3885.190) [-3889.390] (-3883.154) (-3888.090) -- 0:04:26 22500 -- [-3892.607] (-3890.714) (-3883.070) (-3886.405) * (-3886.681) (-3886.538) [-3881.866] (-3888.640) -- 0:04:20 23000 -- (-3897.205) (-3888.305) [-3883.042] (-3886.425) * (-3893.194) [-3880.994] (-3890.045) (-3883.760) -- 0:04:14 23500 -- (-3891.116) (-3892.426) [-3884.388] (-3881.954) * (-3888.262) [-3884.342] (-3888.036) (-3885.941) -- 0:04:09 24000 -- (-3886.686) (-3880.655) [-3887.203] (-3897.783) * (-3887.322) (-3893.464) [-3888.653] (-3889.286) -- 0:04:44 24500 -- (-3891.197) (-3887.509) [-3881.396] (-3897.744) * (-3887.188) [-3888.827] (-3894.784) (-3886.896) -- 0:04:38 25000 -- (-3884.218) (-3886.974) [-3886.104] (-3890.163) * [-3886.369] (-3885.202) (-3889.311) (-3882.745) -- 0:04:33 Average standard deviation of split frequencies: 0.000000 25500 -- (-3888.015) (-3895.844) [-3888.900] (-3887.867) * (-3884.167) [-3888.672] (-3888.365) (-3886.946) -- 0:04:27 26000 -- (-3881.207) (-3885.025) (-3884.013) [-3884.651] * (-3888.520) (-3884.756) (-3891.219) [-3886.550] -- 0:04:22 26500 -- (-3890.729) (-3891.747) (-3888.802) [-3880.990] * (-3885.066) (-3887.488) [-3881.791] (-3884.808) -- 0:04:17 27000 -- (-3888.818) (-3884.877) [-3883.647] (-3886.936) * (-3886.785) (-3888.760) [-3884.070] (-3879.301) -- 0:04:12 27500 -- (-3887.473) [-3888.629] (-3885.746) (-3888.309) * (-3884.410) (-3882.313) (-3882.690) [-3884.906] -- 0:04:42 28000 -- (-3882.236) [-3888.105] (-3881.783) (-3891.531) * (-3882.039) [-3882.252] (-3884.052) (-3884.777) -- 0:04:37 28500 -- [-3882.852] (-3885.892) (-3887.063) (-3889.728) * (-3887.151) (-3888.498) [-3895.076] (-3882.516) -- 0:04:32 29000 -- (-3884.825) (-3889.386) (-3882.477) [-3881.099] * (-3897.615) (-3882.710) [-3883.851] (-3885.783) -- 0:04:27 29500 -- (-3883.641) (-3882.797) (-3887.909) [-3886.623] * [-3883.671] (-3882.702) (-3882.959) (-3888.023) -- 0:04:23 30000 -- (-3886.237) (-3883.845) [-3881.304] (-3883.453) * (-3883.383) (-3885.807) [-3884.250] (-3894.079) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 30500 -- (-3885.507) (-3883.194) (-3884.141) [-3883.617] * [-3879.022] (-3883.324) (-3891.503) (-3891.780) -- 0:04:14 31000 -- [-3892.745] (-3885.601) (-3885.703) (-3884.395) * (-3881.098) (-3883.161) (-3892.518) [-3882.442] -- 0:04:41 31500 -- (-3886.786) [-3883.678] (-3880.454) (-3888.071) * (-3886.673) (-3887.310) (-3886.249) [-3880.707] -- 0:04:36 32000 -- (-3886.444) (-3881.576) [-3882.579] (-3886.186) * (-3890.921) (-3887.463) (-3883.725) [-3881.091] -- 0:04:32 32500 -- (-3884.682) (-3886.123) (-3883.891) [-3885.862] * (-3887.871) (-3893.017) [-3885.404] (-3888.435) -- 0:04:27 33000 -- (-3889.651) (-3881.550) [-3890.008] (-3888.914) * [-3884.059] (-3886.424) (-3891.737) (-3884.975) -- 0:04:23 33500 -- [-3891.750] (-3884.353) (-3884.695) (-3884.554) * (-3890.506) (-3887.155) (-3884.874) [-3884.044] -- 0:04:19 34000 -- (-3882.537) [-3883.367] (-3887.170) (-3883.629) * [-3883.284] (-3886.756) (-3887.976) (-3890.700) -- 0:04:15 34500 -- (-3884.283) (-3886.526) (-3894.408) [-3884.495] * (-3882.754) [-3879.956] (-3885.470) (-3885.856) -- 0:04:39 35000 -- (-3883.202) (-3888.064) (-3886.470) [-3883.955] * (-3881.717) [-3882.462] (-3889.410) (-3892.880) -- 0:04:35 Average standard deviation of split frequencies: 0.000000 35500 -- [-3881.882] (-3886.415) (-3882.333) (-3882.047) * (-3884.913) (-3883.076) [-3890.143] (-3886.663) -- 0:04:31 36000 -- (-3883.103) (-3886.098) (-3891.183) [-3884.818] * (-3884.644) (-3885.161) [-3886.904] (-3892.602) -- 0:04:27 36500 -- (-3880.713) (-3889.667) [-3883.732] (-3884.594) * (-3881.446) (-3881.216) [-3887.604] (-3884.996) -- 0:04:23 37000 -- [-3883.391] (-3889.754) (-3890.718) (-3884.699) * (-3881.598) (-3882.569) [-3883.755] (-3883.721) -- 0:04:20 37500 -- (-3887.324) (-3886.438) [-3884.903] (-3882.555) * (-3882.903) (-3884.253) (-3882.838) [-3890.225] -- 0:04:16 38000 -- (-3882.562) (-3885.422) [-3885.080] (-3887.514) * (-3889.011) (-3880.574) (-3886.867) [-3885.583] -- 0:04:38 38500 -- [-3883.098] (-3884.386) (-3883.845) (-3897.593) * (-3886.959) [-3880.414] (-3882.234) (-3884.728) -- 0:04:34 39000 -- (-3885.383) (-3885.357) (-3889.680) [-3889.807] * (-3888.755) (-3889.948) [-3885.740] (-3889.319) -- 0:04:31 39500 -- (-3889.256) [-3882.580] (-3893.967) (-3890.565) * (-3883.826) (-3884.793) (-3887.393) [-3884.640] -- 0:04:27 40000 -- (-3885.549) (-3882.381) (-3882.120) [-3887.184] * [-3883.478] (-3885.841) (-3883.525) (-3881.289) -- 0:04:24 Average standard deviation of split frequencies: 0.000000 40500 -- [-3887.805] (-3884.683) (-3886.682) (-3885.843) * [-3882.637] (-3881.692) (-3887.321) (-3882.871) -- 0:04:20 41000 -- (-3886.031) (-3885.294) (-3883.799) [-3884.219] * (-3884.501) (-3889.649) (-3885.320) [-3884.415] -- 0:04:17 41500 -- (-3883.886) (-3882.023) (-3881.187) [-3884.943] * (-3884.899) [-3882.046] (-3886.405) (-3884.182) -- 0:04:37 42000 -- (-3880.237) [-3884.091] (-3885.674) (-3881.722) * [-3889.619] (-3884.619) (-3884.453) (-3886.339) -- 0:04:33 42500 -- (-3883.598) [-3882.832] (-3885.064) (-3881.468) * (-3883.353) [-3882.720] (-3892.132) (-3882.334) -- 0:04:30 43000 -- (-3884.902) [-3885.479] (-3882.116) (-3882.306) * (-3891.277) [-3882.562] (-3883.603) (-3883.417) -- 0:04:27 43500 -- (-3895.002) (-3888.465) [-3887.963] (-3887.515) * (-3887.671) [-3884.291] (-3886.151) (-3882.001) -- 0:04:23 44000 -- (-3888.670) (-3886.078) [-3882.497] (-3887.177) * (-3887.387) [-3881.116] (-3883.718) (-3885.285) -- 0:04:20 44500 -- [-3886.891] (-3889.471) (-3888.810) (-3881.942) * (-3885.383) (-3886.882) [-3882.303] (-3880.926) -- 0:04:17 45000 -- (-3886.572) (-3886.627) [-3885.541] (-3886.928) * (-3881.412) (-3882.633) [-3886.216] (-3884.824) -- 0:04:35 Average standard deviation of split frequencies: 0.000000 45500 -- (-3885.455) (-3885.618) (-3881.988) [-3886.252] * (-3885.179) (-3880.606) [-3883.136] (-3887.991) -- 0:04:32 46000 -- [-3884.077] (-3887.047) (-3881.549) (-3882.348) * (-3886.784) [-3887.622] (-3883.121) (-3889.755) -- 0:04:29 46500 -- (-3881.209) (-3887.171) (-3883.465) [-3880.990] * (-3893.298) [-3881.574] (-3885.269) (-3889.684) -- 0:04:26 47000 -- (-3885.633) (-3882.932) [-3883.892] (-3883.807) * (-3881.221) [-3884.728] (-3886.843) (-3882.210) -- 0:04:23 47500 -- [-3881.119] (-3885.514) (-3881.957) (-3881.873) * (-3885.816) [-3882.735] (-3886.429) (-3879.695) -- 0:04:20 48000 -- (-3881.908) (-3885.761) (-3890.792) [-3882.508] * [-3884.077] (-3884.560) (-3889.042) (-3883.082) -- 0:04:17 48500 -- (-3882.279) [-3886.170] (-3892.595) (-3889.575) * (-3881.064) [-3891.844] (-3892.548) (-3888.954) -- 0:04:34 49000 -- (-3883.788) (-3885.201) (-3882.179) [-3884.183] * (-3882.937) [-3888.771] (-3886.371) (-3890.131) -- 0:04:31 49500 -- (-3881.831) (-3893.319) [-3887.904] (-3883.821) * (-3882.198) [-3883.526] (-3888.452) (-3882.869) -- 0:04:28 50000 -- (-3883.553) (-3883.347) (-3886.195) [-3885.036] * (-3888.198) [-3886.426] (-3888.739) (-3885.863) -- 0:04:26 Average standard deviation of split frequencies: 0.000000 50500 -- (-3886.356) (-3885.108) [-3883.114] (-3889.084) * (-3893.913) (-3885.893) [-3885.977] (-3892.439) -- 0:04:23 51000 -- (-3883.368) (-3886.622) (-3881.210) [-3884.186] * (-3891.216) (-3889.815) [-3893.706] (-3887.713) -- 0:04:20 51500 -- (-3881.988) [-3887.788] (-3886.921) (-3886.640) * (-3891.114) (-3886.137) (-3893.818) [-3890.294] -- 0:04:17 52000 -- [-3884.657] (-3891.769) (-3883.665) (-3885.671) * (-3885.756) [-3887.837] (-3886.376) (-3890.079) -- 0:04:33 52500 -- (-3880.803) (-3891.083) [-3877.965] (-3891.522) * (-3881.721) (-3888.934) (-3884.644) [-3882.294] -- 0:04:30 53000 -- (-3887.697) (-3893.712) (-3884.289) [-3886.380] * (-3879.891) (-3889.449) [-3884.272] (-3889.796) -- 0:04:28 53500 -- (-3886.536) [-3886.693] (-3881.854) (-3886.406) * (-3884.165) (-3888.263) [-3886.680] (-3882.191) -- 0:04:25 54000 -- (-3882.117) (-3883.499) [-3879.143] (-3887.852) * (-3881.592) (-3884.981) (-3881.533) [-3890.752] -- 0:04:22 54500 -- (-3880.633) [-3890.594] (-3889.632) (-3885.225) * (-3880.696) (-3886.337) [-3881.641] (-3886.622) -- 0:04:20 55000 -- (-3887.352) (-3894.976) (-3883.549) [-3882.353] * (-3886.717) (-3884.637) [-3883.676] (-3880.792) -- 0:04:17 Average standard deviation of split frequencies: 0.000000 55500 -- (-3890.200) [-3889.153] (-3888.828) (-3889.395) * (-3884.601) [-3878.884] (-3884.423) (-3883.929) -- 0:04:32 56000 -- [-3887.271] (-3886.571) (-3885.304) (-3890.026) * (-3885.348) (-3888.701) [-3882.195] (-3883.856) -- 0:04:29 56500 -- [-3885.375] (-3882.244) (-3904.285) (-3888.793) * (-3888.251) (-3887.728) [-3882.325] (-3884.239) -- 0:04:27 57000 -- [-3882.547] (-3894.604) (-3900.120) (-3883.536) * (-3888.577) (-3886.671) (-3885.438) [-3882.434] -- 0:04:24 57500 -- (-3880.550) (-3883.663) (-3887.368) [-3882.522] * (-3889.785) (-3889.365) [-3884.181] (-3883.318) -- 0:04:22 58000 -- (-3882.738) (-3886.492) [-3888.365] (-3886.816) * (-3890.282) (-3886.921) [-3886.207] (-3882.230) -- 0:04:19 58500 -- (-3884.289) (-3884.839) [-3884.867] (-3887.347) * (-3884.338) [-3884.669] (-3885.205) (-3882.217) -- 0:04:17 59000 -- (-3882.905) (-3887.057) [-3886.563] (-3889.215) * (-3884.691) (-3889.166) [-3884.316] (-3884.985) -- 0:04:31 59500 -- (-3881.291) [-3881.393] (-3882.027) (-3889.983) * (-3883.648) (-3887.433) (-3881.792) [-3881.977] -- 0:04:28 60000 -- (-3881.585) [-3885.119] (-3882.671) (-3892.470) * (-3883.807) (-3883.748) [-3880.781] (-3891.409) -- 0:04:26 Average standard deviation of split frequencies: 0.000000 60500 -- [-3886.026] (-3887.553) (-3886.708) (-3885.444) * [-3885.135] (-3884.040) (-3883.886) (-3881.979) -- 0:04:23 61000 -- (-3883.466) (-3884.969) (-3886.916) [-3886.743] * [-3884.613] (-3884.862) (-3888.573) (-3886.405) -- 0:04:21 61500 -- (-3881.616) [-3885.916] (-3889.364) (-3893.675) * (-3887.298) [-3886.941] (-3882.509) (-3891.332) -- 0:04:19 62000 -- (-3881.684) (-3882.846) [-3885.126] (-3888.027) * (-3884.591) (-3890.138) [-3880.543] (-3885.706) -- 0:04:17 62500 -- (-3880.617) (-3889.428) (-3899.142) [-3888.933] * [-3885.723] (-3888.327) (-3887.356) (-3885.152) -- 0:04:30 63000 -- [-3886.167] (-3884.812) (-3888.054) (-3892.257) * [-3881.439] (-3886.810) (-3886.180) (-3884.200) -- 0:04:27 63500 -- (-3887.987) (-3886.425) [-3886.342] (-3886.042) * (-3883.804) (-3883.551) [-3884.607] (-3887.781) -- 0:04:25 64000 -- (-3885.464) [-3889.913] (-3885.829) (-3884.543) * (-3884.870) (-3884.963) [-3885.645] (-3887.561) -- 0:04:23 64500 -- (-3883.436) (-3889.720) (-3892.724) [-3886.488] * (-3880.122) [-3886.160] (-3883.463) (-3894.496) -- 0:04:21 65000 -- [-3884.184] (-3886.658) (-3884.902) (-3884.866) * (-3883.940) (-3887.085) [-3885.137] (-3890.122) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 65500 -- (-3884.299) [-3885.211] (-3880.490) (-3884.198) * (-3889.473) (-3886.408) [-3887.319] (-3892.355) -- 0:04:16 66000 -- (-3886.796) (-3889.124) (-3890.673) [-3885.537] * (-3888.823) (-3884.450) [-3885.509] (-3882.660) -- 0:04:28 66500 -- (-3882.339) [-3885.134] (-3886.771) (-3881.771) * [-3885.176] (-3890.468) (-3885.844) (-3889.541) -- 0:04:26 67000 -- (-3884.331) [-3888.590] (-3894.714) (-3886.221) * (-3885.740) (-3884.389) (-3885.162) [-3885.624] -- 0:04:24 67500 -- (-3883.988) (-3886.938) [-3886.768] (-3883.008) * (-3887.550) (-3882.938) (-3884.417) [-3883.667] -- 0:04:22 68000 -- (-3886.990) [-3884.368] (-3885.114) (-3884.251) * (-3891.028) [-3881.415] (-3880.255) (-3882.313) -- 0:04:20 68500 -- [-3886.519] (-3881.577) (-3883.886) (-3886.295) * (-3888.895) (-3891.571) (-3882.303) [-3882.575] -- 0:04:18 69000 -- (-3884.346) (-3885.028) [-3887.098] (-3889.437) * (-3888.320) (-3881.645) (-3883.643) [-3878.399] -- 0:04:16 69500 -- (-3880.247) [-3885.531] (-3888.227) (-3889.237) * (-3882.925) [-3886.135] (-3889.824) (-3884.403) -- 0:04:27 70000 -- (-3887.240) (-3885.308) (-3892.813) [-3886.685] * (-3886.477) [-3887.525] (-3885.148) (-3883.892) -- 0:04:25 Average standard deviation of split frequencies: 0.000000 70500 -- (-3888.024) (-3884.375) (-3886.653) [-3887.472] * (-3890.136) [-3883.383] (-3884.413) (-3887.911) -- 0:04:23 71000 -- (-3883.756) (-3883.215) [-3883.423] (-3883.543) * [-3890.115] (-3882.527) (-3888.236) (-3887.310) -- 0:04:21 71500 -- (-3887.453) (-3883.759) [-3884.263] (-3880.882) * (-3894.312) (-3886.958) (-3883.993) [-3888.562] -- 0:04:19 72000 -- [-3880.968] (-3881.571) (-3879.563) (-3882.746) * (-3895.298) (-3891.608) [-3885.039] (-3883.808) -- 0:04:17 72500 -- (-3888.684) (-3887.369) (-3888.327) [-3886.519] * (-3891.017) (-3892.166) (-3889.810) [-3882.304] -- 0:04:15 73000 -- (-3892.120) (-3884.682) [-3884.574] (-3892.135) * (-3889.784) (-3892.722) [-3886.696] (-3884.345) -- 0:04:26 73500 -- (-3889.890) (-3886.256) (-3886.739) [-3890.525] * [-3886.434] (-3887.573) (-3886.075) (-3882.825) -- 0:04:24 74000 -- (-3887.388) [-3884.147] (-3883.396) (-3887.445) * (-3890.015) (-3892.922) (-3894.081) [-3883.738] -- 0:04:22 74500 -- [-3882.440] (-3887.347) (-3888.380) (-3886.453) * [-3887.887] (-3891.173) (-3886.529) (-3893.888) -- 0:04:20 75000 -- (-3888.958) [-3884.569] (-3885.412) (-3888.970) * [-3888.459] (-3882.776) (-3886.663) (-3883.237) -- 0:04:19 Average standard deviation of split frequencies: 0.000000 75500 -- (-3891.910) [-3882.161] (-3888.716) (-3888.888) * (-3884.858) [-3888.123] (-3892.912) (-3887.844) -- 0:04:17 76000 -- (-3894.098) (-3881.569) [-3885.734] (-3884.380) * (-3894.855) [-3887.203] (-3893.964) (-3885.766) -- 0:04:15 76500 -- (-3891.208) (-3885.842) [-3883.419] (-3885.737) * [-3884.417] (-3885.757) (-3888.037) (-3886.694) -- 0:04:25 77000 -- (-3887.793) (-3888.434) (-3881.209) [-3887.619] * (-3892.324) (-3880.170) (-3893.424) [-3880.666] -- 0:04:23 77500 -- [-3887.851] (-3885.966) (-3884.681) (-3888.629) * (-3885.326) (-3885.175) (-3885.300) [-3884.566] -- 0:04:21 78000 -- [-3883.492] (-3889.297) (-3885.098) (-3880.238) * (-3886.672) (-3881.831) [-3881.455] (-3887.261) -- 0:04:20 78500 -- (-3881.305) (-3879.851) (-3882.264) [-3884.439] * (-3887.438) (-3888.000) [-3884.913] (-3886.427) -- 0:04:18 79000 -- (-3880.482) [-3881.601] (-3885.939) (-3887.937) * [-3881.571] (-3889.095) (-3884.738) (-3885.079) -- 0:04:16 79500 -- (-3883.970) (-3886.032) (-3882.541) [-3882.377] * [-3883.546] (-3881.765) (-3884.930) (-3884.730) -- 0:04:14 80000 -- (-3884.652) (-3887.046) [-3881.371] (-3882.992) * (-3888.668) (-3885.615) [-3890.666] (-3889.576) -- 0:04:24 Average standard deviation of split frequencies: 0.000000 80500 -- (-3891.621) [-3891.014] (-3889.262) (-3884.031) * (-3887.075) (-3885.796) [-3893.143] (-3884.358) -- 0:04:22 81000 -- (-3885.204) (-3893.169) (-3887.137) [-3882.307] * (-3891.430) (-3883.387) [-3885.945] (-3885.827) -- 0:04:20 81500 -- [-3883.728] (-3897.131) (-3891.245) (-3882.508) * (-3883.096) [-3886.339] (-3880.333) (-3885.258) -- 0:04:19 82000 -- (-3885.232) (-3890.847) (-3885.473) [-3880.509] * (-3882.619) [-3887.641] (-3881.925) (-3885.199) -- 0:04:17 82500 -- (-3888.638) (-3888.046) (-3884.204) [-3882.839] * (-3879.531) [-3885.134] (-3881.432) (-3885.133) -- 0:04:15 83000 -- (-3886.412) (-3884.940) (-3881.221) [-3891.152] * [-3880.149] (-3884.547) (-3890.204) (-3880.352) -- 0:04:14 83500 -- (-3892.705) (-3883.513) (-3880.068) [-3886.479] * [-3882.385] (-3882.722) (-3883.762) (-3889.061) -- 0:04:23 84000 -- (-3887.103) (-3884.041) (-3886.459) [-3890.977] * (-3888.437) (-3890.749) (-3885.306) [-3887.614] -- 0:04:21 84500 -- (-3888.632) [-3880.945] (-3889.386) (-3889.365) * (-3882.088) (-3893.289) [-3884.967] (-3885.862) -- 0:04:20 85000 -- (-3883.886) [-3883.179] (-3886.700) (-3886.693) * (-3885.087) [-3882.107] (-3880.931) (-3893.453) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 85500 -- (-3884.774) (-3882.271) [-3892.166] (-3890.024) * (-3894.133) [-3887.150] (-3885.219) (-3888.999) -- 0:04:16 86000 -- [-3881.304] (-3885.213) (-3883.510) (-3888.788) * [-3882.035] (-3882.848) (-3886.865) (-3890.059) -- 0:04:15 86500 -- (-3884.823) [-3881.015] (-3881.698) (-3886.078) * (-3882.928) (-3887.471) (-3882.858) [-3885.524] -- 0:04:13 87000 -- (-3885.099) (-3884.596) [-3880.581] (-3883.677) * (-3887.246) [-3882.067] (-3887.121) (-3886.595) -- 0:04:22 87500 -- (-3885.569) [-3882.519] (-3886.781) (-3880.894) * (-3882.786) (-3884.513) [-3884.957] (-3888.090) -- 0:04:20 88000 -- (-3893.426) (-3894.365) (-3882.164) [-3887.691] * (-3886.009) [-3880.703] (-3880.601) (-3884.226) -- 0:04:19 88500 -- (-3887.063) [-3889.806] (-3883.172) (-3891.900) * (-3884.142) (-3885.112) [-3881.172] (-3885.967) -- 0:04:17 89000 -- (-3882.412) (-3897.829) [-3885.374] (-3885.590) * (-3885.082) (-3888.034) [-3882.504] (-3882.366) -- 0:04:15 89500 -- (-3892.880) (-3887.432) (-3881.136) [-3880.526] * (-3886.422) (-3887.969) (-3889.033) [-3884.658] -- 0:04:14 90000 -- [-3884.392] (-3885.987) (-3881.211) (-3884.198) * (-3893.407) (-3881.679) [-3884.692] (-3889.068) -- 0:04:12 Average standard deviation of split frequencies: 0.000000 90500 -- (-3884.430) [-3882.245] (-3883.672) (-3890.624) * (-3890.150) (-3885.496) (-3885.867) [-3882.575] -- 0:04:11 91000 -- [-3882.918] (-3883.353) (-3884.579) (-3887.976) * (-3893.328) (-3893.154) [-3886.715] (-3887.517) -- 0:04:19 91500 -- (-3885.395) (-3887.108) (-3880.935) [-3885.464] * (-3886.480) (-3886.553) [-3890.346] (-3890.184) -- 0:04:18 92000 -- (-3883.568) (-3890.378) [-3887.950] (-3891.189) * (-3898.652) [-3883.313] (-3886.787) (-3882.122) -- 0:04:16 92500 -- [-3882.451] (-3894.413) (-3892.672) (-3888.432) * (-3885.375) [-3884.359] (-3883.839) (-3892.209) -- 0:04:15 93000 -- (-3888.990) (-3889.356) (-3890.058) [-3883.987] * [-3889.157] (-3892.824) (-3885.037) (-3886.134) -- 0:04:13 93500 -- (-3885.200) [-3884.237] (-3890.737) (-3885.112) * (-3883.957) (-3884.718) [-3882.966] (-3881.599) -- 0:04:12 94000 -- (-3886.073) (-3887.575) (-3886.982) [-3884.398] * (-3890.368) (-3893.108) (-3881.482) [-3881.902] -- 0:04:10 94500 -- (-3885.714) (-3890.279) (-3883.204) [-3883.318] * (-3884.711) [-3892.718] (-3880.835) (-3883.057) -- 0:04:18 95000 -- (-3884.474) (-3884.637) [-3882.073] (-3884.465) * [-3887.983] (-3886.714) (-3892.106) (-3881.901) -- 0:04:17 Average standard deviation of split frequencies: 0.000000 95500 -- (-3882.538) [-3882.928] (-3887.910) (-3882.081) * (-3893.158) [-3879.854] (-3880.402) (-3880.687) -- 0:04:15 96000 -- (-3881.164) [-3880.936] (-3887.167) (-3887.633) * (-3886.311) (-3885.529) [-3883.934] (-3889.250) -- 0:04:14 96500 -- (-3882.491) [-3880.840] (-3890.419) (-3883.532) * [-3886.106] (-3882.475) (-3886.080) (-3880.063) -- 0:04:12 97000 -- [-3882.987] (-3888.042) (-3882.432) (-3887.472) * (-3884.481) (-3885.345) (-3884.147) [-3886.208] -- 0:04:11 97500 -- [-3887.396] (-3888.266) (-3891.401) (-3886.928) * [-3886.867] (-3888.721) (-3881.164) (-3892.535) -- 0:04:09 98000 -- (-3889.505) (-3883.719) [-3886.029] (-3883.312) * (-3887.356) [-3888.742] (-3883.831) (-3891.457) -- 0:04:17 98500 -- (-3879.267) (-3884.300) [-3887.617] (-3884.958) * (-3891.399) [-3883.077] (-3884.363) (-3893.045) -- 0:04:16 99000 -- (-3886.105) (-3887.089) (-3894.921) [-3884.184] * (-3883.579) (-3887.399) [-3885.046] (-3886.290) -- 0:04:14 99500 -- (-3882.723) [-3882.931] (-3888.593) (-3883.661) * (-3885.952) (-3886.143) (-3883.174) [-3882.115] -- 0:04:13 100000 -- (-3890.191) [-3884.389] (-3886.535) (-3881.670) * [-3886.619] (-3887.558) (-3883.298) (-3888.945) -- 0:04:11 Average standard deviation of split frequencies: 0.000000 100500 -- (-3885.075) [-3884.452] (-3886.835) (-3883.706) * (-3891.059) (-3884.611) (-3879.575) [-3887.310] -- 0:04:10 101000 -- (-3885.690) (-3888.360) (-3886.543) [-3884.423] * (-3889.260) [-3882.615] (-3886.054) (-3887.980) -- 0:04:09 101500 -- (-3885.392) [-3887.116] (-3888.252) (-3891.239) * [-3884.297] (-3884.742) (-3887.504) (-3887.748) -- 0:04:16 102000 -- [-3883.590] (-3895.087) (-3886.716) (-3884.258) * (-3889.647) (-3889.493) (-3883.486) [-3885.117] -- 0:04:15 102500 -- (-3889.647) [-3886.984] (-3886.306) (-3882.081) * (-3885.939) (-3885.279) [-3882.443] (-3892.038) -- 0:04:13 103000 -- [-3881.444] (-3886.620) (-3881.825) (-3887.729) * (-3887.559) [-3885.069] (-3881.453) (-3887.034) -- 0:04:12 103500 -- (-3885.196) (-3881.429) [-3878.874] (-3884.732) * (-3884.437) (-3886.822) [-3881.550] (-3881.131) -- 0:04:11 104000 -- [-3883.473] (-3885.266) (-3888.913) (-3887.690) * (-3886.307) [-3885.602] (-3881.870) (-3884.767) -- 0:04:09 104500 -- (-3880.980) [-3884.931] (-3886.687) (-3896.392) * [-3886.174] (-3889.768) (-3884.761) (-3886.459) -- 0:04:08 105000 -- (-3882.872) (-3886.296) [-3881.877] (-3890.874) * (-3891.116) [-3883.752] (-3889.952) (-3890.738) -- 0:04:15 Average standard deviation of split frequencies: 0.000000 105500 -- (-3890.569) [-3885.484] (-3891.295) (-3888.195) * [-3889.059] (-3882.827) (-3883.104) (-3886.616) -- 0:04:14 106000 -- (-3885.318) [-3886.475] (-3879.258) (-3883.571) * (-3888.447) (-3887.155) (-3886.248) [-3886.123] -- 0:04:13 106500 -- [-3881.918] (-3882.447) (-3884.250) (-3881.946) * (-3888.470) [-3883.393] (-3893.564) (-3882.586) -- 0:04:11 107000 -- (-3882.949) [-3881.505] (-3883.763) (-3886.228) * [-3886.462] (-3885.110) (-3887.784) (-3889.045) -- 0:04:10 107500 -- (-3887.894) (-3886.769) [-3880.111] (-3881.445) * (-3883.212) (-3887.125) (-3886.048) [-3884.741] -- 0:04:09 108000 -- (-3889.566) [-3883.449] (-3883.901) (-3881.375) * (-3884.659) (-3886.919) [-3883.881] (-3882.718) -- 0:04:07 108500 -- [-3882.539] (-3886.533) (-3883.560) (-3880.871) * (-3883.700) (-3881.233) [-3884.934] (-3882.294) -- 0:04:14 109000 -- (-3891.323) [-3883.444] (-3886.767) (-3885.648) * (-3894.076) (-3886.587) [-3887.203] (-3884.549) -- 0:04:13 109500 -- (-3889.148) (-3881.461) (-3885.489) [-3882.992] * (-3893.137) (-3888.094) [-3884.557] (-3880.564) -- 0:04:12 110000 -- (-3890.839) [-3881.160] (-3887.951) (-3884.487) * (-3888.699) (-3894.670) (-3882.646) [-3886.834] -- 0:04:10 Average standard deviation of split frequencies: 0.000000 110500 -- (-3889.836) (-3882.832) [-3885.184] (-3888.847) * (-3890.231) (-3885.477) (-3884.843) [-3893.226] -- 0:04:09 111000 -- [-3884.270] (-3885.418) (-3885.138) (-3889.327) * (-3883.500) [-3884.216] (-3885.816) (-3883.352) -- 0:04:08 111500 -- (-3887.335) (-3889.073) [-3885.033] (-3885.066) * (-3882.204) [-3887.305] (-3885.288) (-3885.088) -- 0:04:07 112000 -- (-3881.508) (-3890.062) [-3884.709] (-3885.431) * (-3884.852) (-3882.572) [-3879.800] (-3887.666) -- 0:04:13 112500 -- [-3879.593] (-3888.778) (-3883.692) (-3886.885) * (-3889.893) [-3886.800] (-3882.533) (-3884.807) -- 0:04:12 113000 -- (-3887.376) [-3884.834] (-3888.034) (-3884.880) * [-3888.506] (-3889.566) (-3886.517) (-3887.963) -- 0:04:11 113500 -- (-3884.311) [-3886.942] (-3887.490) (-3885.086) * (-3890.614) (-3890.814) (-3886.202) [-3888.978] -- 0:04:09 114000 -- (-3884.188) (-3888.527) (-3886.590) [-3885.373] * (-3887.141) (-3883.566) (-3887.278) [-3886.675] -- 0:04:08 114500 -- (-3884.498) (-3883.095) [-3881.775] (-3889.236) * (-3879.488) (-3889.913) (-3884.798) [-3881.868] -- 0:04:07 115000 -- (-3888.532) (-3886.184) [-3884.813] (-3882.749) * (-3881.250) (-3882.082) (-3887.035) [-3884.641] -- 0:04:06 Average standard deviation of split frequencies: 0.000000 115500 -- (-3886.473) [-3882.170] (-3891.035) (-3884.098) * (-3886.011) (-3885.486) [-3887.998] (-3887.007) -- 0:04:12 116000 -- (-3885.650) [-3890.052] (-3887.426) (-3880.982) * (-3884.224) (-3882.630) (-3883.446) [-3883.177] -- 0:04:11 116500 -- [-3888.467] (-3883.748) (-3884.240) (-3882.849) * (-3885.191) (-3889.272) (-3887.078) [-3886.581] -- 0:04:10 117000 -- (-3890.100) (-3885.065) (-3882.789) [-3883.606] * (-3882.335) (-3887.794) (-3888.060) [-3888.105] -- 0:04:09 117500 -- (-3891.344) (-3883.298) [-3884.048] (-3883.657) * (-3884.217) (-3887.500) [-3889.417] (-3883.886) -- 0:04:07 118000 -- (-3884.765) [-3886.642] (-3884.945) (-3888.139) * [-3883.750] (-3883.816) (-3888.490) (-3884.437) -- 0:04:06 118500 -- (-3883.839) (-3883.579) [-3880.326] (-3885.088) * (-3887.719) (-3882.412) (-3889.713) [-3890.521] -- 0:04:05 119000 -- (-3886.502) (-3888.167) [-3880.687] (-3886.932) * [-3890.472] (-3883.906) (-3887.276) (-3889.020) -- 0:04:11 119500 -- (-3891.064) (-3891.839) [-3885.635] (-3890.220) * (-3892.637) (-3895.235) (-3886.814) [-3881.451] -- 0:04:10 120000 -- (-3884.882) [-3890.626] (-3883.884) (-3884.796) * (-3902.793) (-3887.143) [-3883.441] (-3886.643) -- 0:04:09 Average standard deviation of split frequencies: 0.000000 120500 -- (-3882.052) [-3891.378] (-3889.445) (-3882.445) * (-3894.853) [-3882.751] (-3889.363) (-3884.733) -- 0:04:08 121000 -- (-3886.413) [-3887.809] (-3885.256) (-3889.545) * (-3887.854) [-3883.428] (-3882.844) (-3883.021) -- 0:04:06 121500 -- (-3884.476) (-3890.661) [-3882.685] (-3888.918) * [-3894.232] (-3881.586) (-3886.653) (-3885.209) -- 0:04:05 122000 -- [-3885.831] (-3883.774) (-3879.255) (-3884.793) * (-3885.883) (-3884.875) [-3884.578] (-3889.218) -- 0:04:04 122500 -- [-3883.755] (-3892.218) (-3880.409) (-3887.806) * (-3890.570) (-3886.239) [-3888.193] (-3885.900) -- 0:04:10 123000 -- (-3890.370) [-3884.100] (-3882.421) (-3890.353) * (-3884.667) (-3887.785) (-3898.102) [-3890.363] -- 0:04:09 123500 -- (-3888.554) (-3884.514) [-3883.939] (-3890.363) * (-3881.571) (-3889.489) (-3886.594) [-3885.962] -- 0:04:08 124000 -- (-3886.723) (-3882.730) [-3887.544] (-3884.707) * (-3887.789) (-3883.086) (-3892.746) [-3883.980] -- 0:04:07 124500 -- [-3882.964] (-3882.864) (-3886.225) (-3881.368) * (-3892.780) (-3884.586) (-3888.592) [-3891.824] -- 0:04:06 125000 -- [-3889.909] (-3884.156) (-3893.324) (-3889.525) * (-3881.701) (-3887.915) (-3891.743) [-3886.545] -- 0:04:04 Average standard deviation of split frequencies: 0.000000 125500 -- (-3886.370) (-3883.888) (-3893.222) [-3882.029] * (-3887.603) (-3890.635) [-3885.912] (-3888.477) -- 0:04:03 126000 -- [-3890.321] (-3884.059) (-3885.342) (-3881.455) * (-3887.221) (-3892.697) [-3891.830] (-3886.561) -- 0:04:09 126500 -- (-3891.463) (-3885.800) (-3888.258) [-3886.545] * (-3887.705) (-3889.180) [-3884.774] (-3880.879) -- 0:04:08 127000 -- (-3891.251) [-3886.389] (-3893.510) (-3881.670) * (-3886.898) (-3886.101) (-3887.762) [-3883.240] -- 0:04:07 127500 -- (-3893.876) (-3894.129) [-3885.709] (-3885.423) * (-3888.271) [-3885.142] (-3890.614) (-3883.101) -- 0:04:06 128000 -- [-3888.236] (-3897.457) (-3882.748) (-3892.407) * (-3889.562) [-3887.168] (-3895.996) (-3885.002) -- 0:04:05 128500 -- (-3888.736) (-3889.713) [-3885.462] (-3890.985) * [-3890.117] (-3884.180) (-3890.650) (-3883.396) -- 0:04:04 129000 -- (-3882.430) [-3883.266] (-3882.410) (-3890.945) * (-3889.165) (-3885.654) [-3886.522] (-3885.384) -- 0:04:03 129500 -- (-3884.137) (-3882.491) [-3882.978] (-3887.253) * (-3892.434) [-3890.746] (-3884.453) (-3881.979) -- 0:04:08 130000 -- (-3885.579) (-3880.481) [-3885.393] (-3884.809) * (-3891.241) (-3887.849) (-3885.536) [-3881.368] -- 0:04:07 Average standard deviation of split frequencies: 0.000000 130500 -- (-3883.193) [-3883.696] (-3883.356) (-3881.846) * (-3883.218) [-3884.091] (-3885.853) (-3888.594) -- 0:04:06 131000 -- (-3885.721) [-3880.705] (-3885.232) (-3885.081) * (-3886.436) (-3885.123) [-3886.939] (-3887.670) -- 0:04:05 131500 -- (-3882.666) [-3885.315] (-3888.767) (-3885.033) * (-3886.507) [-3882.704] (-3888.172) (-3886.354) -- 0:04:04 132000 -- [-3889.340] (-3889.656) (-3882.034) (-3881.381) * (-3886.461) (-3887.556) (-3887.692) [-3885.727] -- 0:04:03 132500 -- [-3884.290] (-3884.121) (-3890.374) (-3884.645) * (-3892.894) (-3881.378) [-3890.644] (-3887.119) -- 0:04:02 133000 -- (-3887.385) (-3886.363) [-3882.504] (-3887.947) * (-3884.655) (-3887.574) (-3886.163) [-3882.167] -- 0:04:07 133500 -- (-3897.651) (-3883.441) (-3884.965) [-3884.870] * (-3880.706) [-3892.022] (-3884.211) (-3888.333) -- 0:04:06 134000 -- (-3890.718) (-3884.569) (-3882.237) [-3883.966] * (-3880.770) [-3893.056] (-3892.740) (-3881.906) -- 0:04:05 134500 -- (-3884.841) (-3888.616) (-3880.988) [-3884.371] * (-3886.197) [-3884.602] (-3881.356) (-3884.928) -- 0:04:04 135000 -- (-3884.421) (-3886.320) [-3880.904] (-3888.513) * (-3883.353) (-3892.662) (-3883.131) [-3890.135] -- 0:04:03 Average standard deviation of split frequencies: 0.000000 135500 -- (-3883.832) [-3883.164] (-3890.257) (-3888.685) * [-3886.934] (-3888.643) (-3885.447) (-3897.571) -- 0:04:02 136000 -- (-3884.875) (-3886.589) (-3893.810) [-3891.570] * (-3879.840) (-3887.884) (-3885.960) [-3887.919] -- 0:04:01 136500 -- (-3892.432) (-3884.643) (-3893.499) [-3881.989] * (-3885.498) (-3885.671) (-3882.709) [-3888.165] -- 0:04:06 137000 -- (-3892.736) (-3884.726) (-3886.854) [-3882.247] * (-3885.065) (-3881.763) (-3887.104) [-3886.067] -- 0:04:05 137500 -- (-3887.923) [-3886.257] (-3884.957) (-3882.967) * (-3881.431) (-3885.230) (-3893.676) [-3885.332] -- 0:04:04 138000 -- (-3884.844) (-3884.512) [-3887.083] (-3882.514) * (-3888.938) (-3888.090) [-3882.780] (-3882.331) -- 0:04:03 138500 -- (-3885.912) (-3893.604) (-3885.074) [-3884.234] * [-3883.480] (-3885.205) (-3890.472) (-3885.742) -- 0:04:02 139000 -- (-3885.235) (-3883.182) [-3882.767] (-3887.536) * [-3885.776] (-3884.738) (-3884.283) (-3890.550) -- 0:04:01 139500 -- (-3882.367) (-3884.508) [-3881.938] (-3886.998) * (-3889.425) (-3884.585) [-3880.457] (-3892.493) -- 0:04:00 140000 -- (-3884.608) (-3885.505) [-3882.414] (-3887.878) * (-3894.040) (-3883.073) [-3882.893] (-3883.935) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 140500 -- (-3884.582) [-3884.055] (-3883.824) (-3886.663) * (-3889.473) (-3890.917) (-3890.252) [-3884.705] -- 0:04:04 141000 -- (-3884.088) (-3887.330) (-3883.248) [-3883.288] * (-3888.559) (-3884.361) [-3883.572] (-3886.159) -- 0:04:03 141500 -- (-3884.808) (-3884.239) [-3882.675] (-3881.043) * (-3887.871) (-3880.055) [-3881.364] (-3882.448) -- 0:04:02 142000 -- (-3883.392) [-3884.414] (-3886.974) (-3887.144) * (-3885.763) (-3883.345) [-3879.478] (-3889.739) -- 0:04:01 142500 -- (-3886.826) (-3890.609) (-3881.825) [-3885.765] * (-3887.278) [-3881.946] (-3882.640) (-3890.873) -- 0:04:00 143000 -- (-3885.591) [-3881.448] (-3885.211) (-3885.653) * [-3883.618] (-3887.565) (-3888.027) (-3887.705) -- 0:03:59 143500 -- (-3885.235) (-3886.758) [-3884.646] (-3894.605) * (-3882.795) [-3882.438] (-3885.477) (-3882.116) -- 0:04:04 144000 -- (-3888.053) [-3888.750] (-3893.376) (-3892.112) * (-3882.428) (-3889.455) [-3888.326] (-3880.323) -- 0:04:03 144500 -- [-3885.926] (-3887.601) (-3885.616) (-3890.289) * [-3881.006] (-3883.570) (-3887.315) (-3889.863) -- 0:04:02 145000 -- (-3889.447) (-3887.986) [-3882.309] (-3891.294) * (-3884.178) (-3886.597) (-3890.461) [-3887.428] -- 0:04:01 Average standard deviation of split frequencies: 0.000000 145500 -- [-3882.292] (-3885.292) (-3881.284) (-3887.491) * [-3892.706] (-3883.939) (-3883.634) (-3888.202) -- 0:04:00 146000 -- (-3891.172) [-3885.153] (-3881.655) (-3887.052) * (-3890.776) [-3883.322] (-3883.849) (-3885.473) -- 0:03:59 146500 -- [-3878.909] (-3882.450) (-3886.831) (-3887.923) * (-3889.132) (-3886.749) [-3885.778] (-3886.661) -- 0:03:58 147000 -- [-3881.442] (-3882.368) (-3881.365) (-3886.110) * (-3886.258) [-3890.627] (-3887.178) (-3891.837) -- 0:04:03 147500 -- (-3882.225) [-3882.974] (-3882.758) (-3880.853) * (-3882.505) (-3880.280) (-3889.449) [-3881.663] -- 0:04:02 148000 -- (-3886.313) [-3883.523] (-3887.041) (-3885.820) * (-3887.046) (-3895.520) (-3885.582) [-3891.921] -- 0:04:01 148500 -- (-3882.651) [-3884.463] (-3883.515) (-3883.373) * (-3884.151) [-3883.122] (-3886.941) (-3891.086) -- 0:04:00 149000 -- [-3889.110] (-3886.360) (-3891.162) (-3884.219) * (-3884.652) (-3888.655) [-3885.414] (-3889.286) -- 0:03:59 149500 -- (-3884.816) (-3882.338) (-3886.549) [-3887.022] * [-3884.880] (-3887.235) (-3884.892) (-3892.074) -- 0:03:58 150000 -- (-3887.273) (-3880.113) [-3882.134] (-3892.708) * (-3888.966) (-3886.230) [-3886.390] (-3886.055) -- 0:03:57 Average standard deviation of split frequencies: 0.000000 150500 -- [-3884.188] (-3879.830) (-3893.324) (-3889.397) * (-3882.482) (-3889.473) (-3884.036) [-3886.512] -- 0:04:02 151000 -- [-3881.409] (-3883.013) (-3886.365) (-3889.441) * (-3883.510) [-3887.305] (-3885.562) (-3889.960) -- 0:04:01 151500 -- (-3885.029) (-3889.325) [-3885.869] (-3882.798) * [-3882.674] (-3887.585) (-3882.278) (-3890.484) -- 0:04:00 152000 -- (-3885.373) (-3886.384) (-3893.904) [-3882.584] * (-3885.329) (-3888.541) [-3891.214] (-3885.180) -- 0:03:59 152500 -- (-3881.838) (-3888.298) (-3883.304) [-3882.714] * [-3886.743] (-3884.213) (-3889.288) (-3887.965) -- 0:03:58 153000 -- (-3889.869) [-3883.792] (-3887.400) (-3880.769) * (-3883.925) [-3891.206] (-3889.076) (-3882.149) -- 0:03:58 153500 -- (-3886.176) [-3885.203] (-3885.416) (-3886.869) * [-3887.919] (-3886.190) (-3889.011) (-3884.211) -- 0:03:57 154000 -- [-3883.100] (-3882.771) (-3885.593) (-3888.916) * [-3883.683] (-3887.694) (-3886.150) (-3888.134) -- 0:04:01 154500 -- (-3881.304) [-3884.082] (-3891.793) (-3885.999) * (-3896.400) (-3883.762) [-3883.809] (-3883.538) -- 0:04:00 155000 -- [-3881.555] (-3881.946) (-3884.212) (-3885.365) * [-3884.876] (-3884.921) (-3881.593) (-3889.202) -- 0:03:59 Average standard deviation of split frequencies: 0.000000 155500 -- (-3882.995) [-3883.697] (-3882.039) (-3881.190) * (-3885.904) (-3889.849) [-3883.257] (-3887.849) -- 0:03:58 156000 -- (-3887.967) (-3883.213) [-3885.982] (-3883.536) * [-3886.684] (-3888.148) (-3883.614) (-3885.664) -- 0:03:58 156500 -- (-3888.879) (-3886.460) (-3884.280) [-3884.977] * (-3883.157) (-3888.256) (-3885.292) [-3880.788] -- 0:03:57 157000 -- (-3886.176) [-3882.019] (-3888.827) (-3885.459) * (-3886.118) (-3889.377) [-3881.851] (-3882.826) -- 0:03:56 157500 -- [-3881.535] (-3884.816) (-3882.330) (-3888.197) * (-3889.558) [-3885.163] (-3886.203) (-3885.157) -- 0:04:00 158000 -- (-3885.481) [-3883.936] (-3888.202) (-3886.615) * (-3888.585) (-3884.537) (-3884.042) [-3884.027] -- 0:03:59 158500 -- (-3883.533) (-3891.163) [-3882.516] (-3890.843) * (-3893.937) (-3892.302) (-3882.696) [-3881.893] -- 0:03:58 159000 -- (-3888.483) [-3885.381] (-3891.796) (-3885.225) * (-3889.073) (-3883.844) [-3881.503] (-3880.101) -- 0:03:58 159500 -- [-3881.923] (-3883.583) (-3886.605) (-3884.264) * (-3886.168) (-3883.792) (-3884.427) [-3881.826] -- 0:03:57 160000 -- [-3884.117] (-3894.761) (-3891.543) (-3892.614) * (-3883.433) (-3887.825) (-3892.869) [-3881.036] -- 0:03:56 Average standard deviation of split frequencies: 0.000000 160500 -- (-3887.095) (-3884.730) (-3884.068) [-3885.831] * (-3885.432) [-3885.719] (-3886.195) (-3883.490) -- 0:03:55 161000 -- (-3887.290) (-3884.095) [-3887.361] (-3888.630) * (-3885.223) [-3882.744] (-3885.048) (-3889.183) -- 0:03:59 161500 -- [-3889.929] (-3882.304) (-3885.486) (-3888.440) * (-3881.387) (-3884.319) [-3885.228] (-3880.666) -- 0:03:58 162000 -- (-3888.284) [-3886.690] (-3882.308) (-3885.931) * [-3884.070] (-3893.985) (-3882.612) (-3882.515) -- 0:03:57 162500 -- (-3902.359) [-3882.741] (-3882.925) (-3887.881) * [-3882.639] (-3887.316) (-3884.711) (-3885.932) -- 0:03:57 163000 -- (-3888.257) (-3885.890) [-3881.704] (-3884.899) * [-3891.388] (-3889.901) (-3882.731) (-3888.658) -- 0:03:56 163500 -- (-3890.559) [-3883.107] (-3884.422) (-3883.700) * (-3889.711) (-3888.225) (-3882.406) [-3888.157] -- 0:03:55 164000 -- (-3888.840) (-3889.051) [-3889.440] (-3887.536) * (-3882.377) (-3885.420) (-3884.045) [-3884.344] -- 0:03:54 164500 -- (-3889.285) (-3884.754) (-3888.322) [-3879.676] * (-3885.735) [-3890.679] (-3884.318) (-3886.265) -- 0:03:58 165000 -- (-3881.260) (-3885.549) (-3891.524) [-3886.644] * (-3885.781) (-3887.282) [-3886.627] (-3888.341) -- 0:03:57 Average standard deviation of split frequencies: 0.000000 165500 -- (-3885.140) (-3888.990) (-3890.035) [-3884.048] * (-3885.967) (-3887.925) [-3884.279] (-3884.392) -- 0:03:56 166000 -- (-3893.053) (-3886.514) (-3885.623) [-3885.819] * (-3880.886) (-3882.606) [-3891.726] (-3889.797) -- 0:03:56 166500 -- (-3894.425) [-3880.947] (-3890.517) (-3879.866) * [-3888.499] (-3884.500) (-3884.266) (-3888.993) -- 0:03:55 167000 -- (-3897.657) (-3883.114) (-3887.650) [-3880.192] * [-3882.976] (-3882.716) (-3890.087) (-3886.348) -- 0:03:54 167500 -- (-3893.759) [-3880.432] (-3888.514) (-3885.934) * (-3886.801) (-3888.045) (-3888.259) [-3883.911] -- 0:03:53 168000 -- (-3900.052) [-3879.852] (-3884.509) (-3885.396) * (-3889.032) (-3883.450) (-3890.204) [-3882.066] -- 0:03:57 168500 -- [-3884.968] (-3885.591) (-3885.563) (-3896.751) * (-3882.133) (-3884.980) (-3887.241) [-3882.780] -- 0:03:56 169000 -- (-3884.788) (-3883.947) (-3882.820) [-3884.043] * (-3884.427) (-3891.417) [-3880.561] (-3885.767) -- 0:03:56 169500 -- (-3884.006) (-3885.487) (-3882.337) [-3885.090] * (-3885.327) (-3887.587) [-3882.580] (-3883.555) -- 0:03:55 170000 -- (-3889.626) [-3885.385] (-3885.395) (-3884.756) * (-3887.805) [-3879.361] (-3880.007) (-3885.106) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 170500 -- (-3886.714) [-3886.581] (-3888.529) (-3883.873) * [-3889.485] (-3887.026) (-3883.980) (-3882.333) -- 0:03:53 171000 -- (-3888.492) (-3889.176) [-3884.327] (-3892.328) * (-3889.525) (-3880.773) [-3885.259] (-3887.425) -- 0:03:52 171500 -- (-3900.540) [-3887.912] (-3888.441) (-3888.456) * (-3887.959) (-3882.292) (-3885.141) [-3882.975] -- 0:03:56 172000 -- (-3886.486) [-3880.579] (-3887.711) (-3886.061) * (-3882.636) (-3884.359) [-3882.996] (-3892.027) -- 0:03:55 172500 -- (-3887.740) (-3883.234) [-3886.805] (-3882.054) * (-3884.400) [-3883.054] (-3883.618) (-3887.480) -- 0:03:55 173000 -- (-3882.960) (-3885.048) [-3882.830] (-3882.157) * (-3880.844) (-3888.117) (-3887.363) [-3887.865] -- 0:03:54 173500 -- [-3884.977] (-3884.928) (-3883.958) (-3888.012) * [-3887.226] (-3891.350) (-3887.737) (-3883.556) -- 0:03:53 174000 -- (-3889.878) [-3884.582] (-3889.921) (-3883.262) * (-3886.008) (-3895.670) (-3885.482) [-3882.999] -- 0:03:52 174500 -- (-3884.476) [-3884.772] (-3887.218) (-3888.423) * (-3884.211) (-3898.318) (-3887.975) [-3887.582] -- 0:03:51 175000 -- (-3882.811) [-3886.852] (-3886.830) (-3885.179) * (-3891.336) [-3887.489] (-3886.286) (-3880.416) -- 0:03:55 Average standard deviation of split frequencies: 0.000000 175500 -- (-3886.029) [-3883.435] (-3882.547) (-3890.239) * (-3895.972) (-3885.733) (-3884.949) [-3882.877] -- 0:03:54 176000 -- (-3886.059) (-3901.769) (-3888.551) [-3888.168] * [-3883.435] (-3890.435) (-3886.422) (-3892.876) -- 0:03:54 176500 -- (-3884.990) (-3883.496) [-3889.935] (-3885.617) * (-3881.964) (-3882.598) (-3887.168) [-3885.653] -- 0:03:53 177000 -- [-3887.048] (-3880.732) (-3881.153) (-3879.950) * (-3889.591) (-3885.709) [-3885.123] (-3890.688) -- 0:03:52 177500 -- (-3892.101) (-3883.805) [-3882.803] (-3885.159) * (-3887.081) (-3888.748) [-3880.497] (-3887.942) -- 0:03:51 178000 -- (-3892.303) [-3885.071] (-3881.996) (-3888.699) * (-3884.312) [-3885.657] (-3884.787) (-3888.674) -- 0:03:50 178500 -- (-3889.445) (-3887.215) [-3881.979] (-3889.214) * (-3885.438) (-3886.432) [-3881.922] (-3888.330) -- 0:03:50 179000 -- (-3889.988) (-3882.784) (-3884.633) [-3885.584] * (-3882.084) (-3888.165) [-3883.143] (-3891.874) -- 0:03:53 179500 -- (-3888.229) (-3883.608) (-3890.100) [-3881.102] * (-3882.326) [-3883.953] (-3885.169) (-3885.041) -- 0:03:53 180000 -- [-3883.692] (-3882.806) (-3890.215) (-3896.158) * (-3886.207) [-3881.655] (-3885.419) (-3889.535) -- 0:03:52 Average standard deviation of split frequencies: 0.000000 180500 -- (-3882.790) (-3882.705) [-3887.091] (-3893.078) * (-3883.234) [-3879.759] (-3888.252) (-3882.804) -- 0:03:51 181000 -- (-3885.732) (-3887.837) (-3884.268) [-3891.585] * (-3881.656) (-3888.297) [-3885.543] (-3885.284) -- 0:03:50 181500 -- (-3889.140) [-3886.712] (-3889.432) (-3893.933) * (-3890.829) (-3883.022) [-3882.122] (-3882.981) -- 0:03:49 182000 -- [-3889.651] (-3886.932) (-3884.710) (-3886.155) * [-3883.624] (-3879.812) (-3887.146) (-3887.172) -- 0:03:49 182500 -- [-3884.241] (-3888.381) (-3884.910) (-3882.753) * (-3889.181) [-3883.635] (-3885.822) (-3886.626) -- 0:03:52 183000 -- (-3884.546) (-3884.663) (-3881.178) [-3885.567] * (-3887.654) [-3880.608] (-3879.852) (-3891.571) -- 0:03:52 183500 -- (-3885.532) (-3888.370) [-3884.883] (-3889.270) * (-3890.455) (-3888.606) [-3879.897] (-3884.983) -- 0:03:51 184000 -- (-3890.958) [-3888.458] (-3886.964) (-3883.568) * [-3886.081] (-3894.704) (-3888.176) (-3881.244) -- 0:03:50 184500 -- (-3884.943) [-3884.850] (-3885.550) (-3885.836) * (-3883.218) (-3890.967) (-3890.132) [-3885.728] -- 0:03:49 185000 -- (-3885.504) [-3883.754] (-3886.103) (-3885.544) * (-3884.929) (-3890.159) [-3887.861] (-3886.176) -- 0:03:49 Average standard deviation of split frequencies: 0.000000 185500 -- [-3883.220] (-3886.840) (-3888.360) (-3891.034) * (-3888.927) (-3889.930) [-3884.761] (-3884.948) -- 0:03:48 186000 -- (-3885.368) [-3882.300] (-3889.104) (-3886.327) * (-3889.833) (-3885.396) [-3885.986] (-3884.284) -- 0:03:51 186500 -- (-3877.952) (-3880.448) (-3884.386) [-3880.026] * (-3889.207) [-3886.971] (-3883.154) (-3888.508) -- 0:03:51 187000 -- (-3885.563) (-3879.725) [-3882.372] (-3884.971) * (-3885.480) [-3885.292] (-3886.808) (-3895.211) -- 0:03:50 187500 -- [-3882.959] (-3885.663) (-3881.861) (-3890.560) * (-3881.383) [-3881.842] (-3885.782) (-3903.085) -- 0:03:49 188000 -- (-3879.194) (-3881.152) [-3884.332] (-3895.696) * (-3885.183) (-3884.828) [-3889.189] (-3892.095) -- 0:03:48 188500 -- [-3885.154] (-3890.416) (-3892.767) (-3886.247) * (-3888.777) (-3884.467) [-3885.711] (-3889.781) -- 0:03:48 189000 -- (-3884.796) (-3892.117) (-3895.704) [-3880.994] * (-3886.081) (-3888.353) [-3884.440] (-3890.638) -- 0:03:47 189500 -- (-3893.064) (-3886.891) [-3894.234] (-3887.752) * (-3887.879) (-3888.465) [-3889.759] (-3895.217) -- 0:03:50 190000 -- (-3889.731) [-3889.656] (-3889.359) (-3884.189) * (-3885.911) (-3886.419) [-3883.915] (-3892.350) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 190500 -- (-3887.825) (-3885.875) (-3882.841) [-3883.330] * (-3893.527) (-3888.307) [-3883.858] (-3885.000) -- 0:03:49 191000 -- [-3884.063] (-3883.468) (-3882.893) (-3886.328) * (-3889.397) (-3887.334) (-3890.778) [-3883.224] -- 0:03:48 191500 -- (-3888.852) [-3883.629] (-3885.500) (-3882.530) * (-3890.778) (-3886.883) [-3883.689] (-3883.024) -- 0:03:47 192000 -- (-3882.566) (-3885.031) (-3884.445) [-3879.946] * [-3888.643] (-3882.550) (-3882.058) (-3883.384) -- 0:03:47 192500 -- (-3880.989) (-3883.699) [-3883.133] (-3885.219) * (-3889.757) (-3887.155) [-3883.621] (-3881.740) -- 0:03:46 193000 -- [-3887.709] (-3882.457) (-3887.445) (-3892.584) * (-3896.660) [-3884.889] (-3884.404) (-3891.161) -- 0:03:49 193500 -- (-3882.116) (-3880.460) (-3881.807) [-3883.352] * (-3887.534) (-3889.442) (-3892.119) [-3885.511] -- 0:03:49 194000 -- (-3883.634) (-3885.212) (-3889.806) [-3883.323] * (-3889.258) (-3880.651) [-3882.531] (-3893.292) -- 0:03:48 194500 -- [-3881.711] (-3885.044) (-3883.335) (-3883.966) * (-3883.507) [-3882.145] (-3881.932) (-3891.069) -- 0:03:47 195000 -- (-3886.574) (-3896.417) (-3883.572) [-3882.847] * (-3884.199) [-3885.311] (-3882.893) (-3898.273) -- 0:03:47 Average standard deviation of split frequencies: 0.000000 195500 -- (-3890.933) (-3880.069) (-3883.158) [-3883.410] * [-3879.256] (-3885.858) (-3887.024) (-3892.862) -- 0:03:46 196000 -- [-3883.190] (-3884.549) (-3883.494) (-3890.653) * (-3888.442) (-3888.366) [-3881.748] (-3894.532) -- 0:03:45 196500 -- (-3886.538) (-3883.895) (-3886.202) [-3885.667] * (-3890.112) (-3883.805) [-3879.500] (-3886.663) -- 0:03:48 197000 -- (-3884.161) (-3881.698) (-3883.175) [-3883.622] * (-3886.180) (-3880.802) (-3885.225) [-3883.484] -- 0:03:48 197500 -- (-3891.517) (-3880.128) (-3886.840) [-3883.787] * (-3885.370) (-3883.459) (-3883.874) [-3889.381] -- 0:03:47 198000 -- (-3887.472) (-3883.199) (-3885.407) [-3884.154] * (-3881.517) (-3893.794) (-3885.874) [-3888.270] -- 0:03:46 198500 -- (-3885.594) [-3883.828] (-3883.052) (-3886.616) * (-3884.891) [-3883.981] (-3888.362) (-3885.480) -- 0:03:46 199000 -- (-3888.397) [-3883.869] (-3884.491) (-3880.352) * [-3883.239] (-3883.367) (-3891.796) (-3884.305) -- 0:03:45 199500 -- (-3886.802) [-3881.054] (-3887.776) (-3883.184) * [-3879.477] (-3885.137) (-3890.210) (-3884.401) -- 0:03:44 200000 -- [-3881.984] (-3887.523) (-3887.711) (-3883.971) * (-3887.128) [-3881.886] (-3885.729) (-3882.242) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 200500 -- [-3884.272] (-3885.564) (-3883.088) (-3879.937) * (-3886.640) (-3882.085) (-3892.487) [-3881.258] -- 0:03:47 201000 -- (-3881.150) (-3884.577) (-3890.632) [-3887.655] * [-3883.462] (-3885.337) (-3887.514) (-3883.546) -- 0:03:46 201500 -- (-3885.182) (-3882.738) (-3885.344) [-3882.937] * (-3886.494) (-3891.899) [-3883.373] (-3888.776) -- 0:03:45 202000 -- (-3892.790) (-3884.445) (-3880.347) [-3882.248] * [-3882.369] (-3881.344) (-3882.328) (-3885.462) -- 0:03:45 202500 -- (-3887.183) (-3882.462) (-3883.782) [-3884.534] * (-3884.679) [-3884.988] (-3891.776) (-3882.063) -- 0:03:44 203000 -- (-3893.808) (-3884.791) (-3883.974) [-3883.502] * (-3882.378) [-3882.152] (-3886.912) (-3886.926) -- 0:03:43 203500 -- (-3882.412) (-3885.027) (-3886.613) [-3886.371] * (-3886.901) (-3896.846) (-3893.214) [-3886.671] -- 0:03:47 204000 -- (-3884.904) (-3883.829) (-3895.061) [-3887.777] * (-3884.717) [-3882.054] (-3889.126) (-3888.140) -- 0:03:46 204500 -- [-3884.143] (-3883.333) (-3883.310) (-3885.338) * (-3887.537) [-3885.382] (-3896.379) (-3881.342) -- 0:03:45 205000 -- (-3884.761) (-3887.419) (-3884.355) [-3884.215] * (-3883.846) (-3883.953) [-3884.406] (-3884.534) -- 0:03:44 Average standard deviation of split frequencies: 0.000000 205500 -- (-3884.466) [-3880.390] (-3884.986) (-3890.170) * [-3883.714] (-3884.719) (-3892.325) (-3886.635) -- 0:03:44 206000 -- (-3885.534) (-3883.720) (-3887.657) [-3880.993] * (-3883.302) (-3882.976) [-3882.560] (-3893.277) -- 0:03:43 206500 -- (-3890.880) (-3887.144) (-3890.340) [-3883.118] * (-3883.771) [-3887.221] (-3886.999) (-3898.908) -- 0:03:42 207000 -- [-3884.061] (-3886.167) (-3888.647) (-3883.753) * (-3882.268) (-3892.004) [-3885.155] (-3887.061) -- 0:03:46 207500 -- (-3889.703) [-3885.129] (-3889.703) (-3885.190) * [-3884.226] (-3883.779) (-3893.423) (-3892.513) -- 0:03:45 208000 -- (-3884.249) (-3885.853) [-3888.517] (-3886.516) * (-3885.894) (-3895.703) (-3886.124) [-3881.794] -- 0:03:44 208500 -- (-3885.602) [-3883.693] (-3884.626) (-3889.367) * (-3883.806) (-3885.252) [-3881.765] (-3890.378) -- 0:03:43 209000 -- [-3884.245] (-3884.935) (-3887.579) (-3884.154) * [-3885.145] (-3888.880) (-3881.091) (-3888.092) -- 0:03:43 209500 -- (-3888.882) (-3883.914) [-3886.113] (-3885.779) * [-3886.352] (-3886.825) (-3885.549) (-3881.697) -- 0:03:42 210000 -- [-3885.925] (-3896.967) (-3885.952) (-3886.168) * (-3881.658) (-3888.639) (-3887.423) [-3885.274] -- 0:03:41 Average standard deviation of split frequencies: 0.000000 210500 -- (-3882.134) (-3896.801) [-3882.006] (-3888.869) * (-3882.289) [-3882.810] (-3888.588) (-3888.158) -- 0:03:45 211000 -- (-3889.895) (-3886.164) [-3881.558] (-3887.474) * (-3896.387) (-3890.226) (-3884.545) [-3886.922] -- 0:03:44 211500 -- (-3883.690) (-3887.146) [-3883.973] (-3886.582) * [-3886.457] (-3884.548) (-3883.032) (-3884.041) -- 0:03:43 212000 -- (-3881.880) (-3885.380) [-3879.832] (-3883.107) * (-3891.493) (-3884.385) [-3881.257] (-3887.078) -- 0:03:43 212500 -- (-3891.601) (-3881.259) [-3882.548] (-3883.172) * (-3888.489) [-3883.917] (-3883.544) (-3889.190) -- 0:03:42 213000 -- (-3883.997) [-3881.338] (-3884.490) (-3887.713) * [-3890.372] (-3881.644) (-3885.124) (-3889.996) -- 0:03:41 213500 -- [-3888.679] (-3880.480) (-3888.014) (-3889.499) * [-3886.962] (-3881.618) (-3886.731) (-3891.102) -- 0:03:41 214000 -- [-3883.831] (-3883.551) (-3894.011) (-3884.125) * [-3887.358] (-3885.321) (-3892.174) (-3891.266) -- 0:03:44 214500 -- (-3884.125) (-3883.849) (-3887.256) [-3885.383] * (-3886.907) [-3886.613] (-3888.851) (-3886.725) -- 0:03:43 215000 -- (-3888.510) [-3882.450] (-3882.761) (-3883.991) * (-3885.860) [-3883.746] (-3889.643) (-3884.192) -- 0:03:42 Average standard deviation of split frequencies: 0.000000 215500 -- [-3882.573] (-3882.643) (-3884.074) (-3880.514) * (-3890.659) (-3888.420) (-3881.846) [-3890.807] -- 0:03:42 216000 -- (-3885.112) (-3887.710) [-3884.581] (-3892.311) * (-3883.412) (-3885.275) [-3889.887] (-3887.230) -- 0:03:41 216500 -- (-3883.490) (-3880.020) [-3882.803] (-3891.236) * (-3884.521) (-3884.411) (-3889.417) [-3882.057] -- 0:03:40 217000 -- (-3881.947) (-3884.126) [-3883.857] (-3883.835) * (-3880.005) (-3885.199) (-3885.268) [-3887.540] -- 0:03:40 217500 -- (-3882.706) (-3880.067) (-3885.447) [-3880.446] * (-3882.382) [-3883.846] (-3885.047) (-3883.782) -- 0:03:43 218000 -- (-3889.375) (-3884.002) [-3887.885] (-3886.382) * (-3883.553) [-3881.804] (-3893.822) (-3881.974) -- 0:03:42 218500 -- (-3885.494) (-3888.833) [-3884.520] (-3887.481) * (-3887.719) [-3883.177] (-3881.586) (-3885.705) -- 0:03:41 219000 -- (-3887.100) [-3886.205] (-3887.286) (-3881.623) * (-3886.158) (-3887.219) (-3888.733) [-3887.658] -- 0:03:41 219500 -- [-3886.057] (-3887.041) (-3886.980) (-3885.979) * [-3883.460] (-3886.951) (-3885.768) (-3884.428) -- 0:03:40 220000 -- [-3885.895] (-3885.060) (-3890.622) (-3887.171) * (-3885.677) (-3887.381) (-3888.852) [-3884.993] -- 0:03:39 Average standard deviation of split frequencies: 0.000000 220500 -- [-3885.778] (-3884.455) (-3886.132) (-3887.787) * [-3884.337] (-3885.941) (-3889.744) (-3889.583) -- 0:03:39 221000 -- [-3887.953] (-3887.905) (-3884.344) (-3886.222) * (-3887.041) (-3885.134) [-3885.327] (-3887.075) -- 0:03:42 221500 -- (-3883.702) (-3891.960) [-3892.806] (-3891.218) * (-3884.733) [-3885.073] (-3889.646) (-3885.798) -- 0:03:41 222000 -- [-3886.019] (-3886.951) (-3897.138) (-3889.914) * (-3887.732) (-3890.629) (-3879.546) [-3882.137] -- 0:03:40 222500 -- [-3882.373] (-3884.621) (-3889.323) (-3895.212) * (-3888.524) [-3887.782] (-3881.346) (-3880.668) -- 0:03:40 223000 -- (-3886.654) [-3884.247] (-3885.032) (-3890.582) * (-3886.828) (-3891.975) (-3881.425) [-3882.322] -- 0:03:39 223500 -- (-3885.679) (-3888.632) [-3886.204] (-3893.001) * [-3885.093] (-3884.360) (-3884.168) (-3885.675) -- 0:03:38 224000 -- [-3883.174] (-3884.741) (-3884.593) (-3885.036) * (-3887.857) [-3888.892] (-3884.048) (-3882.292) -- 0:03:38 224500 -- (-3886.316) [-3886.387] (-3890.872) (-3885.872) * (-3888.377) (-3886.560) (-3883.828) [-3885.514] -- 0:03:41 225000 -- (-3885.222) (-3888.981) [-3881.132] (-3887.195) * [-3882.762] (-3883.850) (-3889.754) (-3888.169) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 225500 -- (-3884.351) (-3885.248) (-3884.285) [-3887.396] * (-3882.623) (-3886.922) (-3882.888) [-3885.760] -- 0:03:39 226000 -- (-3888.221) (-3886.052) (-3889.870) [-3885.189] * (-3884.110) [-3887.564] (-3885.998) (-3887.990) -- 0:03:39 226500 -- (-3890.233) [-3880.830] (-3887.626) (-3884.132) * (-3888.008) (-3890.547) [-3884.757] (-3887.324) -- 0:03:38 227000 -- (-3888.665) (-3887.512) [-3883.257] (-3888.349) * (-3888.158) (-3887.064) (-3883.294) [-3883.655] -- 0:03:37 227500 -- [-3885.699] (-3882.814) (-3893.222) (-3882.901) * (-3883.939) (-3886.144) (-3883.140) [-3884.109] -- 0:03:37 228000 -- [-3883.687] (-3882.743) (-3892.177) (-3885.983) * [-3884.083] (-3887.308) (-3880.904) (-3888.880) -- 0:03:40 228500 -- (-3883.918) [-3880.482] (-3891.399) (-3885.299) * [-3883.388] (-3890.779) (-3883.105) (-3888.345) -- 0:03:39 229000 -- (-3886.531) (-3881.751) [-3889.320] (-3892.943) * [-3882.280] (-3889.524) (-3884.197) (-3883.277) -- 0:03:38 229500 -- (-3884.193) (-3889.883) [-3892.890] (-3886.403) * (-3890.284) [-3883.644] (-3883.565) (-3884.940) -- 0:03:38 230000 -- (-3883.534) [-3882.892] (-3893.149) (-3882.463) * (-3890.478) [-3885.386] (-3884.972) (-3887.336) -- 0:03:37 Average standard deviation of split frequencies: 0.000000 230500 -- (-3888.221) (-3886.060) (-3898.915) [-3886.731] * [-3887.337] (-3897.231) (-3878.721) (-3881.961) -- 0:03:36 231000 -- [-3883.462] (-3896.308) (-3896.321) (-3888.537) * (-3884.407) (-3883.022) [-3882.582] (-3881.006) -- 0:03:36 231500 -- (-3886.464) (-3886.389) (-3885.154) [-3888.482] * (-3883.426) [-3881.248] (-3886.154) (-3883.140) -- 0:03:39 232000 -- [-3880.866] (-3881.283) (-3888.317) (-3886.754) * [-3883.997] (-3886.284) (-3889.886) (-3889.340) -- 0:03:38 232500 -- [-3882.288] (-3880.812) (-3889.029) (-3880.821) * (-3885.729) (-3885.080) (-3889.620) [-3890.734] -- 0:03:37 233000 -- (-3895.594) [-3883.952] (-3878.092) (-3886.869) * (-3891.409) (-3884.143) [-3885.196] (-3884.960) -- 0:03:37 233500 -- (-3881.516) (-3894.119) [-3883.371] (-3888.650) * (-3890.329) (-3885.607) [-3883.450] (-3884.959) -- 0:03:36 234000 -- [-3887.428] (-3888.498) (-3888.424) (-3882.187) * (-3888.050) (-3884.170) [-3889.048] (-3885.873) -- 0:03:36 234500 -- (-3886.344) [-3884.624] (-3888.990) (-3879.076) * [-3887.820] (-3885.716) (-3889.884) (-3884.936) -- 0:03:35 235000 -- (-3886.017) (-3882.934) [-3881.133] (-3887.230) * [-3888.736] (-3887.524) (-3889.915) (-3885.836) -- 0:03:38 Average standard deviation of split frequencies: 0.000000 235500 -- (-3887.655) [-3883.480] (-3887.203) (-3886.616) * (-3885.426) (-3883.775) [-3886.277] (-3886.063) -- 0:03:37 236000 -- (-3885.505) (-3882.641) [-3885.487] (-3895.526) * [-3885.012] (-3886.680) (-3888.572) (-3884.292) -- 0:03:36 236500 -- [-3883.608] (-3881.636) (-3888.202) (-3891.576) * (-3883.845) (-3884.898) [-3887.856] (-3887.196) -- 0:03:36 237000 -- (-3885.186) (-3886.259) [-3884.828] (-3890.457) * (-3885.350) [-3885.766] (-3893.759) (-3890.793) -- 0:03:35 237500 -- (-3890.857) [-3889.352] (-3884.232) (-3889.220) * (-3885.440) [-3881.066] (-3889.731) (-3888.129) -- 0:03:35 238000 -- [-3893.840] (-3890.383) (-3883.705) (-3885.449) * (-3892.416) [-3884.088] (-3893.150) (-3887.915) -- 0:03:34 238500 -- (-3890.563) (-3884.004) [-3882.576] (-3894.556) * (-3889.601) (-3886.346) [-3886.486] (-3885.776) -- 0:03:37 239000 -- [-3885.264] (-3884.274) (-3886.383) (-3883.947) * (-3889.202) (-3891.453) (-3885.947) [-3889.233] -- 0:03:36 239500 -- (-3884.371) [-3881.398] (-3890.309) (-3883.447) * (-3888.380) (-3883.668) (-3884.235) [-3884.198] -- 0:03:35 240000 -- (-3890.192) (-3883.023) [-3881.968] (-3885.848) * [-3888.563] (-3882.111) (-3884.802) (-3894.284) -- 0:03:35 Average standard deviation of split frequencies: 0.000000 240500 -- (-3889.796) [-3880.663] (-3893.104) (-3882.400) * (-3891.823) (-3883.375) (-3880.840) [-3882.351] -- 0:03:34 241000 -- (-3883.706) [-3880.254] (-3882.477) (-3887.172) * (-3893.499) (-3881.153) [-3887.144] (-3881.142) -- 0:03:34 241500 -- (-3885.878) (-3886.490) (-3881.811) [-3883.782] * [-3882.814] (-3883.788) (-3888.939) (-3889.132) -- 0:03:33 242000 -- (-3881.226) (-3890.376) (-3882.369) [-3882.150] * (-3886.523) (-3888.561) (-3887.053) [-3887.175] -- 0:03:36 242500 -- (-3882.937) [-3888.447] (-3885.310) (-3887.691) * [-3883.511] (-3887.082) (-3890.085) (-3891.485) -- 0:03:35 243000 -- (-3887.882) [-3883.650] (-3886.840) (-3885.342) * (-3886.886) (-3882.278) [-3883.508] (-3889.019) -- 0:03:34 243500 -- [-3889.302] (-3884.473) (-3886.974) (-3884.865) * (-3887.822) [-3882.912] (-3885.909) (-3882.463) -- 0:03:34 244000 -- (-3886.609) (-3883.689) [-3885.996] (-3883.496) * (-3880.856) (-3888.958) [-3881.601] (-3894.657) -- 0:03:33 244500 -- [-3881.024] (-3887.387) (-3893.237) (-3887.763) * (-3887.274) (-3888.591) [-3883.639] (-3883.232) -- 0:03:33 245000 -- (-3880.433) (-3882.161) (-3882.568) [-3880.849] * (-3888.173) (-3891.822) (-3888.010) [-3882.791] -- 0:03:32 Average standard deviation of split frequencies: 0.000000 245500 -- (-3885.685) [-3891.305] (-3885.681) (-3892.053) * [-3885.589] (-3881.985) (-3888.367) (-3880.733) -- 0:03:35 246000 -- (-3884.967) [-3885.467] (-3888.074) (-3887.665) * (-3886.239) (-3886.799) (-3885.190) [-3880.262] -- 0:03:34 246500 -- (-3884.819) (-3885.965) [-3890.610] (-3881.902) * [-3881.867] (-3886.670) (-3897.773) (-3889.875) -- 0:03:33 247000 -- (-3883.660) (-3887.076) (-3889.181) [-3880.996] * [-3881.384] (-3884.473) (-3887.170) (-3890.724) -- 0:03:33 247500 -- (-3882.794) (-3887.976) (-3884.204) [-3883.106] * (-3888.378) (-3887.482) (-3883.049) [-3887.301] -- 0:03:32 248000 -- [-3884.355] (-3885.130) (-3879.398) (-3885.278) * [-3881.509] (-3880.992) (-3880.738) (-3884.271) -- 0:03:32 248500 -- (-3886.304) (-3882.968) (-3883.873) [-3886.030] * (-3886.365) [-3882.750] (-3885.130) (-3888.577) -- 0:03:31 249000 -- (-3893.187) (-3885.775) [-3886.074] (-3887.826) * (-3886.466) [-3882.370] (-3892.223) (-3887.724) -- 0:03:34 249500 -- (-3884.970) [-3885.122] (-3885.435) (-3890.646) * (-3888.090) [-3882.762] (-3892.989) (-3888.655) -- 0:03:33 250000 -- [-3885.290] (-3880.276) (-3888.991) (-3888.549) * (-3886.139) (-3888.823) [-3886.309] (-3884.582) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 250500 -- (-3889.710) [-3879.448] (-3886.252) (-3890.229) * (-3885.396) [-3884.334] (-3886.495) (-3885.813) -- 0:03:32 251000 -- [-3889.267] (-3883.187) (-3883.792) (-3885.369) * (-3890.663) (-3887.749) [-3889.454] (-3891.499) -- 0:03:31 251500 -- [-3886.864] (-3881.349) (-3882.483) (-3887.377) * (-3890.933) (-3889.385) (-3887.778) [-3884.488] -- 0:03:31 252000 -- (-3886.824) (-3884.671) (-3893.013) [-3880.608] * (-3891.835) (-3886.825) [-3883.069] (-3881.979) -- 0:03:30 252500 -- (-3889.261) [-3890.085] (-3883.302) (-3883.361) * (-3885.500) (-3890.941) [-3882.472] (-3880.321) -- 0:03:33 253000 -- (-3885.847) (-3885.814) (-3885.854) [-3880.186] * (-3885.851) (-3886.017) [-3888.952] (-3881.718) -- 0:03:32 253500 -- (-3882.665) [-3890.436] (-3885.370) (-3884.198) * [-3889.641] (-3884.757) (-3886.869) (-3888.171) -- 0:03:32 254000 -- (-3882.938) (-3892.355) (-3882.889) [-3883.696] * (-3892.652) (-3887.751) [-3887.070] (-3879.856) -- 0:03:31 254500 -- [-3886.895] (-3888.188) (-3888.275) (-3884.019) * (-3893.758) (-3885.859) [-3885.348] (-3882.461) -- 0:03:30 255000 -- (-3887.378) (-3889.439) (-3887.322) [-3883.900] * (-3890.438) (-3883.875) (-3890.571) [-3890.149] -- 0:03:30 Average standard deviation of split frequencies: 0.000000 255500 -- (-3885.335) (-3887.049) (-3887.238) [-3883.844] * (-3881.615) [-3889.320] (-3888.482) (-3890.646) -- 0:03:29 256000 -- (-3883.515) (-3884.889) (-3884.962) [-3885.258] * (-3885.500) (-3882.753) (-3888.143) [-3884.866] -- 0:03:32 256500 -- (-3886.194) [-3887.807] (-3883.674) (-3884.326) * (-3880.474) (-3883.850) [-3886.571] (-3884.356) -- 0:03:31 257000 -- (-3888.155) (-3886.315) (-3884.751) [-3886.304] * (-3884.796) (-3881.575) (-3886.029) [-3884.790] -- 0:03:31 257500 -- (-3889.691) (-3890.367) (-3886.933) [-3888.080] * (-3882.240) (-3879.039) [-3889.678] (-3886.989) -- 0:03:30 258000 -- [-3886.415] (-3885.555) (-3880.887) (-3886.232) * (-3884.042) [-3882.286] (-3888.684) (-3887.366) -- 0:03:29 258500 -- (-3893.873) (-3889.127) [-3883.320] (-3885.906) * [-3882.651] (-3891.324) (-3886.279) (-3894.752) -- 0:03:29 259000 -- (-3899.570) [-3891.088] (-3880.925) (-3882.222) * [-3880.966] (-3893.907) (-3884.217) (-3888.608) -- 0:03:28 259500 -- (-3882.843) (-3882.165) (-3883.542) [-3886.622] * (-3884.290) (-3896.776) [-3884.444] (-3892.572) -- 0:03:31 260000 -- (-3887.581) [-3891.972] (-3885.038) (-3881.420) * (-3883.769) [-3887.077] (-3886.075) (-3884.762) -- 0:03:30 Average standard deviation of split frequencies: 0.000000 260500 -- (-3882.808) (-3885.814) [-3888.597] (-3884.220) * (-3880.608) (-3886.361) (-3884.475) [-3884.752] -- 0:03:30 261000 -- (-3884.940) [-3881.206] (-3883.215) (-3881.703) * (-3889.682) (-3886.370) (-3885.867) [-3890.169] -- 0:03:29 261500 -- [-3883.656] (-3895.892) (-3890.553) (-3885.788) * (-3882.949) (-3892.329) (-3887.761) [-3883.926] -- 0:03:28 262000 -- (-3883.251) (-3890.161) (-3887.896) [-3884.189] * [-3884.040] (-3889.292) (-3890.898) (-3883.339) -- 0:03:28 262500 -- (-3888.592) (-3887.550) (-3881.888) [-3884.408] * (-3884.150) (-3890.062) [-3884.050] (-3879.686) -- 0:03:27 263000 -- (-3885.884) (-3882.457) (-3885.738) [-3887.898] * (-3882.545) (-3884.812) (-3883.620) [-3880.459] -- 0:03:30 263500 -- (-3891.375) (-3884.760) (-3887.700) [-3888.405] * (-3883.989) [-3886.222] (-3883.710) (-3885.611) -- 0:03:29 264000 -- (-3890.800) (-3884.784) [-3882.061] (-3894.530) * [-3884.154] (-3884.626) (-3885.627) (-3889.793) -- 0:03:29 264500 -- (-3889.916) [-3886.350] (-3887.213) (-3901.293) * (-3886.582) [-3884.529] (-3884.430) (-3884.354) -- 0:03:28 265000 -- (-3882.885) (-3893.664) [-3882.437] (-3895.365) * [-3885.387] (-3882.401) (-3886.992) (-3886.304) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 265500 -- (-3892.412) [-3886.925] (-3881.988) (-3891.827) * (-3881.784) (-3884.517) [-3882.942] (-3889.239) -- 0:03:27 266000 -- (-3882.395) (-3886.656) (-3886.562) [-3882.086] * (-3886.044) (-3886.373) [-3884.423] (-3887.189) -- 0:03:26 266500 -- (-3886.601) (-3883.273) (-3897.002) [-3885.637] * [-3884.849] (-3887.835) (-3884.353) (-3885.879) -- 0:03:29 267000 -- [-3888.276] (-3885.417) (-3894.079) (-3887.171) * [-3881.331] (-3889.089) (-3886.227) (-3881.840) -- 0:03:28 267500 -- (-3886.544) (-3883.163) (-3884.079) [-3886.342] * [-3884.024] (-3883.415) (-3881.188) (-3886.010) -- 0:03:28 268000 -- (-3887.088) [-3882.017] (-3891.120) (-3886.771) * (-3886.844) (-3882.039) [-3884.463] (-3892.579) -- 0:03:27 268500 -- (-3885.369) (-3884.666) (-3884.527) [-3886.294] * (-3885.547) [-3880.223] (-3882.493) (-3882.614) -- 0:03:27 269000 -- (-3884.534) [-3885.960] (-3887.750) (-3888.645) * (-3884.612) [-3884.779] (-3888.448) (-3886.445) -- 0:03:26 269500 -- (-3883.899) (-3885.123) [-3884.646] (-3882.398) * [-3881.151] (-3883.967) (-3887.923) (-3884.460) -- 0:03:26 270000 -- [-3885.846] (-3883.441) (-3886.855) (-3888.076) * (-3889.693) (-3881.999) (-3889.198) [-3887.266] -- 0:03:28 Average standard deviation of split frequencies: 0.000000 270500 -- (-3885.641) [-3884.057] (-3883.654) (-3884.262) * (-3887.258) [-3887.232] (-3884.577) (-3891.785) -- 0:03:27 271000 -- [-3880.881] (-3887.143) (-3889.549) (-3879.046) * [-3889.105] (-3885.331) (-3885.203) (-3888.564) -- 0:03:27 271500 -- (-3891.366) (-3887.666) (-3891.037) [-3886.022] * (-3888.026) (-3892.507) (-3885.742) [-3883.107] -- 0:03:26 272000 -- (-3885.480) [-3893.733] (-3884.652) (-3883.867) * (-3886.860) (-3891.232) (-3890.853) [-3883.977] -- 0:03:26 272500 -- (-3886.047) (-3885.410) (-3885.225) [-3882.555] * (-3887.224) (-3888.778) [-3884.341] (-3885.118) -- 0:03:25 273000 -- (-3889.368) (-3898.937) [-3887.920] (-3892.418) * [-3884.655] (-3896.201) (-3884.273) (-3887.316) -- 0:03:25 273500 -- (-3886.379) (-3883.876) [-3880.034] (-3890.832) * (-3889.266) (-3883.646) (-3884.264) [-3885.886] -- 0:03:27 274000 -- (-3886.619) (-3891.190) [-3882.525] (-3886.865) * (-3888.497) [-3884.626] (-3886.942) (-3890.013) -- 0:03:26 274500 -- (-3892.371) (-3881.471) [-3881.705] (-3884.033) * [-3881.451] (-3884.989) (-3887.470) (-3890.747) -- 0:03:26 275000 -- [-3879.926] (-3881.909) (-3884.911) (-3880.131) * (-3885.754) (-3883.578) (-3886.183) [-3894.674] -- 0:03:25 Average standard deviation of split frequencies: 0.000000 275500 -- [-3885.181] (-3881.526) (-3889.090) (-3883.389) * (-3890.013) (-3881.531) [-3883.606] (-3884.858) -- 0:03:25 276000 -- (-3883.098) (-3882.000) (-3889.984) [-3884.045] * (-3887.608) (-3887.262) (-3887.026) [-3882.919] -- 0:03:24 276500 -- [-3881.707] (-3887.115) (-3884.026) (-3888.713) * (-3883.768) (-3888.933) (-3886.138) [-3882.033] -- 0:03:24 277000 -- (-3889.061) [-3885.063] (-3881.102) (-3891.625) * (-3888.124) (-3885.773) (-3883.788) [-3882.796] -- 0:03:26 277500 -- (-3886.776) (-3896.412) (-3883.513) [-3887.843] * (-3888.096) [-3882.542] (-3883.662) (-3886.063) -- 0:03:25 278000 -- (-3880.991) [-3887.387] (-3885.020) (-3889.030) * (-3886.555) (-3883.078) [-3885.403] (-3889.941) -- 0:03:25 278500 -- (-3891.331) (-3888.309) [-3883.940] (-3882.183) * (-3891.014) [-3880.834] (-3886.589) (-3885.029) -- 0:03:24 279000 -- (-3889.222) (-3885.975) (-3884.818) [-3888.802] * [-3886.417] (-3888.909) (-3893.557) (-3887.521) -- 0:03:24 279500 -- [-3887.832] (-3892.400) (-3884.862) (-3891.682) * (-3893.224) (-3887.759) [-3889.702] (-3881.299) -- 0:03:23 280000 -- (-3886.916) (-3888.356) [-3888.570] (-3888.221) * (-3885.362) [-3882.465] (-3887.645) (-3887.013) -- 0:03:23 Average standard deviation of split frequencies: 0.000000 280500 -- (-3884.904) [-3887.973] (-3886.487) (-3886.537) * (-3883.340) [-3884.390] (-3884.880) (-3887.935) -- 0:03:25 281000 -- (-3889.062) [-3883.199] (-3891.296) (-3884.636) * [-3885.100] (-3883.369) (-3887.739) (-3883.185) -- 0:03:24 281500 -- (-3892.907) (-3892.217) [-3884.103] (-3886.366) * (-3884.022) (-3884.761) (-3887.819) [-3883.919] -- 0:03:24 282000 -- (-3887.843) (-3884.886) (-3884.979) [-3886.364] * (-3885.315) [-3889.461] (-3892.576) (-3887.082) -- 0:03:23 282500 -- (-3889.053) [-3884.469] (-3881.347) (-3883.967) * (-3886.398) (-3882.411) (-3890.903) [-3885.655] -- 0:03:23 283000 -- (-3887.075) (-3881.570) [-3885.967] (-3885.296) * (-3882.587) [-3883.347] (-3892.054) (-3886.335) -- 0:03:22 283500 -- (-3884.009) [-3881.751] (-3881.115) (-3880.411) * [-3885.110] (-3883.531) (-3885.949) (-3887.770) -- 0:03:22 284000 -- (-3889.775) (-3886.222) [-3880.113] (-3890.844) * [-3881.833] (-3884.959) (-3883.422) (-3884.293) -- 0:03:21 284500 -- (-3885.456) (-3888.307) [-3880.000] (-3884.568) * (-3897.399) (-3884.322) (-3884.452) [-3886.619] -- 0:03:23 285000 -- [-3887.269] (-3883.971) (-3883.982) (-3887.999) * [-3886.168] (-3883.273) (-3884.700) (-3888.561) -- 0:03:23 Average standard deviation of split frequencies: 0.000000 285500 -- [-3887.398] (-3888.095) (-3886.444) (-3886.303) * (-3887.233) [-3881.484] (-3887.578) (-3888.098) -- 0:03:22 286000 -- (-3884.703) [-3882.990] (-3888.645) (-3889.131) * (-3899.266) (-3893.153) [-3884.016] (-3887.607) -- 0:03:22 286500 -- (-3884.917) [-3887.950] (-3895.038) (-3894.145) * (-3895.171) (-3885.392) (-3887.126) [-3889.614] -- 0:03:21 287000 -- (-3887.192) (-3886.171) [-3885.501] (-3882.473) * (-3883.907) [-3881.704] (-3884.060) (-3888.226) -- 0:03:21 287500 -- [-3890.372] (-3883.249) (-3884.050) (-3886.576) * (-3882.025) (-3881.087) (-3884.507) [-3888.100] -- 0:03:20 288000 -- (-3891.648) (-3888.636) (-3890.083) [-3882.694] * (-3883.637) [-3885.445] (-3888.561) (-3888.919) -- 0:03:22 288500 -- [-3882.815] (-3887.637) (-3890.883) (-3891.911) * (-3884.314) (-3881.859) [-3885.037] (-3886.924) -- 0:03:22 289000 -- (-3885.519) (-3887.256) [-3882.031] (-3880.826) * (-3891.800) [-3891.750] (-3888.247) (-3886.778) -- 0:03:21 289500 -- (-3886.777) [-3888.738] (-3890.101) (-3883.319) * (-3890.312) (-3890.259) (-3888.622) [-3888.370] -- 0:03:21 290000 -- [-3885.821] (-3889.523) (-3888.405) (-3889.221) * [-3889.640] (-3886.108) (-3885.298) (-3889.709) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 290500 -- (-3886.713) (-3888.952) [-3889.847] (-3887.292) * (-3884.133) (-3885.053) [-3881.708] (-3884.818) -- 0:03:20 291000 -- [-3885.428] (-3891.030) (-3895.044) (-3882.740) * (-3888.244) (-3880.950) [-3883.383] (-3901.110) -- 0:03:19 291500 -- (-3886.967) (-3892.663) [-3882.734] (-3891.092) * [-3882.742] (-3886.839) (-3884.645) (-3888.645) -- 0:03:21 292000 -- [-3880.482] (-3882.928) (-3892.373) (-3884.846) * (-3888.859) [-3882.788] (-3886.362) (-3881.549) -- 0:03:21 292500 -- (-3882.311) (-3886.344) (-3891.000) [-3885.966] * (-3887.313) (-3886.338) [-3883.375] (-3884.750) -- 0:03:20 293000 -- (-3887.190) (-3889.804) (-3893.228) [-3881.244] * (-3890.169) [-3884.725] (-3885.265) (-3892.059) -- 0:03:20 293500 -- (-3897.630) [-3883.881] (-3885.555) (-3885.496) * (-3883.460) (-3884.213) [-3883.721] (-3886.974) -- 0:03:19 294000 -- (-3886.801) (-3884.727) (-3883.887) [-3883.341] * [-3882.160] (-3885.053) (-3886.110) (-3889.416) -- 0:03:19 294500 -- [-3885.234] (-3886.872) (-3884.721) (-3886.420) * (-3882.991) (-3887.014) (-3885.629) [-3887.449] -- 0:03:18 295000 -- (-3886.999) (-3889.950) (-3883.433) [-3884.088] * [-3881.216] (-3890.546) (-3885.847) (-3887.669) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 295500 -- (-3885.996) (-3892.615) (-3885.436) [-3882.633] * (-3886.849) [-3889.253] (-3889.790) (-3888.114) -- 0:03:20 296000 -- [-3884.668] (-3890.754) (-3884.931) (-3886.960) * (-3882.642) (-3890.136) (-3885.119) [-3884.546] -- 0:03:19 296500 -- (-3891.100) (-3888.188) [-3884.749] (-3889.595) * (-3883.244) (-3893.277) [-3888.321] (-3892.329) -- 0:03:19 297000 -- (-3892.432) [-3887.049] (-3881.664) (-3893.233) * [-3889.126] (-3889.736) (-3884.680) (-3883.682) -- 0:03:18 297500 -- [-3883.836] (-3889.908) (-3884.330) (-3885.352) * (-3890.283) (-3897.574) (-3884.911) [-3887.709] -- 0:03:18 298000 -- (-3883.836) (-3882.123) (-3895.669) [-3883.485] * (-3885.376) (-3883.648) (-3889.265) [-3884.586] -- 0:03:17 298500 -- (-3883.407) (-3885.510) (-3884.979) [-3880.818] * [-3888.613] (-3893.214) (-3884.315) (-3882.569) -- 0:03:19 299000 -- (-3883.604) [-3883.371] (-3881.986) (-3887.797) * (-3880.901) (-3889.362) [-3884.220] (-3886.269) -- 0:03:19 299500 -- (-3884.666) [-3887.743] (-3887.761) (-3893.024) * (-3883.885) (-3886.510) [-3882.059] (-3882.141) -- 0:03:18 300000 -- (-3885.486) (-3882.708) [-3882.107] (-3886.804) * (-3882.949) (-3894.053) (-3885.708) [-3885.468] -- 0:03:18 Average standard deviation of split frequencies: 0.000000 300500 -- (-3883.403) (-3887.586) (-3886.344) [-3888.638] * [-3885.878] (-3885.918) (-3887.936) (-3883.370) -- 0:03:17 301000 -- (-3884.082) (-3887.911) (-3883.517) [-3883.231] * [-3884.028] (-3883.243) (-3887.500) (-3881.411) -- 0:03:17 301500 -- [-3881.075] (-3888.331) (-3883.716) (-3882.750) * (-3884.570) (-3891.581) [-3884.298] (-3889.282) -- 0:03:16 302000 -- (-3884.053) [-3886.006] (-3891.593) (-3882.334) * [-3884.440] (-3882.400) (-3884.364) (-3883.549) -- 0:03:18 302500 -- (-3890.901) (-3887.302) [-3880.296] (-3885.990) * (-3883.331) (-3888.921) (-3886.398) [-3886.921] -- 0:03:18 303000 -- [-3886.348] (-3888.056) (-3882.276) (-3888.664) * (-3887.622) (-3889.078) [-3888.670] (-3887.272) -- 0:03:17 303500 -- (-3887.774) (-3887.062) [-3883.246] (-3888.696) * (-3884.498) (-3888.905) (-3892.804) [-3888.201] -- 0:03:17 304000 -- (-3883.862) (-3886.203) (-3883.603) [-3885.765] * (-3883.877) (-3890.903) [-3888.233] (-3887.656) -- 0:03:16 304500 -- (-3884.287) (-3888.525) [-3889.342] (-3882.974) * (-3890.233) [-3888.744] (-3883.769) (-3884.329) -- 0:03:16 305000 -- (-3882.165) (-3888.652) (-3882.034) [-3881.731] * (-3882.798) (-3882.819) (-3879.605) [-3885.608] -- 0:03:15 Average standard deviation of split frequencies: 0.000000 305500 -- (-3881.271) (-3885.217) (-3891.690) [-3882.927] * (-3883.854) [-3881.798] (-3891.863) (-3888.937) -- 0:03:17 306000 -- (-3884.945) (-3894.027) (-3888.786) [-3887.938] * (-3889.852) (-3889.776) (-3887.857) [-3893.285] -- 0:03:17 306500 -- (-3887.997) (-3884.351) (-3891.188) [-3883.183] * [-3881.210] (-3893.493) (-3882.869) (-3884.580) -- 0:03:16 307000 -- [-3881.339] (-3885.640) (-3894.695) (-3891.972) * [-3886.434] (-3886.243) (-3884.630) (-3887.088) -- 0:03:16 307500 -- (-3884.515) (-3881.984) (-3885.643) [-3881.214] * (-3890.779) [-3881.734] (-3886.930) (-3884.482) -- 0:03:15 308000 -- (-3886.106) [-3881.528] (-3887.076) (-3884.333) * (-3884.217) [-3881.156] (-3887.572) (-3887.107) -- 0:03:15 308500 -- (-3894.212) (-3881.970) [-3885.702] (-3882.838) * (-3885.272) (-3881.960) [-3886.407] (-3885.620) -- 0:03:15 309000 -- (-3887.510) (-3886.946) [-3885.794] (-3878.719) * (-3884.142) [-3880.596] (-3879.535) (-3887.461) -- 0:03:16 309500 -- (-3893.378) (-3885.178) [-3885.809] (-3885.724) * (-3886.955) (-3892.265) [-3882.340] (-3887.601) -- 0:03:16 310000 -- (-3889.564) [-3883.967] (-3886.935) (-3893.471) * [-3882.785] (-3886.088) (-3885.527) (-3885.485) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 310500 -- (-3893.917) (-3887.073) (-3886.370) [-3890.366] * (-3890.733) [-3883.528] (-3882.928) (-3889.094) -- 0:03:15 311000 -- (-3891.929) (-3882.940) [-3886.736] (-3887.180) * [-3885.644] (-3883.035) (-3883.922) (-3890.131) -- 0:03:14 311500 -- (-3892.418) [-3887.269] (-3886.674) (-3883.840) * (-3890.676) (-3888.778) [-3882.932] (-3889.403) -- 0:03:14 312000 -- (-3882.370) (-3886.082) (-3886.465) [-3886.097] * (-3887.656) (-3884.084) [-3882.851] (-3883.856) -- 0:03:14 312500 -- (-3882.249) [-3880.711] (-3884.584) (-3883.932) * [-3883.050] (-3885.308) (-3883.939) (-3883.172) -- 0:03:15 313000 -- (-3884.391) [-3883.956] (-3888.738) (-3883.353) * (-3885.473) (-3886.713) [-3888.042] (-3887.965) -- 0:03:15 313500 -- (-3891.930) [-3883.479] (-3891.748) (-3884.626) * (-3887.576) (-3890.839) [-3887.281] (-3890.419) -- 0:03:14 314000 -- (-3884.369) (-3888.658) (-3883.046) [-3886.498] * (-3886.118) (-3889.258) [-3884.292] (-3884.048) -- 0:03:14 314500 -- (-3892.789) [-3886.311] (-3884.100) (-3885.663) * [-3883.485] (-3887.966) (-3887.260) (-3889.297) -- 0:03:13 315000 -- (-3887.318) [-3880.533] (-3883.480) (-3880.780) * (-3883.293) [-3886.320] (-3884.370) (-3886.208) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 315500 -- (-3888.219) (-3884.892) (-3885.701) [-3887.307] * (-3884.842) [-3886.585] (-3883.007) (-3884.262) -- 0:03:13 316000 -- (-3886.216) [-3885.275] (-3888.533) (-3891.233) * (-3884.964) [-3888.184] (-3885.286) (-3880.875) -- 0:03:14 316500 -- (-3889.022) (-3887.717) [-3883.776] (-3889.795) * (-3892.675) [-3883.070] (-3889.867) (-3884.389) -- 0:03:14 317000 -- (-3881.997) (-3885.520) (-3883.764) [-3886.886] * (-3886.008) (-3886.921) [-3885.662] (-3886.645) -- 0:03:13 317500 -- (-3882.559) (-3885.033) (-3889.932) [-3884.163] * (-3896.900) [-3885.567] (-3886.322) (-3882.115) -- 0:03:13 318000 -- (-3885.085) (-3886.252) [-3884.701] (-3885.076) * [-3884.458] (-3889.311) (-3882.657) (-3889.528) -- 0:03:13 318500 -- (-3884.996) (-3884.257) (-3885.434) [-3887.214] * (-3882.025) (-3883.305) [-3884.001] (-3890.354) -- 0:03:12 319000 -- (-3883.155) [-3889.757] (-3887.763) (-3879.543) * (-3889.472) (-3890.376) (-3886.200) [-3882.285] -- 0:03:12 319500 -- [-3880.901] (-3883.241) (-3894.246) (-3884.350) * (-3883.074) (-3886.028) [-3885.049] (-3881.252) -- 0:03:13 320000 -- [-3890.793] (-3885.496) (-3888.313) (-3889.763) * (-3891.837) (-3883.643) [-3883.131] (-3886.110) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 320500 -- (-3888.261) (-3883.270) [-3885.041] (-3884.570) * (-3893.192) (-3888.275) (-3889.740) [-3886.037] -- 0:03:12 321000 -- (-3884.312) (-3885.691) (-3884.733) [-3884.959] * [-3887.352] (-3884.230) (-3889.138) (-3885.847) -- 0:03:12 321500 -- (-3886.185) (-3884.413) (-3884.731) [-3881.764] * (-3890.258) (-3883.430) (-3885.422) [-3882.184] -- 0:03:12 322000 -- (-3887.913) (-3885.901) (-3892.681) [-3882.615] * (-3882.573) (-3889.719) (-3886.172) [-3886.416] -- 0:03:11 322500 -- (-3889.371) [-3884.092] (-3889.731) (-3887.322) * (-3885.494) (-3888.889) [-3887.233] (-3890.922) -- 0:03:11 323000 -- (-3887.606) (-3882.838) (-3889.418) [-3882.172] * (-3886.990) [-3881.602] (-3893.983) (-3886.173) -- 0:03:12 323500 -- (-3892.642) (-3886.705) (-3889.460) [-3883.152] * (-3883.481) [-3888.584] (-3892.330) (-3881.789) -- 0:03:12 324000 -- (-3891.724) (-3882.444) (-3888.975) [-3884.289] * (-3886.015) (-3881.411) (-3889.755) [-3884.717] -- 0:03:11 324500 -- (-3880.497) [-3880.291] (-3886.858) (-3888.025) * (-3882.335) (-3884.279) (-3889.236) [-3882.385] -- 0:03:11 325000 -- (-3888.795) [-3880.478] (-3884.418) (-3890.329) * (-3890.653) (-3881.344) (-3884.651) [-3883.921] -- 0:03:11 Average standard deviation of split frequencies: 0.000000 325500 -- (-3884.873) [-3885.035] (-3883.214) (-3887.729) * (-3887.605) (-3889.928) (-3888.915) [-3886.992] -- 0:03:10 326000 -- (-3886.468) [-3886.394] (-3885.273) (-3886.269) * [-3882.181] (-3884.804) (-3881.627) (-3882.352) -- 0:03:10 326500 -- (-3888.706) (-3890.423) [-3879.936] (-3882.216) * (-3890.000) (-3882.657) (-3888.575) [-3882.882] -- 0:03:11 327000 -- (-3886.977) (-3888.469) (-3890.319) [-3885.977] * (-3893.203) (-3886.317) (-3884.871) [-3883.788] -- 0:03:11 327500 -- [-3882.766] (-3887.412) (-3882.640) (-3886.862) * (-3897.458) (-3894.914) (-3885.139) [-3891.981] -- 0:03:10 328000 -- (-3889.711) (-3887.535) [-3886.068] (-3883.300) * [-3887.528] (-3888.475) (-3880.916) (-3881.645) -- 0:03:10 328500 -- (-3888.528) [-3884.596] (-3890.618) (-3884.279) * (-3887.980) [-3886.797] (-3883.815) (-3879.904) -- 0:03:10 329000 -- [-3886.194] (-3883.452) (-3881.629) (-3883.181) * (-3890.641) (-3884.186) [-3883.885] (-3885.947) -- 0:03:09 329500 -- (-3887.242) (-3893.761) (-3885.826) [-3885.393] * [-3884.471] (-3888.433) (-3883.900) (-3886.235) -- 0:03:09 330000 -- [-3884.945] (-3886.596) (-3885.970) (-3890.193) * [-3883.687] (-3884.454) (-3880.381) (-3886.110) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 330500 -- (-3889.370) (-3888.903) [-3882.436] (-3886.783) * (-3883.394) (-3886.194) (-3883.455) [-3886.833] -- 0:03:10 331000 -- (-3884.127) [-3883.812] (-3885.330) (-3886.561) * (-3888.713) [-3885.948] (-3884.219) (-3885.475) -- 0:03:09 331500 -- [-3884.701] (-3892.276) (-3892.251) (-3882.505) * (-3887.247) (-3890.951) (-3886.062) [-3887.761] -- 0:03:09 332000 -- (-3883.875) [-3892.029] (-3884.465) (-3883.826) * (-3889.629) (-3885.093) [-3889.532] (-3897.414) -- 0:03:09 332500 -- (-3891.080) [-3883.888] (-3887.430) (-3887.342) * (-3889.768) (-3884.648) [-3881.512] (-3889.555) -- 0:03:08 333000 -- (-3887.894) (-3887.579) (-3882.382) [-3885.333] * (-3884.789) (-3885.125) [-3881.100] (-3893.458) -- 0:03:08 333500 -- (-3887.483) (-3889.243) (-3884.259) [-3883.519] * (-3886.657) [-3883.690] (-3885.985) (-3884.584) -- 0:03:09 334000 -- (-3883.543) (-3888.975) [-3889.191] (-3885.756) * (-3890.649) (-3884.545) (-3884.830) [-3882.243] -- 0:03:09 334500 -- (-3883.184) (-3893.830) [-3884.330] (-3882.775) * (-3884.386) (-3883.659) [-3885.281] (-3889.610) -- 0:03:09 335000 -- [-3889.487] (-3893.791) (-3885.402) (-3890.108) * (-3886.158) [-3884.071] (-3886.283) (-3890.147) -- 0:03:08 Average standard deviation of split frequencies: 0.000000 335500 -- (-3883.390) (-3892.349) [-3882.537] (-3887.643) * (-3890.314) (-3886.360) [-3884.847] (-3894.903) -- 0:03:08 336000 -- [-3880.165] (-3893.447) (-3889.214) (-3885.296) * (-3889.039) [-3881.071] (-3885.984) (-3894.992) -- 0:03:07 336500 -- (-3883.638) (-3885.673) (-3889.187) [-3888.832] * [-3888.823] (-3879.913) (-3887.791) (-3890.510) -- 0:03:07 337000 -- (-3883.477) (-3892.681) (-3892.772) [-3886.254] * (-3885.283) (-3885.423) [-3887.117] (-3887.724) -- 0:03:08 337500 -- [-3882.115] (-3884.379) (-3892.668) (-3880.861) * (-3887.825) (-3887.770) (-3890.252) [-3883.615] -- 0:03:08 338000 -- (-3882.746) (-3883.662) (-3893.458) [-3881.467] * (-3883.657) (-3890.906) [-3882.689] (-3881.525) -- 0:03:08 338500 -- (-3881.751) [-3887.539] (-3881.877) (-3885.768) * (-3887.144) (-3885.298) (-3885.819) [-3880.335] -- 0:03:07 339000 -- (-3886.587) (-3891.350) [-3886.735] (-3883.252) * (-3885.446) [-3885.595] (-3886.366) (-3884.636) -- 0:03:07 339500 -- (-3893.222) (-3884.238) (-3885.459) [-3887.344] * (-3882.461) [-3892.779] (-3887.551) (-3884.127) -- 0:03:06 340000 -- [-3885.335] (-3887.786) (-3888.931) (-3882.805) * (-3886.326) [-3889.165] (-3886.429) (-3888.684) -- 0:03:06 Average standard deviation of split frequencies: 0.000000 340500 -- [-3887.010] (-3885.183) (-3881.977) (-3884.971) * (-3887.831) (-3885.143) [-3881.884] (-3886.144) -- 0:03:07 341000 -- [-3882.393] (-3886.591) (-3883.628) (-3890.801) * [-3880.028] (-3887.792) (-3886.930) (-3893.676) -- 0:03:07 341500 -- (-3892.552) (-3885.914) [-3880.934] (-3884.954) * (-3885.498) (-3888.781) [-3884.969] (-3895.273) -- 0:03:07 342000 -- [-3888.726] (-3887.948) (-3886.468) (-3882.357) * (-3883.104) (-3886.611) (-3889.639) [-3886.940] -- 0:03:06 342500 -- [-3887.545] (-3882.722) (-3879.960) (-3888.646) * (-3885.844) (-3887.103) (-3885.333) [-3884.026] -- 0:03:06 343000 -- (-3886.045) [-3882.982] (-3880.667) (-3883.407) * (-3884.234) [-3884.910] (-3884.677) (-3884.332) -- 0:03:05 343500 -- (-3882.102) [-3883.904] (-3883.105) (-3886.329) * (-3883.504) (-3886.978) (-3883.739) [-3884.123] -- 0:03:05 344000 -- (-3888.900) (-3881.353) [-3891.783] (-3887.346) * (-3884.565) (-3884.778) (-3886.639) [-3884.121] -- 0:03:06 344500 -- (-3887.223) (-3886.402) (-3887.429) [-3886.917] * (-3883.474) [-3882.879] (-3885.516) (-3879.914) -- 0:03:06 345000 -- [-3881.785] (-3885.044) (-3890.726) (-3885.343) * (-3887.640) [-3883.633] (-3886.429) (-3889.241) -- 0:03:06 Average standard deviation of split frequencies: 0.000000 345500 -- (-3886.496) (-3883.858) [-3881.077] (-3888.313) * (-3894.344) [-3885.445] (-3890.456) (-3885.655) -- 0:03:05 346000 -- (-3885.769) (-3885.038) [-3886.399] (-3888.928) * [-3881.880] (-3884.811) (-3889.670) (-3883.401) -- 0:03:05 346500 -- [-3884.594] (-3882.386) (-3886.911) (-3887.557) * (-3881.670) (-3886.222) (-3891.061) [-3887.011] -- 0:03:04 347000 -- (-3883.034) (-3883.651) [-3884.415] (-3879.775) * (-3886.902) (-3884.212) (-3882.604) [-3888.293] -- 0:03:04 347500 -- [-3886.655] (-3884.418) (-3884.452) (-3884.682) * (-3885.069) (-3886.460) (-3881.649) [-3883.768] -- 0:03:05 348000 -- (-3884.777) (-3883.946) (-3882.046) [-3883.524] * (-3882.501) [-3883.698] (-3882.421) (-3880.482) -- 0:03:05 348500 -- (-3889.484) (-3886.529) [-3887.378] (-3882.791) * (-3883.820) (-3883.049) (-3887.715) [-3884.237] -- 0:03:05 349000 -- [-3889.470] (-3890.932) (-3889.745) (-3881.493) * (-3885.402) [-3881.405] (-3885.453) (-3889.011) -- 0:03:04 349500 -- (-3884.617) [-3884.245] (-3892.010) (-3882.749) * (-3886.534) (-3883.066) [-3883.443] (-3886.433) -- 0:03:04 350000 -- (-3885.508) [-3883.335] (-3887.406) (-3887.185) * [-3888.966] (-3892.869) (-3893.315) (-3887.775) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 350500 -- (-3892.573) (-3883.481) (-3887.211) [-3883.527] * (-3884.825) (-3883.949) [-3882.884] (-3883.905) -- 0:03:03 351000 -- (-3888.736) (-3883.636) [-3885.158] (-3884.732) * [-3882.954] (-3887.565) (-3885.949) (-3895.181) -- 0:03:04 351500 -- (-3894.926) (-3892.313) [-3886.321] (-3887.337) * (-3887.064) (-3883.534) [-3887.799] (-3883.365) -- 0:03:04 352000 -- (-3889.523) (-3888.854) (-3894.863) [-3882.230] * (-3895.505) [-3884.848] (-3882.708) (-3885.167) -- 0:03:04 352500 -- (-3884.066) (-3884.150) [-3883.544] (-3884.719) * (-3893.251) [-3886.107] (-3883.840) (-3892.843) -- 0:03:03 353000 -- (-3888.838) (-3881.849) (-3889.667) [-3887.813] * (-3885.111) (-3885.105) [-3884.375] (-3886.383) -- 0:03:03 353500 -- [-3882.603] (-3882.748) (-3886.284) (-3883.352) * (-3882.331) [-3883.401] (-3889.118) (-3888.446) -- 0:03:02 354000 -- [-3883.733] (-3886.446) (-3886.920) (-3887.548) * (-3881.933) (-3881.024) (-3888.824) [-3882.559] -- 0:03:02 354500 -- [-3883.587] (-3891.166) (-3889.690) (-3885.934) * [-3892.569] (-3886.620) (-3890.580) (-3890.112) -- 0:03:02 355000 -- (-3887.549) (-3881.539) (-3884.696) [-3881.659] * (-3885.409) (-3888.404) [-3886.578] (-3886.434) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 355500 -- (-3886.234) [-3889.091] (-3884.738) (-3883.773) * (-3882.480) [-3884.639] (-3886.084) (-3889.369) -- 0:03:03 356000 -- (-3885.930) (-3883.083) (-3885.780) [-3886.969] * (-3884.701) (-3884.702) (-3890.513) [-3882.762] -- 0:03:02 356500 -- (-3888.925) (-3882.427) (-3887.160) [-3884.117] * (-3887.455) (-3893.377) (-3886.844) [-3883.545] -- 0:03:02 357000 -- (-3893.553) [-3882.754] (-3890.405) (-3888.311) * [-3884.754] (-3886.707) (-3884.147) (-3884.327) -- 0:03:01 357500 -- (-3893.593) [-3881.896] (-3892.336) (-3890.157) * [-3887.619] (-3884.206) (-3880.148) (-3889.856) -- 0:03:01 358000 -- (-3893.765) (-3886.307) (-3887.348) [-3884.072] * (-3880.707) [-3886.939] (-3885.858) (-3889.966) -- 0:03:01 358500 -- (-3889.210) (-3884.920) [-3885.100] (-3884.312) * [-3883.659] (-3886.622) (-3888.965) (-3888.432) -- 0:03:02 359000 -- [-3890.742] (-3883.708) (-3893.153) (-3884.905) * [-3886.209] (-3894.143) (-3884.316) (-3881.223) -- 0:03:02 359500 -- (-3890.499) (-3886.599) [-3880.306] (-3881.935) * (-3884.578) (-3888.500) (-3883.413) [-3887.483] -- 0:03:01 360000 -- (-3882.643) [-3888.663] (-3888.589) (-3884.385) * [-3885.686] (-3887.109) (-3888.628) (-3887.873) -- 0:03:01 Average standard deviation of split frequencies: 0.000000 360500 -- (-3887.905) (-3895.421) [-3882.988] (-3885.579) * (-3886.309) (-3885.229) [-3884.467] (-3880.105) -- 0:03:00 361000 -- (-3891.553) (-3884.438) (-3890.078) [-3882.878] * [-3883.538] (-3887.867) (-3886.912) (-3886.621) -- 0:03:00 361500 -- (-3892.363) (-3885.199) (-3887.613) [-3881.097] * (-3891.013) (-3883.983) (-3884.361) [-3887.312] -- 0:03:00 362000 -- (-3886.882) [-3880.248] (-3881.830) (-3883.321) * (-3882.997) [-3883.588] (-3887.757) (-3894.915) -- 0:03:01 362500 -- (-3884.603) [-3881.274] (-3887.416) (-3891.309) * [-3883.231] (-3883.390) (-3883.531) (-3892.181) -- 0:03:01 363000 -- [-3886.157] (-3891.936) (-3895.265) (-3892.291) * [-3886.638] (-3881.278) (-3883.427) (-3885.552) -- 0:03:00 363500 -- (-3883.102) [-3885.139] (-3884.562) (-3890.269) * (-3885.428) (-3888.395) (-3883.240) [-3883.754] -- 0:03:00 364000 -- (-3888.330) [-3888.624] (-3882.493) (-3883.426) * (-3881.919) (-3885.995) (-3885.576) [-3886.450] -- 0:02:59 364500 -- (-3881.381) (-3884.450) (-3893.331) [-3882.301] * [-3882.057] (-3885.263) (-3887.405) (-3883.856) -- 0:02:59 365000 -- (-3886.368) (-3886.914) (-3892.927) [-3884.404] * [-3883.057] (-3887.084) (-3890.234) (-3883.503) -- 0:02:59 Average standard deviation of split frequencies: 0.000000 365500 -- [-3881.346] (-3891.806) (-3891.583) (-3886.101) * (-3889.258) (-3888.543) (-3888.847) [-3881.560] -- 0:03:00 366000 -- [-3883.435] (-3883.244) (-3887.755) (-3882.216) * (-3881.106) (-3883.455) (-3887.971) [-3889.601] -- 0:03:00 366500 -- (-3880.470) (-3884.326) (-3887.371) [-3892.271] * (-3881.219) (-3886.982) (-3885.368) [-3884.111] -- 0:02:59 367000 -- [-3887.064] (-3881.359) (-3885.975) (-3879.774) * [-3881.607] (-3887.386) (-3888.224) (-3885.610) -- 0:02:59 367500 -- (-3888.001) (-3886.320) (-3883.252) [-3891.666] * (-3891.461) (-3880.564) (-3884.346) [-3882.884] -- 0:02:58 368000 -- (-3883.145) (-3886.909) (-3885.803) [-3879.852] * (-3885.551) (-3886.406) [-3885.721] (-3880.804) -- 0:02:58 368500 -- [-3885.762] (-3883.618) (-3883.236) (-3883.542) * (-3883.512) [-3885.249] (-3884.914) (-3887.077) -- 0:02:58 369000 -- (-3891.194) [-3884.351] (-3890.861) (-3886.404) * [-3881.922] (-3884.878) (-3888.873) (-3887.938) -- 0:02:59 369500 -- (-3886.462) (-3884.771) [-3886.446] (-3882.548) * (-3883.579) (-3880.972) [-3881.971] (-3882.447) -- 0:02:59 370000 -- [-3883.894] (-3888.789) (-3886.986) (-3886.134) * (-3882.007) [-3884.438] (-3884.715) (-3881.722) -- 0:02:58 Average standard deviation of split frequencies: 0.000000 370500 -- (-3883.421) [-3889.646] (-3884.039) (-3887.177) * (-3888.923) (-3892.212) (-3888.572) [-3887.701] -- 0:02:58 371000 -- (-3887.602) (-3888.576) (-3885.286) [-3879.946] * (-3889.995) (-3885.187) (-3881.768) [-3883.119] -- 0:02:58 371500 -- (-3893.010) [-3887.365] (-3886.918) (-3884.887) * [-3881.509] (-3887.677) (-3888.730) (-3886.252) -- 0:02:57 372000 -- (-3890.971) [-3883.751] (-3889.587) (-3889.611) * (-3900.317) (-3886.412) (-3888.760) [-3888.122] -- 0:02:57 372500 -- (-3887.862) [-3883.644] (-3888.472) (-3884.558) * [-3890.208] (-3895.289) (-3889.468) (-3885.200) -- 0:02:58 373000 -- [-3888.738] (-3881.281) (-3891.583) (-3889.007) * (-3893.729) (-3881.816) (-3889.147) [-3881.392] -- 0:02:58 373500 -- (-3889.854) (-3887.894) (-3892.065) [-3887.998] * [-3884.226] (-3885.362) (-3886.347) (-3891.427) -- 0:02:57 374000 -- (-3888.802) [-3886.603] (-3883.700) (-3883.428) * [-3882.944] (-3888.173) (-3885.025) (-3888.431) -- 0:02:57 374500 -- (-3886.815) (-3892.709) [-3882.475] (-3883.689) * (-3882.701) (-3890.962) [-3883.602] (-3889.044) -- 0:02:57 375000 -- (-3886.382) (-3888.620) [-3885.070] (-3882.235) * (-3882.407) (-3886.066) (-3887.458) [-3882.482] -- 0:02:56 Average standard deviation of split frequencies: 0.000000 375500 -- (-3887.790) [-3888.840] (-3888.240) (-3887.506) * (-3892.533) [-3879.883] (-3887.715) (-3884.042) -- 0:02:56 376000 -- [-3881.583] (-3889.289) (-3889.086) (-3882.626) * (-3887.068) (-3885.779) (-3886.779) [-3882.427] -- 0:02:57 376500 -- (-3887.131) (-3888.121) [-3886.057] (-3883.616) * [-3886.943] (-3885.583) (-3881.901) (-3886.154) -- 0:02:57 377000 -- [-3885.518] (-3881.862) (-3886.137) (-3892.814) * (-3886.050) (-3890.038) [-3888.352] (-3884.748) -- 0:02:56 377500 -- (-3890.905) (-3881.471) [-3885.457] (-3890.033) * [-3886.141] (-3887.828) (-3890.383) (-3884.534) -- 0:02:56 378000 -- (-3889.176) [-3883.643] (-3885.012) (-3884.977) * (-3884.111) (-3892.158) [-3880.726] (-3884.095) -- 0:02:56 378500 -- (-3893.006) (-3883.304) (-3882.148) [-3886.477] * (-3885.294) (-3885.079) [-3880.547] (-3884.253) -- 0:02:55 379000 -- (-3894.814) (-3884.547) (-3883.431) [-3884.382] * (-3885.927) (-3884.097) [-3882.246] (-3887.240) -- 0:02:55 379500 -- (-3890.087) [-3884.172] (-3882.296) (-3892.155) * (-3885.308) (-3880.644) (-3889.471) [-3884.989] -- 0:02:56 380000 -- (-3890.592) (-3887.840) [-3882.362] (-3890.314) * (-3887.726) (-3889.838) (-3889.962) [-3884.629] -- 0:02:56 Average standard deviation of split frequencies: 0.000000 380500 -- [-3890.242] (-3888.397) (-3886.869) (-3885.909) * (-3886.677) (-3883.343) (-3888.018) [-3887.818] -- 0:02:55 381000 -- (-3887.717) (-3885.350) [-3884.681] (-3886.772) * (-3885.175) (-3883.284) [-3888.483] (-3886.664) -- 0:02:55 381500 -- [-3883.543] (-3881.986) (-3885.344) (-3884.012) * [-3882.989] (-3885.268) (-3889.024) (-3883.307) -- 0:02:55 382000 -- (-3892.460) (-3887.233) [-3890.389] (-3881.136) * [-3881.253] (-3883.855) (-3890.677) (-3885.864) -- 0:02:54 382500 -- (-3892.062) [-3884.020] (-3892.975) (-3887.079) * (-3888.913) (-3884.360) (-3894.618) [-3891.345] -- 0:02:54 383000 -- (-3889.511) (-3886.400) (-3885.634) [-3885.743] * (-3887.937) [-3884.702] (-3886.308) (-3884.608) -- 0:02:55 383500 -- [-3885.843] (-3887.013) (-3890.890) (-3883.680) * (-3881.264) (-3881.694) [-3889.015] (-3884.273) -- 0:02:55 384000 -- (-3882.360) (-3881.200) (-3883.370) [-3885.287] * (-3890.536) [-3883.408] (-3892.647) (-3884.003) -- 0:02:54 384500 -- [-3881.962] (-3889.731) (-3885.393) (-3891.054) * (-3888.736) [-3886.956] (-3888.844) (-3884.824) -- 0:02:54 385000 -- (-3886.052) (-3884.588) [-3881.300] (-3886.351) * (-3885.015) (-3886.279) [-3885.894] (-3888.868) -- 0:02:54 Average standard deviation of split frequencies: 0.000000 385500 -- (-3886.921) [-3881.488] (-3880.805) (-3887.101) * (-3882.274) (-3884.190) [-3882.335] (-3889.380) -- 0:02:53 386000 -- (-3887.828) (-3885.947) (-3883.321) [-3884.355] * (-3886.480) (-3887.896) (-3885.498) [-3888.092] -- 0:02:53 386500 -- (-3889.032) [-3885.237] (-3882.170) (-3886.809) * (-3881.180) [-3886.070] (-3885.637) (-3900.089) -- 0:02:54 387000 -- (-3882.832) (-3893.036) [-3885.942] (-3888.434) * (-3885.642) (-3881.759) (-3888.527) [-3884.276] -- 0:02:54 387500 -- [-3885.177] (-3889.532) (-3880.248) (-3886.560) * (-3887.747) (-3884.067) (-3884.733) [-3890.463] -- 0:02:53 388000 -- (-3883.190) (-3881.170) (-3887.533) [-3881.736] * (-3888.776) (-3883.450) [-3885.705] (-3896.292) -- 0:02:53 388500 -- (-3885.011) (-3886.696) [-3892.176] (-3883.856) * (-3882.421) [-3884.111] (-3886.304) (-3889.613) -- 0:02:53 389000 -- (-3885.341) (-3886.449) (-3883.481) [-3881.337] * (-3883.719) [-3887.942] (-3884.072) (-3888.812) -- 0:02:52 389500 -- (-3884.735) (-3894.426) (-3886.122) [-3883.828] * (-3884.065) (-3890.612) [-3880.517] (-3885.822) -- 0:02:52 390000 -- (-3879.779) (-3888.967) [-3881.421] (-3883.369) * [-3883.644] (-3890.179) (-3884.808) (-3890.454) -- 0:02:53 Average standard deviation of split frequencies: 0.000000 390500 -- [-3880.356] (-3894.315) (-3885.999) (-3881.041) * (-3885.041) (-3890.203) [-3882.960] (-3886.374) -- 0:02:53 391000 -- [-3884.370] (-3889.870) (-3887.991) (-3886.642) * (-3888.865) (-3890.105) (-3881.685) [-3881.184] -- 0:02:52 391500 -- (-3881.075) (-3892.650) [-3882.821] (-3882.138) * (-3881.921) [-3887.672] (-3886.961) (-3888.307) -- 0:02:52 392000 -- (-3894.748) (-3895.334) (-3886.830) [-3885.760] * (-3899.227) (-3886.744) (-3886.293) [-3881.384] -- 0:02:52 392500 -- (-3881.830) [-3891.566] (-3885.889) (-3886.431) * (-3885.128) (-3884.242) (-3885.260) [-3885.494] -- 0:02:51 393000 -- (-3885.468) (-3888.005) (-3881.755) [-3881.625] * [-3883.044] (-3886.011) (-3885.315) (-3881.085) -- 0:02:51 393500 -- (-3884.004) (-3888.337) [-3884.463] (-3883.443) * (-3901.792) (-3882.525) (-3884.095) [-3883.062] -- 0:02:52 394000 -- (-3892.519) (-3885.877) (-3882.754) [-3883.289] * (-3885.587) (-3890.109) (-3890.772) [-3880.817] -- 0:02:52 394500 -- (-3888.572) [-3887.218] (-3885.164) (-3882.012) * [-3880.187] (-3891.073) (-3883.287) (-3892.723) -- 0:02:51 395000 -- [-3882.693] (-3885.822) (-3889.528) (-3887.538) * (-3890.421) (-3895.901) [-3882.178] (-3895.018) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 395500 -- [-3893.054] (-3882.086) (-3885.259) (-3889.898) * (-3887.986) (-3885.619) [-3883.036] (-3890.980) -- 0:02:51 396000 -- [-3879.887] (-3886.941) (-3889.044) (-3886.977) * (-3886.608) [-3881.259] (-3880.665) (-3886.489) -- 0:02:50 396500 -- (-3892.500) [-3885.824] (-3886.777) (-3884.134) * (-3885.085) (-3886.910) [-3881.173] (-3888.750) -- 0:02:50 397000 -- [-3891.185] (-3879.277) (-3883.595) (-3889.247) * [-3882.069] (-3885.630) (-3884.065) (-3884.225) -- 0:02:51 397500 -- (-3886.455) (-3887.257) [-3888.293] (-3885.431) * (-3889.078) [-3884.025] (-3889.110) (-3891.139) -- 0:02:51 398000 -- (-3886.610) (-3890.317) (-3885.959) [-3881.351] * [-3885.493] (-3882.737) (-3881.946) (-3882.191) -- 0:02:50 398500 -- (-3886.833) [-3888.276] (-3885.747) (-3884.919) * (-3885.850) [-3886.693] (-3884.657) (-3888.101) -- 0:02:50 399000 -- (-3883.679) [-3881.440] (-3890.314) (-3884.536) * (-3885.213) (-3881.948) [-3881.981] (-3884.968) -- 0:02:50 399500 -- (-3884.751) [-3882.744] (-3887.461) (-3883.629) * (-3884.773) [-3889.988] (-3884.882) (-3886.547) -- 0:02:49 400000 -- (-3887.468) [-3882.418] (-3887.232) (-3887.134) * (-3884.299) [-3884.541] (-3887.290) (-3885.819) -- 0:02:49 Average standard deviation of split frequencies: 0.000000 400500 -- (-3888.424) (-3881.297) (-3886.554) [-3887.955] * (-3886.224) (-3881.288) (-3880.714) [-3884.849] -- 0:02:50 401000 -- (-3887.546) (-3883.611) [-3886.265] (-3885.542) * (-3881.691) (-3888.834) (-3887.846) [-3883.139] -- 0:02:50 401500 -- (-3888.339) (-3886.167) [-3887.850] (-3892.401) * [-3885.102] (-3886.033) (-3885.656) (-3891.080) -- 0:02:49 402000 -- (-3889.520) (-3884.274) (-3886.286) [-3887.640] * (-3888.500) (-3882.600) [-3884.152] (-3884.237) -- 0:02:49 402500 -- [-3882.210] (-3889.914) (-3888.019) (-3888.607) * (-3888.715) (-3885.099) (-3887.120) [-3888.479] -- 0:02:49 403000 -- (-3882.959) (-3885.479) [-3885.564] (-3884.926) * (-3892.109) [-3885.781] (-3882.547) (-3885.934) -- 0:02:48 403500 -- (-3884.208) [-3885.545] (-3884.079) (-3886.331) * (-3895.260) (-3887.611) [-3882.132] (-3881.165) -- 0:02:48 404000 -- (-3885.939) (-3892.851) (-3881.973) [-3882.944] * (-3895.087) (-3892.595) [-3885.904] (-3884.827) -- 0:02:49 404500 -- [-3881.408] (-3884.576) (-3886.312) (-3885.221) * (-3894.654) (-3892.533) [-3887.599] (-3888.371) -- 0:02:49 405000 -- (-3880.865) (-3892.785) (-3884.622) [-3890.133] * [-3892.144] (-3882.228) (-3882.343) (-3888.216) -- 0:02:48 Average standard deviation of split frequencies: 0.000000 405500 -- (-3884.184) (-3882.320) [-3883.333] (-3892.449) * (-3887.390) (-3886.977) [-3882.373] (-3888.151) -- 0:02:48 406000 -- (-3889.858) (-3883.694) (-3890.241) [-3886.236] * [-3882.655] (-3884.162) (-3887.228) (-3889.692) -- 0:02:48 406500 -- (-3882.732) (-3884.989) [-3886.012] (-3887.946) * (-3888.073) (-3883.455) (-3885.276) [-3882.201] -- 0:02:47 407000 -- (-3881.605) (-3882.056) [-3886.917] (-3889.546) * (-3892.501) (-3882.486) [-3885.504] (-3881.722) -- 0:02:47 407500 -- (-3889.431) (-3884.800) [-3878.449] (-3884.785) * (-3887.597) [-3884.877] (-3888.325) (-3887.616) -- 0:02:48 408000 -- (-3885.392) [-3885.255] (-3885.828) (-3888.960) * [-3880.658] (-3887.608) (-3891.175) (-3887.507) -- 0:02:48 408500 -- (-3892.172) [-3889.935] (-3885.636) (-3882.327) * (-3883.938) [-3882.784] (-3889.718) (-3885.640) -- 0:02:47 409000 -- [-3884.852] (-3886.492) (-3886.699) (-3881.732) * [-3891.219] (-3895.104) (-3895.551) (-3882.116) -- 0:02:47 409500 -- (-3887.257) (-3882.267) [-3886.737] (-3891.268) * (-3899.163) (-3882.223) [-3885.008] (-3888.975) -- 0:02:47 410000 -- [-3882.380] (-3880.635) (-3886.518) (-3885.572) * (-3898.138) (-3884.948) [-3885.026] (-3889.575) -- 0:02:46 Average standard deviation of split frequencies: 0.000000 410500 -- (-3888.897) (-3891.648) [-3884.612] (-3889.337) * (-3882.729) [-3886.482] (-3886.687) (-3886.093) -- 0:02:46 411000 -- (-3893.743) (-3880.912) (-3884.612) [-3883.044] * (-3890.047) [-3889.577] (-3884.796) (-3892.503) -- 0:02:47 411500 -- (-3889.162) (-3884.676) (-3881.854) [-3885.271] * (-3891.080) (-3890.330) (-3885.995) [-3884.407] -- 0:02:47 412000 -- [-3884.114] (-3886.562) (-3885.291) (-3884.602) * (-3889.006) (-3889.699) [-3884.022] (-3885.418) -- 0:02:46 412500 -- (-3885.719) [-3884.516] (-3883.914) (-3885.658) * (-3884.127) (-3888.513) (-3887.979) [-3891.060] -- 0:02:46 413000 -- [-3884.664] (-3885.339) (-3886.152) (-3885.200) * (-3887.976) (-3893.078) (-3886.557) [-3882.793] -- 0:02:46 413500 -- (-3894.847) (-3882.514) [-3883.632] (-3884.866) * (-3892.306) (-3886.158) (-3884.855) [-3887.852] -- 0:02:45 414000 -- (-3886.227) (-3883.665) (-3879.940) [-3880.040] * [-3888.417] (-3884.643) (-3890.627) (-3882.633) -- 0:02:45 414500 -- (-3887.840) (-3884.552) [-3880.282] (-3883.883) * [-3884.157] (-3886.774) (-3895.296) (-3881.925) -- 0:02:46 415000 -- (-3886.823) [-3886.991] (-3883.557) (-3885.186) * (-3888.646) [-3887.022] (-3882.674) (-3883.948) -- 0:02:46 Average standard deviation of split frequencies: 0.000000 415500 -- (-3888.028) [-3883.217] (-3886.277) (-3887.089) * (-3885.209) [-3889.094] (-3886.641) (-3887.025) -- 0:02:45 416000 -- (-3886.614) (-3886.779) [-3882.222] (-3883.768) * (-3888.423) [-3887.757] (-3888.979) (-3882.087) -- 0:02:45 416500 -- (-3891.737) [-3881.280] (-3885.395) (-3896.216) * (-3886.091) [-3887.646] (-3888.215) (-3882.878) -- 0:02:45 417000 -- (-3881.967) [-3883.263] (-3889.689) (-3884.409) * [-3882.982] (-3887.100) (-3886.775) (-3881.196) -- 0:02:44 417500 -- (-3884.093) (-3884.746) (-3885.954) [-3881.722] * (-3883.224) (-3890.167) [-3889.716] (-3887.112) -- 0:02:44 418000 -- (-3883.332) (-3890.257) [-3885.016] (-3891.483) * (-3881.772) (-3883.111) (-3885.613) [-3884.129] -- 0:02:45 418500 -- (-3882.720) (-3887.162) (-3893.488) [-3889.212] * (-3888.351) (-3886.821) [-3888.413] (-3882.171) -- 0:02:45 419000 -- (-3889.034) (-3882.945) (-3888.692) [-3890.144] * [-3880.846] (-3887.466) (-3886.150) (-3883.814) -- 0:02:45 419500 -- (-3884.220) (-3882.630) [-3884.536] (-3888.488) * (-3886.566) (-3894.494) [-3886.087] (-3887.488) -- 0:02:44 420000 -- [-3880.601] (-3885.332) (-3885.526) (-3891.553) * (-3881.313) (-3883.076) [-3886.352] (-3889.712) -- 0:02:44 Average standard deviation of split frequencies: 0.000000 420500 -- [-3880.099] (-3887.938) (-3889.717) (-3885.500) * (-3882.885) [-3880.851] (-3886.714) (-3885.295) -- 0:02:43 421000 -- (-3888.585) (-3885.156) [-3888.436] (-3888.071) * (-3885.030) (-3891.204) [-3883.095] (-3889.255) -- 0:02:43 421500 -- (-3888.564) (-3882.448) [-3888.099] (-3887.967) * [-3884.147] (-3885.221) (-3883.380) (-3889.781) -- 0:02:44 422000 -- (-3888.932) (-3884.298) [-3888.481] (-3881.735) * (-3883.042) [-3886.333] (-3884.088) (-3883.487) -- 0:02:44 422500 -- (-3890.767) (-3888.952) (-3882.992) [-3886.797] * (-3885.017) (-3885.340) (-3883.234) [-3884.082] -- 0:02:44 423000 -- (-3883.312) (-3882.571) [-3885.738] (-3890.793) * [-3882.357] (-3881.919) (-3879.201) (-3891.045) -- 0:02:43 423500 -- (-3882.717) (-3882.192) [-3879.886] (-3885.727) * (-3885.700) (-3883.765) [-3883.924] (-3886.386) -- 0:02:43 424000 -- (-3881.979) [-3885.378] (-3885.055) (-3884.606) * (-3883.579) [-3881.971] (-3892.222) (-3885.054) -- 0:02:43 424500 -- [-3881.440] (-3886.702) (-3884.430) (-3883.527) * [-3888.747] (-3885.684) (-3885.754) (-3885.860) -- 0:02:42 425000 -- (-3884.098) (-3882.056) (-3886.630) [-3884.051] * [-3883.849] (-3893.577) (-3887.619) (-3883.452) -- 0:02:43 Average standard deviation of split frequencies: 0.000000 425500 -- [-3883.187] (-3885.075) (-3886.841) (-3883.248) * (-3882.140) (-3888.194) (-3893.779) [-3883.979] -- 0:02:43 426000 -- (-3883.173) [-3885.807] (-3886.230) (-3885.999) * [-3882.222] (-3887.307) (-3882.727) (-3880.491) -- 0:02:43 426500 -- (-3880.398) [-3883.579] (-3887.931) (-3882.404) * (-3884.925) (-3886.265) (-3890.685) [-3884.212] -- 0:02:42 427000 -- (-3886.641) (-3888.945) [-3887.180] (-3886.659) * (-3894.541) (-3889.982) [-3885.370] (-3885.274) -- 0:02:42 427500 -- (-3883.852) [-3882.162] (-3887.802) (-3891.047) * (-3895.917) (-3884.441) (-3888.482) [-3883.129] -- 0:02:42 428000 -- (-3891.164) [-3884.256] (-3885.632) (-3893.341) * (-3891.416) (-3885.590) [-3886.759] (-3888.207) -- 0:02:41 428500 -- [-3882.881] (-3886.843) (-3893.185) (-3886.293) * (-3887.917) (-3890.577) [-3882.140] (-3881.087) -- 0:02:42 429000 -- [-3880.505] (-3883.698) (-3881.124) (-3884.214) * (-3884.453) (-3883.189) [-3884.863] (-3888.931) -- 0:02:42 429500 -- (-3880.576) (-3887.409) (-3882.275) [-3882.388] * (-3885.594) [-3885.694] (-3887.494) (-3892.241) -- 0:02:42 430000 -- (-3892.961) (-3887.158) (-3886.370) [-3883.944] * (-3886.068) (-3886.096) (-3887.007) [-3881.433] -- 0:02:41 Average standard deviation of split frequencies: 0.000000 430500 -- [-3885.593] (-3884.724) (-3885.928) (-3894.836) * (-3886.458) (-3886.000) [-3892.093] (-3883.871) -- 0:02:41 431000 -- (-3887.208) (-3884.650) [-3885.209] (-3892.995) * (-3883.039) [-3887.981] (-3892.669) (-3884.971) -- 0:02:41 431500 -- (-3899.283) (-3886.108) (-3883.807) [-3887.049] * (-3887.966) (-3886.244) [-3888.729] (-3888.599) -- 0:02:40 432000 -- [-3886.417] (-3884.874) (-3884.512) (-3884.898) * (-3896.410) (-3888.903) [-3884.877] (-3881.234) -- 0:02:41 432500 -- (-3887.133) [-3885.088] (-3885.187) (-3884.427) * (-3885.381) (-3881.869) [-3889.314] (-3885.805) -- 0:02:41 433000 -- (-3884.459) (-3882.387) [-3881.895] (-3888.907) * (-3886.392) [-3883.376] (-3895.383) (-3882.256) -- 0:02:41 433500 -- (-3883.049) [-3883.111] (-3887.878) (-3887.266) * (-3885.681) [-3885.775] (-3885.898) (-3886.096) -- 0:02:40 434000 -- (-3890.262) [-3882.121] (-3892.244) (-3889.746) * [-3883.801] (-3884.874) (-3887.218) (-3881.253) -- 0:02:40 434500 -- (-3889.312) (-3890.913) [-3880.122] (-3887.681) * (-3890.815) [-3883.677] (-3891.943) (-3886.002) -- 0:02:40 435000 -- [-3883.059] (-3885.480) (-3885.631) (-3894.571) * (-3882.239) (-3890.071) (-3887.913) [-3887.050] -- 0:02:39 Average standard deviation of split frequencies: 0.000000 435500 -- (-3885.820) (-3887.710) [-3884.926] (-3889.614) * [-3882.702] (-3890.587) (-3884.822) (-3884.025) -- 0:02:40 436000 -- (-3886.821) [-3883.677] (-3886.026) (-3885.234) * (-3889.358) (-3899.132) [-3882.747] (-3883.723) -- 0:02:40 436500 -- [-3881.756] (-3881.498) (-3891.227) (-3888.830) * (-3881.740) (-3888.301) (-3885.519) [-3886.922] -- 0:02:40 437000 -- (-3883.379) [-3888.699] (-3886.070) (-3881.312) * (-3884.613) [-3890.979] (-3884.242) (-3888.373) -- 0:02:39 437500 -- (-3890.040) (-3882.359) [-3887.270] (-3891.129) * (-3887.232) (-3884.639) [-3887.114] (-3883.455) -- 0:02:39 438000 -- (-3885.575) [-3883.119] (-3886.100) (-3884.712) * (-3885.922) (-3889.091) [-3886.010] (-3886.464) -- 0:02:39 438500 -- (-3886.239) (-3884.851) [-3881.895] (-3886.106) * (-3883.632) (-3885.080) (-3881.432) [-3887.379] -- 0:02:38 439000 -- (-3888.534) (-3884.064) (-3885.783) [-3886.594] * (-3886.901) (-3890.027) (-3890.147) [-3886.069] -- 0:02:39 439500 -- (-3888.098) (-3887.720) (-3883.337) [-3881.164] * (-3888.583) (-3891.846) (-3882.279) [-3886.042] -- 0:02:39 440000 -- (-3888.161) (-3889.440) [-3886.776] (-3881.269) * (-3886.632) (-3895.374) [-3885.670] (-3889.423) -- 0:02:39 Average standard deviation of split frequencies: 0.000000 440500 -- (-3889.703) (-3885.189) [-3888.820] (-3890.741) * (-3889.961) (-3894.037) (-3887.091) [-3882.591] -- 0:02:38 441000 -- (-3890.260) (-3881.866) [-3883.007] (-3883.648) * (-3881.764) [-3890.022] (-3884.868) (-3891.574) -- 0:02:38 441500 -- (-3893.684) (-3882.940) [-3884.971] (-3881.867) * (-3888.834) (-3893.074) (-3884.144) [-3884.764] -- 0:02:38 442000 -- (-3884.669) (-3884.705) (-3881.829) [-3885.688] * (-3883.203) (-3898.283) [-3883.603] (-3891.699) -- 0:02:37 442500 -- (-3887.199) (-3889.142) (-3887.292) [-3882.789] * (-3883.099) (-3883.608) (-3881.832) [-3882.774] -- 0:02:37 443000 -- [-3886.682] (-3887.805) (-3887.157) (-3883.307) * (-3883.889) (-3879.793) (-3887.484) [-3883.046] -- 0:02:38 443500 -- [-3880.604] (-3888.464) (-3885.471) (-3883.152) * [-3884.238] (-3888.828) (-3890.621) (-3879.991) -- 0:02:38 444000 -- [-3884.721] (-3884.044) (-3892.336) (-3884.630) * (-3891.510) [-3892.237] (-3886.769) (-3888.556) -- 0:02:37 444500 -- [-3887.588] (-3886.212) (-3892.804) (-3883.335) * [-3885.513] (-3887.165) (-3882.394) (-3887.737) -- 0:02:37 445000 -- (-3882.084) [-3888.559] (-3884.473) (-3889.027) * (-3888.294) [-3884.583] (-3890.133) (-3883.510) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 445500 -- [-3881.052] (-3880.223) (-3881.469) (-3882.672) * (-3889.171) (-3880.445) [-3885.610] (-3891.828) -- 0:02:36 446000 -- (-3885.482) (-3883.877) [-3883.715] (-3888.362) * [-3888.012] (-3886.418) (-3885.538) (-3886.428) -- 0:02:36 446500 -- (-3891.977) (-3888.066) [-3884.710] (-3884.137) * [-3886.867] (-3883.913) (-3883.956) (-3887.561) -- 0:02:37 447000 -- (-3885.153) [-3885.292] (-3883.964) (-3890.424) * (-3887.244) [-3884.628] (-3884.275) (-3887.359) -- 0:02:37 447500 -- (-3892.732) [-3881.279] (-3886.778) (-3884.706) * (-3883.783) [-3885.748] (-3890.256) (-3892.268) -- 0:02:36 448000 -- [-3881.397] (-3883.685) (-3887.684) (-3887.758) * (-3884.099) (-3885.050) (-3887.827) [-3883.854] -- 0:02:36 448500 -- [-3886.232] (-3885.332) (-3879.798) (-3884.032) * (-3890.328) (-3884.947) (-3895.685) [-3883.592] -- 0:02:36 449000 -- (-3890.737) (-3891.699) [-3882.589] (-3884.953) * (-3883.776) [-3882.081] (-3890.623) (-3884.316) -- 0:02:35 449500 -- (-3889.363) (-3887.249) (-3895.186) [-3885.138] * (-3888.799) (-3883.750) (-3882.732) [-3883.015] -- 0:02:35 450000 -- (-3885.408) [-3880.258] (-3882.274) (-3888.382) * (-3887.304) (-3881.661) [-3885.718] (-3889.916) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 450500 -- (-3885.550) (-3886.261) (-3888.400) [-3884.566] * (-3888.580) [-3882.811] (-3882.464) (-3889.648) -- 0:02:36 451000 -- (-3885.535) (-3894.147) [-3884.411] (-3880.667) * (-3888.511) [-3883.346] (-3891.141) (-3888.194) -- 0:02:35 451500 -- [-3884.321] (-3885.305) (-3884.954) (-3881.772) * (-3893.940) [-3882.971] (-3882.864) (-3885.218) -- 0:02:35 452000 -- (-3881.842) [-3881.191] (-3894.302) (-3885.924) * (-3890.702) (-3883.955) (-3883.580) [-3883.116] -- 0:02:35 452500 -- (-3888.146) [-3881.879] (-3882.992) (-3889.375) * (-3888.670) [-3887.337] (-3884.897) (-3887.949) -- 0:02:34 453000 -- (-3883.113) [-3882.765] (-3887.724) (-3888.136) * (-3888.176) [-3884.571] (-3885.791) (-3884.288) -- 0:02:34 453500 -- (-3881.977) (-3880.154) (-3881.520) [-3885.197] * (-3888.644) (-3880.998) [-3884.279] (-3884.694) -- 0:02:35 454000 -- (-3883.452) (-3887.052) (-3887.172) [-3885.562] * (-3893.276) (-3881.406) [-3883.740] (-3889.181) -- 0:02:35 454500 -- (-3888.903) (-3886.330) (-3887.110) [-3883.375] * (-3882.903) (-3887.374) (-3882.517) [-3885.537] -- 0:02:34 455000 -- (-3895.261) (-3884.441) [-3882.880] (-3884.302) * (-3889.026) [-3888.921] (-3889.764) (-3884.291) -- 0:02:34 Average standard deviation of split frequencies: 0.000000 455500 -- [-3885.842] (-3883.637) (-3883.370) (-3888.071) * (-3887.681) (-3881.468) (-3885.743) [-3882.341] -- 0:02:34 456000 -- (-3887.477) (-3881.482) (-3886.635) [-3882.850] * (-3886.902) (-3883.051) (-3887.985) [-3882.397] -- 0:02:33 456500 -- (-3884.059) [-3883.868] (-3888.501) (-3892.551) * (-3881.698) (-3882.293) (-3882.342) [-3884.160] -- 0:02:33 457000 -- (-3883.855) [-3881.778] (-3888.166) (-3889.712) * (-3886.628) [-3881.537] (-3885.470) (-3882.679) -- 0:02:34 457500 -- (-3885.159) [-3880.635] (-3893.379) (-3886.357) * (-3892.433) (-3883.622) [-3884.954] (-3884.303) -- 0:02:34 458000 -- (-3887.272) (-3886.958) [-3882.592] (-3884.941) * (-3888.004) [-3881.398] (-3885.917) (-3885.045) -- 0:02:33 458500 -- (-3883.951) (-3880.087) (-3886.173) [-3881.295] * (-3886.005) [-3886.429] (-3892.253) (-3883.967) -- 0:02:33 459000 -- (-3888.932) (-3892.829) [-3880.502] (-3882.363) * (-3881.531) (-3887.820) (-3885.813) [-3886.507] -- 0:02:33 459500 -- (-3890.978) (-3885.878) (-3886.308) [-3884.778] * [-3883.467] (-3892.815) (-3880.169) (-3894.982) -- 0:02:32 460000 -- (-3892.912) [-3888.901] (-3884.307) (-3887.462) * [-3886.299] (-3887.044) (-3881.424) (-3891.350) -- 0:02:32 Average standard deviation of split frequencies: 0.000000 460500 -- (-3888.625) (-3881.546) [-3886.040] (-3889.647) * (-3891.227) [-3888.825] (-3885.526) (-3887.966) -- 0:02:33 461000 -- (-3889.907) [-3883.194] (-3885.661) (-3896.847) * (-3883.933) (-3890.553) (-3884.882) [-3886.127] -- 0:02:33 461500 -- [-3889.880] (-3891.065) (-3890.120) (-3890.890) * (-3885.484) [-3888.453] (-3880.661) (-3887.081) -- 0:02:32 462000 -- [-3881.290] (-3888.938) (-3884.254) (-3883.146) * (-3886.880) (-3898.508) (-3888.910) [-3888.756] -- 0:02:32 462500 -- (-3888.244) (-3890.820) [-3884.791] (-3883.502) * (-3884.884) (-3885.500) (-3891.308) [-3882.589] -- 0:02:32 463000 -- (-3883.677) (-3886.422) [-3882.754] (-3891.263) * [-3887.450] (-3887.148) (-3887.440) (-3886.112) -- 0:02:31 463500 -- (-3888.636) (-3884.143) [-3884.085] (-3894.456) * (-3886.357) [-3880.605] (-3888.607) (-3892.117) -- 0:02:31 464000 -- (-3885.570) [-3884.340] (-3888.785) (-3889.817) * (-3884.096) [-3884.034] (-3884.895) (-3889.353) -- 0:02:32 464500 -- [-3880.508] (-3880.745) (-3888.657) (-3890.616) * [-3883.368] (-3882.732) (-3890.425) (-3887.660) -- 0:02:32 465000 -- [-3884.927] (-3886.203) (-3885.346) (-3884.896) * (-3890.042) (-3885.557) (-3891.373) [-3887.019] -- 0:02:31 Average standard deviation of split frequencies: 0.000000 465500 -- [-3889.514] (-3887.584) (-3881.613) (-3888.869) * (-3882.771) [-3882.197] (-3879.993) (-3890.506) -- 0:02:31 466000 -- (-3884.400) [-3890.213] (-3886.299) (-3884.984) * (-3887.797) [-3885.215] (-3884.218) (-3886.087) -- 0:02:31 466500 -- (-3885.594) (-3888.606) (-3884.325) [-3881.136] * [-3886.871] (-3893.319) (-3880.896) (-3884.718) -- 0:02:30 467000 -- (-3887.080) (-3887.882) (-3888.584) [-3885.773] * [-3888.269] (-3894.915) (-3885.784) (-3887.356) -- 0:02:30 467500 -- (-3882.759) [-3889.605] (-3886.437) (-3885.552) * (-3886.433) (-3886.352) [-3884.488] (-3882.746) -- 0:02:31 468000 -- (-3884.335) (-3886.962) (-3886.251) [-3882.342] * (-3887.211) (-3888.343) [-3882.549] (-3884.898) -- 0:02:31 468500 -- [-3883.762] (-3887.833) (-3883.624) (-3879.774) * (-3882.639) [-3887.825] (-3885.816) (-3887.152) -- 0:02:30 469000 -- (-3888.085) [-3886.725] (-3888.001) (-3881.869) * (-3882.462) (-3890.146) [-3882.581] (-3887.715) -- 0:02:30 469500 -- [-3883.222] (-3891.327) (-3889.420) (-3883.725) * (-3892.211) (-3888.837) [-3885.129] (-3897.578) -- 0:02:30 470000 -- (-3886.984) [-3892.276] (-3888.296) (-3891.993) * (-3888.845) (-3893.067) [-3885.500] (-3886.680) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 470500 -- (-3885.611) (-3882.974) (-3887.120) [-3890.096] * (-3889.871) (-3889.805) [-3887.778] (-3893.211) -- 0:02:29 471000 -- (-3890.724) (-3889.683) (-3886.689) [-3887.334] * (-3883.867) (-3885.167) (-3887.962) [-3884.125] -- 0:02:30 471500 -- (-3883.289) (-3890.276) [-3880.258] (-3884.257) * (-3881.518) (-3881.855) (-3884.844) [-3883.918] -- 0:02:30 472000 -- [-3883.992] (-3882.260) (-3886.585) (-3885.287) * (-3884.258) (-3883.975) (-3882.068) [-3885.854] -- 0:02:29 472500 -- (-3887.390) [-3885.290] (-3889.589) (-3886.992) * [-3885.498] (-3884.587) (-3884.719) (-3887.168) -- 0:02:29 473000 -- (-3887.128) [-3889.790] (-3886.081) (-3886.938) * (-3884.949) [-3883.480] (-3882.116) (-3883.878) -- 0:02:29 473500 -- (-3882.173) [-3888.997] (-3885.126) (-3899.363) * (-3887.910) (-3890.243) (-3882.694) [-3886.391] -- 0:02:28 474000 -- [-3883.292] (-3886.882) (-3886.355) (-3892.692) * [-3882.018] (-3883.936) (-3882.067) (-3888.490) -- 0:02:28 474500 -- (-3883.985) (-3885.648) (-3887.982) [-3884.930] * (-3884.908) (-3889.634) [-3881.601] (-3890.603) -- 0:02:29 475000 -- [-3881.443] (-3884.368) (-3889.019) (-3880.575) * [-3887.790] (-3888.698) (-3880.313) (-3888.658) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 475500 -- (-3897.469) [-3883.033] (-3890.074) (-3889.530) * (-3887.281) (-3888.793) (-3889.667) [-3883.469] -- 0:02:28 476000 -- (-3882.742) (-3896.291) [-3884.420] (-3881.874) * [-3884.952] (-3882.751) (-3885.192) (-3884.521) -- 0:02:28 476500 -- [-3881.105] (-3890.985) (-3889.787) (-3887.594) * (-3882.673) (-3888.901) [-3882.590] (-3883.916) -- 0:02:28 477000 -- (-3889.462) (-3891.160) (-3889.231) [-3890.115] * (-3887.252) (-3885.095) (-3888.934) [-3883.322] -- 0:02:28 477500 -- (-3883.021) (-3889.308) (-3896.052) [-3889.984] * (-3891.554) (-3896.308) [-3887.099] (-3892.159) -- 0:02:27 478000 -- [-3881.982] (-3883.769) (-3889.912) (-3884.729) * (-3882.137) (-3885.248) [-3883.492] (-3886.272) -- 0:02:28 478500 -- [-3887.690] (-3884.377) (-3886.004) (-3893.943) * (-3883.923) [-3884.086] (-3884.292) (-3886.236) -- 0:02:28 479000 -- [-3885.219] (-3888.304) (-3884.668) (-3890.727) * (-3890.730) (-3883.863) (-3887.236) [-3888.658] -- 0:02:27 479500 -- (-3884.632) (-3886.178) [-3885.936] (-3883.918) * (-3886.687) [-3886.943] (-3882.678) (-3892.564) -- 0:02:27 480000 -- (-3883.516) (-3884.703) (-3882.408) [-3884.287] * [-3888.001] (-3885.163) (-3887.342) (-3890.561) -- 0:02:27 Average standard deviation of split frequencies: 0.000000 480500 -- (-3889.052) (-3885.946) [-3882.921] (-3879.701) * [-3889.061] (-3883.681) (-3883.098) (-3882.346) -- 0:02:27 481000 -- (-3884.955) (-3886.901) (-3892.211) [-3887.304] * (-3883.627) [-3888.254] (-3881.455) (-3883.854) -- 0:02:26 481500 -- [-3879.558] (-3890.191) (-3882.911) (-3885.479) * (-3892.003) [-3887.741] (-3883.390) (-3883.956) -- 0:02:27 482000 -- (-3887.065) (-3888.252) [-3883.187] (-3886.427) * (-3884.708) [-3886.813] (-3882.971) (-3888.052) -- 0:02:27 482500 -- (-3882.197) (-3882.553) [-3888.830] (-3884.892) * (-3882.886) (-3885.953) (-3886.107) [-3885.963] -- 0:02:26 483000 -- [-3885.302] (-3883.764) (-3894.655) (-3892.652) * (-3883.224) (-3886.198) (-3880.641) [-3887.278] -- 0:02:26 483500 -- [-3888.172] (-3889.733) (-3887.274) (-3884.971) * [-3885.489] (-3884.093) (-3890.501) (-3885.671) -- 0:02:26 484000 -- [-3889.325] (-3885.316) (-3889.063) (-3885.588) * [-3880.356] (-3884.430) (-3882.404) (-3892.456) -- 0:02:26 484500 -- (-3886.344) (-3886.943) [-3883.095] (-3886.772) * (-3884.966) (-3887.525) [-3892.978] (-3890.033) -- 0:02:25 485000 -- (-3884.558) (-3891.278) (-3886.905) [-3892.963] * (-3879.825) (-3890.363) [-3883.617] (-3879.189) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 485500 -- [-3887.393] (-3884.279) (-3887.933) (-3885.401) * (-3881.795) (-3885.535) (-3893.617) [-3881.609] -- 0:02:26 486000 -- (-3883.800) (-3884.446) (-3884.837) [-3884.542] * (-3880.408) [-3883.374] (-3889.102) (-3886.712) -- 0:02:25 486500 -- (-3884.926) [-3884.863] (-3882.439) (-3885.628) * [-3879.647] (-3882.922) (-3892.187) (-3891.091) -- 0:02:25 487000 -- (-3887.550) (-3888.337) [-3883.654] (-3886.412) * (-3887.402) [-3882.629] (-3887.977) (-3894.217) -- 0:02:25 487500 -- (-3888.211) (-3881.926) [-3890.261] (-3885.977) * (-3886.920) [-3895.420] (-3885.176) (-3893.482) -- 0:02:25 488000 -- [-3880.653] (-3882.620) (-3887.512) (-3887.876) * [-3881.684] (-3886.984) (-3882.982) (-3890.978) -- 0:02:24 488500 -- [-3894.891] (-3885.991) (-3884.422) (-3887.067) * [-3883.351] (-3886.548) (-3886.530) (-3886.216) -- 0:02:25 489000 -- (-3890.158) (-3885.609) (-3885.029) [-3884.904] * [-3880.424] (-3884.706) (-3891.090) (-3881.993) -- 0:02:25 489500 -- (-3886.356) (-3883.075) (-3887.604) [-3887.857] * [-3881.288] (-3886.446) (-3890.553) (-3881.485) -- 0:02:24 490000 -- (-3882.859) (-3882.056) (-3882.665) [-3887.733] * (-3879.378) (-3884.019) [-3884.056] (-3882.866) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 490500 -- [-3887.607] (-3887.829) (-3883.302) (-3886.281) * (-3883.507) (-3886.510) [-3885.218] (-3882.716) -- 0:02:24 491000 -- (-3883.275) (-3881.002) [-3880.467] (-3882.744) * (-3881.818) (-3886.829) [-3882.998] (-3884.501) -- 0:02:24 491500 -- (-3891.122) [-3888.371] (-3880.359) (-3882.700) * (-3882.930) (-3886.335) [-3887.017] (-3885.234) -- 0:02:23 492000 -- [-3885.490] (-3887.240) (-3887.443) (-3883.236) * (-3885.980) (-3886.892) [-3883.284] (-3888.336) -- 0:02:24 492500 -- (-3886.135) (-3883.755) (-3884.428) [-3882.390] * (-3888.558) (-3886.773) [-3882.597] (-3885.027) -- 0:02:24 493000 -- [-3888.316] (-3885.662) (-3889.025) (-3880.334) * (-3888.379) [-3883.497] (-3885.337) (-3886.443) -- 0:02:23 493500 -- (-3887.833) (-3887.154) [-3882.074] (-3891.698) * (-3886.229) [-3881.566] (-3885.407) (-3882.575) -- 0:02:23 494000 -- (-3886.851) (-3886.855) (-3885.898) [-3883.970] * (-3881.407) (-3883.111) (-3883.881) [-3887.478] -- 0:02:23 494500 -- (-3888.939) (-3890.526) (-3888.584) [-3883.853] * (-3884.092) [-3883.298] (-3891.259) (-3883.657) -- 0:02:23 495000 -- (-3884.183) (-3880.801) [-3881.631] (-3883.216) * (-3887.725) (-3882.077) (-3884.135) [-3884.242] -- 0:02:22 Average standard deviation of split frequencies: 0.000000 495500 -- (-3892.169) (-3887.706) [-3882.738] (-3883.614) * (-3887.154) [-3883.498] (-3885.135) (-3887.312) -- 0:02:23 496000 -- (-3882.473) (-3887.752) (-3884.874) [-3880.652] * (-3883.114) [-3880.004] (-3885.876) (-3885.325) -- 0:02:23 496500 -- (-3883.509) (-3891.138) (-3891.425) [-3880.114] * (-3885.321) [-3883.535] (-3887.971) (-3882.433) -- 0:02:22 497000 -- (-3884.772) (-3888.081) [-3884.138] (-3884.491) * (-3884.999) (-3884.578) (-3888.307) [-3886.223] -- 0:02:22 497500 -- [-3888.444] (-3884.628) (-3882.771) (-3880.930) * [-3880.673] (-3884.172) (-3897.616) (-3888.541) -- 0:02:22 498000 -- [-3883.943] (-3890.781) (-3886.526) (-3884.176) * (-3886.059) [-3885.363] (-3892.529) (-3887.714) -- 0:02:22 498500 -- (-3889.430) (-3884.242) (-3882.105) [-3887.049] * (-3886.115) [-3885.824] (-3890.579) (-3888.517) -- 0:02:21 499000 -- (-3884.367) [-3884.046] (-3884.768) (-3885.287) * (-3885.707) [-3880.909] (-3890.798) (-3884.334) -- 0:02:22 499500 -- [-3886.486] (-3887.779) (-3884.855) (-3886.225) * (-3886.500) [-3885.778] (-3883.571) (-3883.502) -- 0:02:22 500000 -- (-3886.101) (-3886.355) (-3887.308) [-3881.563] * [-3883.084] (-3887.970) (-3880.813) (-3889.771) -- 0:02:22 Average standard deviation of split frequencies: 0.000000 500500 -- (-3886.269) (-3883.341) (-3885.992) [-3883.140] * (-3881.427) [-3882.058] (-3883.474) (-3886.236) -- 0:02:21 501000 -- (-3882.757) (-3885.650) [-3888.930] (-3889.516) * (-3890.819) [-3882.195] (-3885.495) (-3884.876) -- 0:02:21 501500 -- (-3887.236) (-3894.205) [-3885.147] (-3882.323) * [-3883.213] (-3882.910) (-3886.839) (-3891.072) -- 0:02:21 502000 -- (-3890.473) (-3891.603) (-3892.000) [-3881.488] * (-3887.649) (-3885.080) [-3891.968] (-3887.281) -- 0:02:20 502500 -- (-3884.736) (-3890.987) [-3883.829] (-3885.081) * (-3883.915) [-3883.466] (-3885.893) (-3891.383) -- 0:02:21 503000 -- [-3883.963] (-3887.744) (-3887.085) (-3886.418) * [-3884.448] (-3890.415) (-3882.637) (-3893.581) -- 0:02:21 503500 -- (-3889.429) [-3883.018] (-3893.443) (-3887.405) * [-3885.325] (-3887.527) (-3885.629) (-3893.270) -- 0:02:21 504000 -- [-3886.245] (-3887.262) (-3893.263) (-3890.619) * (-3887.677) (-3886.393) [-3888.713] (-3895.088) -- 0:02:20 504500 -- (-3884.378) [-3879.036] (-3900.241) (-3884.281) * [-3884.697] (-3886.396) (-3886.733) (-3891.554) -- 0:02:20 505000 -- (-3886.218) [-3883.366] (-3896.151) (-3890.210) * (-3887.487) [-3885.017] (-3894.314) (-3884.222) -- 0:02:20 Average standard deviation of split frequencies: 0.000000 505500 -- (-3882.996) [-3880.596] (-3886.084) (-3885.977) * (-3881.663) (-3881.525) (-3895.810) [-3884.949] -- 0:02:19 506000 -- (-3892.665) (-3885.071) [-3888.171] (-3891.126) * (-3882.168) (-3884.439) (-3887.576) [-3883.656] -- 0:02:19 506500 -- [-3887.873] (-3889.159) (-3881.372) (-3887.703) * (-3884.057) (-3880.468) (-3889.902) [-3886.176] -- 0:02:20 507000 -- (-3889.095) (-3891.539) [-3878.439] (-3881.601) * (-3889.249) [-3886.160] (-3889.401) (-3883.099) -- 0:02:20 507500 -- [-3882.936] (-3887.830) (-3881.423) (-3890.292) * [-3888.860] (-3884.521) (-3886.123) (-3882.306) -- 0:02:19 508000 -- (-3888.116) [-3884.948] (-3886.956) (-3889.782) * (-3881.118) (-3885.210) [-3890.753] (-3889.383) -- 0:02:19 508500 -- (-3889.823) (-3889.663) [-3889.679] (-3885.104) * [-3885.373] (-3885.310) (-3885.334) (-3885.346) -- 0:02:19 509000 -- (-3887.130) (-3881.460) (-3883.720) [-3893.393] * (-3886.570) (-3882.064) [-3883.120] (-3895.538) -- 0:02:18 509500 -- (-3892.418) (-3883.328) (-3887.050) [-3883.904] * [-3880.796] (-3893.884) (-3889.005) (-3882.122) -- 0:02:18 510000 -- [-3886.255] (-3884.091) (-3886.274) (-3887.208) * [-3882.404] (-3889.137) (-3891.186) (-3886.499) -- 0:02:19 Average standard deviation of split frequencies: 0.000000 510500 -- [-3878.843] (-3886.172) (-3884.815) (-3884.052) * (-3882.160) (-3894.309) [-3889.247] (-3882.479) -- 0:02:19 511000 -- [-3881.526] (-3888.150) (-3886.596) (-3887.590) * [-3883.938] (-3889.981) (-3885.782) (-3887.489) -- 0:02:18 511500 -- (-3883.499) (-3885.832) [-3885.025] (-3889.805) * (-3883.697) (-3883.766) (-3897.787) [-3879.999] -- 0:02:18 512000 -- (-3889.448) (-3882.190) (-3881.318) [-3882.145] * [-3883.996] (-3884.529) (-3889.562) (-3881.628) -- 0:02:18 512500 -- (-3884.439) [-3883.722] (-3883.324) (-3886.459) * (-3888.579) (-3886.995) [-3885.417] (-3887.043) -- 0:02:17 513000 -- (-3885.345) (-3888.909) (-3883.680) [-3883.229] * (-3887.928) (-3886.339) [-3883.826] (-3885.080) -- 0:02:17 513500 -- [-3884.457] (-3884.163) (-3880.486) (-3891.021) * (-3886.647) (-3889.946) [-3888.000] (-3881.675) -- 0:02:18 514000 -- [-3891.105] (-3890.820) (-3886.104) (-3885.950) * [-3883.927] (-3893.104) (-3889.472) (-3884.102) -- 0:02:18 514500 -- (-3888.077) [-3885.137] (-3878.488) (-3881.067) * (-3882.976) (-3888.785) [-3885.753] (-3883.942) -- 0:02:17 515000 -- (-3884.635) (-3885.130) [-3881.880] (-3882.546) * [-3883.303] (-3882.549) (-3889.893) (-3888.255) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 515500 -- (-3885.696) [-3885.530] (-3885.450) (-3881.358) * (-3880.123) (-3889.332) (-3885.791) [-3882.346] -- 0:02:17 516000 -- (-3885.665) (-3891.019) (-3881.762) [-3884.934] * (-3887.027) (-3886.977) (-3884.211) [-3882.741] -- 0:02:16 516500 -- (-3890.231) (-3890.327) [-3882.564] (-3896.553) * (-3887.366) (-3884.038) [-3879.572] (-3884.844) -- 0:02:16 517000 -- (-3881.524) (-3881.968) [-3881.066] (-3884.230) * (-3886.163) [-3884.258] (-3887.528) (-3887.604) -- 0:02:17 517500 -- (-3886.082) (-3888.682) (-3884.959) [-3887.652] * (-3882.466) [-3883.672] (-3887.582) (-3886.426) -- 0:02:17 518000 -- (-3889.783) [-3887.722] (-3885.775) (-3883.842) * [-3888.161] (-3886.075) (-3885.031) (-3883.416) -- 0:02:16 518500 -- (-3886.350) (-3879.613) [-3880.205] (-3886.944) * (-3884.491) (-3888.609) (-3887.223) [-3888.114] -- 0:02:16 519000 -- (-3889.847) (-3883.513) (-3888.004) [-3883.794] * [-3884.704] (-3892.265) (-3887.804) (-3885.491) -- 0:02:16 519500 -- (-3891.170) (-3884.669) [-3881.116] (-3887.688) * (-3883.144) (-3892.211) [-3883.079] (-3884.532) -- 0:02:15 520000 -- (-3889.332) (-3886.549) (-3885.616) [-3882.312] * (-3881.046) (-3893.803) (-3890.361) [-3884.096] -- 0:02:15 Average standard deviation of split frequencies: 0.000000 520500 -- (-3894.826) (-3884.684) [-3885.449] (-3891.069) * (-3886.261) (-3893.750) (-3889.869) [-3883.418] -- 0:02:16 521000 -- (-3887.345) (-3882.891) (-3883.813) [-3888.569] * (-3884.885) [-3882.729] (-3892.627) (-3885.554) -- 0:02:16 521500 -- (-3886.593) (-3888.475) (-3887.443) [-3886.246] * (-3890.834) (-3889.282) [-3882.096] (-3892.561) -- 0:02:15 522000 -- (-3883.245) [-3885.828] (-3880.698) (-3887.762) * (-3889.180) [-3885.550] (-3889.419) (-3884.830) -- 0:02:15 522500 -- (-3885.824) (-3884.554) [-3887.654] (-3881.734) * (-3882.800) [-3885.323] (-3892.070) (-3883.210) -- 0:02:15 523000 -- (-3883.866) [-3884.549] (-3887.311) (-3885.968) * (-3886.144) (-3883.806) (-3885.745) [-3889.817] -- 0:02:14 523500 -- (-3888.612) [-3880.681] (-3881.029) (-3882.837) * (-3884.550) (-3880.946) [-3886.858] (-3889.742) -- 0:02:14 524000 -- (-3881.601) [-3888.183] (-3889.839) (-3885.105) * (-3883.805) (-3884.194) [-3886.853] (-3884.343) -- 0:02:15 524500 -- (-3887.061) (-3882.379) (-3882.168) [-3883.950] * [-3885.374] (-3884.770) (-3886.143) (-3880.947) -- 0:02:15 525000 -- (-3886.923) (-3882.861) (-3882.923) [-3881.543] * [-3883.207] (-3884.621) (-3881.610) (-3882.199) -- 0:02:14 Average standard deviation of split frequencies: 0.000000 525500 -- [-3882.931] (-3885.849) (-3885.782) (-3884.153) * (-3886.016) (-3886.816) (-3884.687) [-3886.426] -- 0:02:14 526000 -- (-3883.314) (-3886.842) (-3890.221) [-3886.307] * (-3886.740) (-3884.756) [-3885.241] (-3888.478) -- 0:02:14 526500 -- (-3886.388) [-3884.290] (-3887.204) (-3892.691) * [-3887.322] (-3890.221) (-3881.095) (-3891.015) -- 0:02:14 527000 -- (-3889.446) [-3883.639] (-3882.806) (-3883.752) * (-3893.174) [-3886.156] (-3886.898) (-3890.457) -- 0:02:13 527500 -- (-3886.121) (-3883.012) (-3883.828) [-3882.625] * (-3885.918) (-3888.001) (-3887.587) [-3882.241] -- 0:02:14 528000 -- (-3892.665) [-3882.235] (-3885.145) (-3887.059) * (-3886.240) (-3886.641) (-3890.401) [-3881.017] -- 0:02:14 528500 -- (-3894.600) (-3885.065) (-3889.316) [-3884.967] * [-3887.698] (-3885.654) (-3888.807) (-3883.265) -- 0:02:13 529000 -- (-3887.978) (-3887.611) (-3885.730) [-3884.513] * (-3887.267) (-3889.087) [-3884.365] (-3886.115) -- 0:02:13 529500 -- (-3893.245) [-3882.651] (-3881.844) (-3892.072) * (-3885.929) (-3887.516) [-3884.937] (-3886.210) -- 0:02:13 530000 -- (-3888.866) (-3881.778) (-3885.162) [-3881.334] * (-3892.549) [-3886.434] (-3886.712) (-3888.803) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 530500 -- (-3882.304) [-3880.878] (-3884.205) (-3888.747) * (-3889.478) [-3881.951] (-3881.671) (-3887.176) -- 0:02:12 531000 -- (-3886.495) [-3890.489] (-3883.455) (-3891.138) * [-3886.354] (-3889.466) (-3889.592) (-3880.673) -- 0:02:13 531500 -- (-3889.209) (-3882.299) [-3884.124] (-3888.842) * (-3895.141) [-3887.990] (-3881.483) (-3888.524) -- 0:02:13 532000 -- [-3885.409] (-3889.036) (-3886.459) (-3888.543) * (-3887.427) [-3884.020] (-3882.560) (-3880.204) -- 0:02:12 532500 -- (-3890.264) (-3893.653) (-3890.124) [-3885.882] * [-3892.264] (-3883.854) (-3887.078) (-3883.468) -- 0:02:12 533000 -- (-3887.547) (-3892.770) (-3889.757) [-3891.302] * (-3891.828) (-3884.311) [-3885.654] (-3891.737) -- 0:02:12 533500 -- [-3889.137] (-3885.005) (-3887.766) (-3893.341) * (-3886.518) (-3884.407) (-3887.018) [-3879.272] -- 0:02:12 534000 -- (-3890.280) (-3889.016) [-3886.273] (-3884.228) * [-3884.137] (-3886.219) (-3883.553) (-3882.549) -- 0:02:11 534500 -- (-3885.901) (-3882.633) [-3883.974] (-3885.055) * [-3886.112] (-3893.081) (-3886.780) (-3881.337) -- 0:02:12 535000 -- (-3890.767) (-3891.913) (-3883.410) [-3888.486] * [-3885.501] (-3879.495) (-3890.072) (-3886.257) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 535500 -- (-3889.187) (-3894.176) (-3887.259) [-3882.303] * [-3881.803] (-3891.209) (-3886.952) (-3884.047) -- 0:02:11 536000 -- [-3880.161] (-3890.017) (-3889.200) (-3887.003) * [-3894.969] (-3892.698) (-3889.646) (-3885.786) -- 0:02:11 536500 -- (-3883.141) (-3884.258) [-3883.803] (-3883.731) * (-3894.077) (-3891.936) (-3885.848) [-3882.172] -- 0:02:11 537000 -- (-3886.868) [-3885.656] (-3882.276) (-3887.291) * [-3887.510] (-3885.913) (-3885.714) (-3884.873) -- 0:02:11 537500 -- [-3882.721] (-3889.388) (-3882.194) (-3887.623) * (-3885.732) [-3886.321] (-3880.525) (-3886.685) -- 0:02:10 538000 -- (-3890.175) (-3892.593) [-3881.212] (-3883.470) * (-3885.816) [-3889.110] (-3881.514) (-3891.449) -- 0:02:11 538500 -- (-3895.312) [-3884.832] (-3889.710) (-3884.432) * [-3882.925] (-3881.990) (-3887.019) (-3887.669) -- 0:02:11 539000 -- (-3884.243) [-3886.287] (-3883.737) (-3890.683) * (-3885.066) [-3879.338] (-3884.876) (-3886.951) -- 0:02:10 539500 -- [-3888.618] (-3883.674) (-3884.655) (-3890.736) * (-3884.357) (-3885.048) [-3883.487] (-3880.708) -- 0:02:10 540000 -- (-3885.041) [-3886.523] (-3888.661) (-3881.936) * [-3883.697] (-3887.649) (-3882.592) (-3884.087) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 540500 -- (-3884.519) (-3884.220) (-3883.516) [-3883.944] * [-3883.770] (-3889.128) (-3881.441) (-3889.407) -- 0:02:10 541000 -- (-3883.673) [-3883.224] (-3888.537) (-3890.852) * (-3885.046) [-3884.417] (-3890.301) (-3884.779) -- 0:02:09 541500 -- (-3887.869) (-3888.111) [-3884.870] (-3888.383) * (-3887.514) [-3884.932] (-3885.484) (-3881.782) -- 0:02:10 542000 -- (-3886.669) [-3892.365] (-3885.014) (-3887.167) * (-3881.720) [-3881.377] (-3891.678) (-3881.814) -- 0:02:10 542500 -- [-3883.581] (-3890.334) (-3885.933) (-3885.461) * (-3887.132) (-3880.201) (-3887.120) [-3881.672] -- 0:02:09 543000 -- [-3889.392] (-3888.905) (-3888.310) (-3886.727) * (-3884.742) (-3881.809) [-3888.016] (-3887.659) -- 0:02:09 543500 -- (-3894.739) [-3885.450] (-3887.310) (-3887.924) * [-3878.557] (-3885.938) (-3887.428) (-3889.208) -- 0:02:09 544000 -- [-3886.764] (-3885.687) (-3884.445) (-3878.805) * [-3885.753] (-3882.982) (-3888.721) (-3892.939) -- 0:02:09 544500 -- (-3882.685) [-3880.882] (-3890.649) (-3887.656) * (-3881.493) [-3888.891] (-3889.638) (-3884.584) -- 0:02:08 545000 -- (-3884.727) (-3887.406) (-3884.165) [-3886.753] * (-3885.065) (-3885.552) [-3885.915] (-3886.735) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 545500 -- (-3886.261) [-3888.226] (-3889.960) (-3886.817) * (-3895.331) (-3883.125) [-3887.068] (-3886.432) -- 0:02:09 546000 -- (-3883.884) [-3885.669] (-3893.103) (-3887.451) * [-3882.058] (-3879.295) (-3887.190) (-3891.849) -- 0:02:08 546500 -- (-3885.829) (-3891.693) [-3884.880] (-3879.194) * (-3885.524) (-3889.980) [-3882.203] (-3885.429) -- 0:02:08 547000 -- [-3886.700] (-3892.069) (-3891.396) (-3882.274) * [-3890.038] (-3890.589) (-3890.435) (-3890.983) -- 0:02:08 547500 -- (-3887.495) (-3888.349) (-3890.785) [-3880.367] * (-3893.755) [-3883.980] (-3884.603) (-3879.850) -- 0:02:08 548000 -- (-3885.987) (-3883.785) (-3884.552) [-3881.661] * (-3885.267) (-3885.332) (-3886.129) [-3887.426] -- 0:02:07 548500 -- (-3887.033) [-3885.251] (-3888.869) (-3886.071) * (-3885.434) (-3883.712) (-3891.472) [-3890.299] -- 0:02:08 549000 -- (-3887.368) (-3896.488) [-3882.900] (-3880.544) * [-3884.448] (-3888.007) (-3894.153) (-3894.481) -- 0:02:08 549500 -- [-3888.475] (-3892.927) (-3887.382) (-3881.926) * [-3881.320] (-3885.875) (-3888.846) (-3886.304) -- 0:02:07 550000 -- (-3884.218) (-3883.446) [-3883.595] (-3887.288) * [-3883.972] (-3885.157) (-3886.309) (-3890.489) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 550500 -- [-3886.656] (-3882.284) (-3893.035) (-3886.908) * (-3897.867) (-3884.691) [-3888.619] (-3888.217) -- 0:02:07 551000 -- (-3891.200) (-3894.167) [-3885.299] (-3881.555) * (-3891.082) [-3885.651] (-3889.351) (-3883.727) -- 0:02:07 551500 -- (-3888.644) [-3888.835] (-3889.419) (-3882.524) * (-3888.049) (-3885.858) [-3885.347] (-3880.101) -- 0:02:06 552000 -- (-3888.241) (-3884.666) (-3885.748) [-3889.137] * (-3885.469) [-3884.109] (-3887.199) (-3882.250) -- 0:02:07 552500 -- [-3886.242] (-3893.734) (-3884.021) (-3885.213) * (-3882.907) (-3898.835) [-3881.437] (-3884.639) -- 0:02:07 553000 -- (-3881.559) (-3888.550) [-3881.032] (-3889.419) * (-3891.176) (-3886.520) [-3882.324] (-3887.548) -- 0:02:06 553500 -- [-3881.445] (-3884.268) (-3880.477) (-3883.558) * (-3885.821) [-3882.298] (-3884.289) (-3889.034) -- 0:02:06 554000 -- [-3883.651] (-3884.483) (-3881.553) (-3881.487) * (-3886.800) (-3886.073) [-3883.102] (-3887.644) -- 0:02:06 554500 -- (-3887.600) [-3889.577] (-3885.481) (-3884.866) * (-3882.677) (-3882.628) [-3886.747] (-3880.931) -- 0:02:06 555000 -- (-3884.239) [-3884.027] (-3884.204) (-3889.966) * (-3883.701) (-3887.645) [-3891.035] (-3885.692) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 555500 -- (-3886.712) (-3884.741) [-3885.959] (-3884.688) * [-3882.299] (-3883.262) (-3890.975) (-3880.920) -- 0:02:06 556000 -- (-3886.897) (-3888.263) (-3883.975) [-3882.546] * (-3892.991) (-3884.451) (-3883.067) [-3884.350] -- 0:02:06 556500 -- (-3885.199) (-3890.491) (-3882.996) [-3883.489] * (-3883.108) (-3895.374) (-3886.529) [-3884.817] -- 0:02:05 557000 -- (-3890.970) (-3889.283) [-3889.275] (-3893.267) * (-3892.865) (-3886.999) (-3889.018) [-3886.687] -- 0:02:05 557500 -- [-3882.621] (-3888.817) (-3881.538) (-3885.641) * (-3890.380) [-3884.652] (-3898.119) (-3881.788) -- 0:02:05 558000 -- (-3887.174) (-3885.287) [-3889.682] (-3885.892) * [-3887.072] (-3887.665) (-3882.902) (-3886.952) -- 0:02:05 558500 -- [-3887.006] (-3891.619) (-3889.853) (-3884.416) * (-3889.345) [-3881.279] (-3884.572) (-3891.069) -- 0:02:04 559000 -- (-3888.219) (-3885.678) (-3886.631) [-3883.496] * [-3881.476] (-3886.357) (-3890.574) (-3883.931) -- 0:02:05 559500 -- (-3891.086) [-3885.202] (-3892.306) (-3888.301) * (-3884.213) (-3890.496) [-3887.861] (-3885.521) -- 0:02:05 560000 -- [-3884.284] (-3887.395) (-3892.369) (-3889.632) * (-3886.468) (-3886.159) (-3892.701) [-3881.126] -- 0:02:04 Average standard deviation of split frequencies: 0.000000 560500 -- (-3887.426) (-3882.744) [-3881.416] (-3885.317) * (-3888.198) (-3884.669) (-3899.810) [-3883.414] -- 0:02:04 561000 -- (-3889.272) [-3886.003] (-3880.373) (-3883.094) * (-3881.780) [-3883.024] (-3900.514) (-3882.187) -- 0:02:04 561500 -- (-3893.576) (-3881.773) [-3884.020] (-3889.643) * (-3883.525) [-3881.077] (-3890.399) (-3882.218) -- 0:02:04 562000 -- (-3884.917) (-3886.043) (-3881.475) [-3885.475] * [-3882.686] (-3891.255) (-3883.805) (-3892.912) -- 0:02:03 562500 -- (-3885.048) (-3885.447) (-3881.743) [-3889.133] * (-3882.404) [-3883.323] (-3884.431) (-3887.847) -- 0:02:04 563000 -- [-3884.585] (-3886.771) (-3888.670) (-3885.572) * (-3884.068) (-3886.058) [-3884.733] (-3888.223) -- 0:02:04 563500 -- [-3885.580] (-3890.700) (-3886.022) (-3886.527) * (-3890.267) [-3882.303] (-3888.836) (-3883.374) -- 0:02:03 564000 -- [-3882.552] (-3890.441) (-3887.777) (-3887.953) * [-3886.486] (-3880.276) (-3883.927) (-3893.654) -- 0:02:03 564500 -- (-3886.015) (-3889.481) [-3882.656] (-3889.771) * (-3886.611) [-3884.926] (-3883.629) (-3883.542) -- 0:02:03 565000 -- (-3880.490) (-3885.520) [-3883.741] (-3884.976) * (-3888.691) (-3890.749) [-3884.886] (-3884.067) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 565500 -- [-3881.923] (-3883.067) (-3891.892) (-3889.107) * (-3890.903) [-3882.734] (-3891.002) (-3888.561) -- 0:02:02 566000 -- (-3881.315) [-3881.321] (-3882.155) (-3890.287) * (-3888.005) (-3883.489) (-3886.213) [-3885.175] -- 0:02:03 566500 -- (-3889.191) [-3891.293] (-3885.436) (-3885.522) * [-3889.357] (-3890.598) (-3882.044) (-3879.673) -- 0:02:03 567000 -- (-3883.389) (-3890.225) [-3883.324] (-3892.273) * (-3895.545) (-3882.034) (-3899.162) [-3884.610] -- 0:02:02 567500 -- (-3888.152) (-3884.769) [-3886.006] (-3888.096) * (-3888.858) [-3884.079] (-3887.480) (-3887.625) -- 0:02:02 568000 -- (-3886.156) [-3885.702] (-3887.488) (-3890.922) * [-3885.697] (-3885.591) (-3879.818) (-3884.753) -- 0:02:02 568500 -- (-3883.305) (-3883.351) [-3890.498] (-3888.293) * (-3883.523) [-3882.526] (-3880.949) (-3884.443) -- 0:02:02 569000 -- [-3885.478] (-3885.327) (-3889.490) (-3897.520) * (-3882.389) (-3883.847) [-3890.193] (-3885.696) -- 0:02:01 569500 -- (-3885.114) [-3883.721] (-3881.533) (-3884.252) * [-3882.387] (-3884.476) (-3885.145) (-3881.126) -- 0:02:02 570000 -- [-3887.425] (-3884.396) (-3882.398) (-3887.049) * (-3887.664) (-3883.971) [-3892.178] (-3885.334) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 570500 -- (-3890.865) (-3883.727) (-3883.794) [-3888.550] * (-3893.433) (-3885.783) (-3884.688) [-3883.752] -- 0:02:01 571000 -- [-3881.677] (-3886.002) (-3889.023) (-3887.551) * (-3882.152) (-3891.692) [-3880.784] (-3884.676) -- 0:02:01 571500 -- [-3883.784] (-3884.662) (-3893.426) (-3884.570) * (-3890.692) (-3885.048) [-3880.926] (-3884.683) -- 0:02:01 572000 -- (-3887.187) (-3887.483) (-3890.932) [-3881.634] * (-3884.824) (-3880.836) (-3880.638) [-3886.844] -- 0:02:01 572500 -- (-3889.423) [-3885.312] (-3897.357) (-3885.663) * (-3886.605) (-3885.139) (-3886.478) [-3886.876] -- 0:02:00 573000 -- [-3884.212] (-3886.163) (-3889.521) (-3883.314) * (-3882.723) (-3885.772) (-3887.289) [-3883.431] -- 0:02:01 573500 -- (-3887.248) (-3888.942) [-3884.876] (-3884.577) * (-3887.098) (-3879.740) (-3885.715) [-3883.211] -- 0:02:01 574000 -- [-3882.405] (-3883.142) (-3889.042) (-3884.561) * [-3882.217] (-3883.447) (-3887.769) (-3888.733) -- 0:02:00 574500 -- (-3883.128) [-3883.201] (-3885.681) (-3881.301) * (-3888.287) (-3883.798) (-3891.745) [-3888.391] -- 0:02:00 575000 -- [-3881.180] (-3882.568) (-3883.036) (-3880.243) * [-3884.317] (-3884.903) (-3891.173) (-3886.951) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 575500 -- (-3886.053) (-3887.407) (-3884.059) [-3884.002] * [-3888.583] (-3882.916) (-3881.874) (-3891.510) -- 0:02:00 576000 -- (-3889.744) (-3887.574) [-3893.017] (-3882.707) * [-3880.703] (-3886.082) (-3880.249) (-3888.114) -- 0:01:59 576500 -- (-3898.764) (-3890.863) (-3883.541) [-3881.254] * [-3884.394] (-3886.102) (-3887.694) (-3891.730) -- 0:02:00 577000 -- (-3884.541) [-3885.082] (-3888.503) (-3886.440) * [-3883.975] (-3885.646) (-3883.344) (-3886.255) -- 0:02:00 577500 -- [-3882.418] (-3882.394) (-3881.050) (-3886.435) * [-3886.831] (-3886.422) (-3884.127) (-3887.937) -- 0:01:59 578000 -- (-3886.746) (-3886.447) (-3890.122) [-3885.289] * (-3885.524) (-3884.504) [-3887.015] (-3889.725) -- 0:01:59 578500 -- (-3890.720) [-3879.269] (-3882.069) (-3891.833) * (-3886.004) (-3883.370) [-3884.343] (-3889.914) -- 0:01:59 579000 -- (-3888.532) (-3888.378) [-3878.889] (-3890.400) * (-3882.544) (-3890.152) [-3886.338] (-3888.512) -- 0:01:59 579500 -- [-3882.613] (-3890.847) (-3887.351) (-3890.386) * [-3880.653] (-3883.306) (-3886.917) (-3882.065) -- 0:01:59 580000 -- (-3892.433) (-3892.518) (-3893.135) [-3889.206] * (-3883.841) (-3886.035) (-3889.007) [-3886.163] -- 0:01:58 Average standard deviation of split frequencies: 0.000000 580500 -- (-3895.898) (-3880.244) [-3885.821] (-3889.595) * [-3889.576] (-3887.879) (-3888.601) (-3888.200) -- 0:01:59 581000 -- [-3880.805] (-3882.313) (-3888.515) (-3884.950) * (-3887.113) (-3898.031) (-3886.317) [-3882.704] -- 0:01:58 581500 -- (-3887.838) (-3886.002) (-3882.984) [-3887.425] * [-3886.674] (-3893.814) (-3881.367) (-3882.530) -- 0:01:58 582000 -- (-3883.037) [-3884.723] (-3884.066) (-3883.036) * (-3890.935) (-3889.628) [-3884.965] (-3883.195) -- 0:01:58 582500 -- (-3890.297) [-3889.275] (-3887.399) (-3888.484) * (-3887.232) (-3889.411) (-3888.145) [-3885.005] -- 0:01:58 583000 -- (-3888.394) (-3888.379) (-3881.787) [-3889.538] * (-3885.036) (-3888.613) (-3889.093) [-3882.218] -- 0:01:58 583500 -- [-3885.607] (-3889.947) (-3888.205) (-3886.783) * (-3885.581) (-3888.774) (-3889.292) [-3883.873] -- 0:01:57 584000 -- (-3884.275) (-3895.729) (-3884.457) [-3882.941] * (-3892.232) [-3886.203] (-3892.377) (-3890.922) -- 0:01:58 584500 -- (-3883.655) (-3886.885) [-3880.947] (-3890.942) * [-3885.528] (-3882.035) (-3887.467) (-3884.872) -- 0:01:58 585000 -- (-3886.080) (-3886.465) [-3882.541] (-3884.861) * (-3882.451) (-3884.802) (-3882.924) [-3883.427] -- 0:01:57 Average standard deviation of split frequencies: 0.000000 585500 -- [-3884.013] (-3884.695) (-3882.643) (-3884.799) * (-3886.595) (-3889.253) (-3884.732) [-3888.777] -- 0:01:57 586000 -- [-3885.863] (-3883.225) (-3886.994) (-3884.183) * [-3886.441] (-3885.226) (-3883.937) (-3885.130) -- 0:01:57 586500 -- [-3892.501] (-3881.832) (-3884.218) (-3881.721) * (-3883.232) (-3879.817) [-3888.275] (-3895.372) -- 0:01:57 587000 -- (-3888.912) (-3887.642) (-3883.052) [-3891.341] * [-3883.324] (-3886.715) (-3879.928) (-3890.963) -- 0:01:56 587500 -- (-3897.552) (-3883.913) [-3884.102] (-3890.522) * [-3883.998] (-3887.863) (-3885.474) (-3888.002) -- 0:01:57 588000 -- (-3886.667) (-3887.277) [-3886.305] (-3883.416) * (-3886.205) (-3882.645) [-3882.460] (-3885.337) -- 0:01:57 588500 -- [-3884.514] (-3888.350) (-3890.187) (-3894.825) * (-3886.152) (-3889.419) [-3883.741] (-3885.662) -- 0:01:56 589000 -- [-3881.287] (-3884.399) (-3889.125) (-3889.281) * (-3881.880) (-3883.500) [-3885.432] (-3886.003) -- 0:01:56 589500 -- [-3885.755] (-3887.514) (-3882.121) (-3889.492) * (-3882.494) [-3889.666] (-3882.944) (-3892.543) -- 0:01:56 590000 -- (-3884.943) (-3892.154) (-3881.768) [-3882.797] * (-3883.035) (-3888.368) [-3880.792] (-3885.312) -- 0:01:56 Average standard deviation of split frequencies: 0.000000 590500 -- (-3881.074) [-3888.489] (-3883.148) (-3886.305) * [-3883.555] (-3889.329) (-3894.949) (-3890.948) -- 0:01:55 591000 -- (-3886.721) [-3882.638] (-3885.697) (-3887.986) * [-3882.492] (-3884.492) (-3883.182) (-3885.422) -- 0:01:56 591500 -- (-3885.367) [-3892.946] (-3882.489) (-3884.380) * [-3885.895] (-3881.683) (-3884.599) (-3884.451) -- 0:01:56 592000 -- (-3887.664) (-3885.484) [-3887.133] (-3890.463) * (-3893.720) (-3883.456) (-3894.590) [-3883.985] -- 0:01:55 592500 -- (-3889.763) [-3884.061] (-3893.347) (-3892.216) * [-3887.252] (-3886.462) (-3887.878) (-3884.940) -- 0:01:55 593000 -- (-3891.262) [-3882.036] (-3886.743) (-3887.707) * (-3886.652) (-3881.714) [-3887.818] (-3887.933) -- 0:01:55 593500 -- (-3884.994) (-3886.746) (-3889.074) [-3881.297] * (-3882.463) (-3892.724) [-3884.341] (-3890.757) -- 0:01:55 594000 -- (-3884.939) (-3890.664) (-3884.691) [-3888.833] * (-3883.500) [-3886.774] (-3891.332) (-3894.702) -- 0:01:54 594500 -- (-3889.567) (-3891.081) [-3888.335] (-3883.833) * (-3888.249) (-3891.325) [-3884.757] (-3890.126) -- 0:01:55 595000 -- (-3890.271) [-3886.696] (-3884.853) (-3886.512) * [-3880.966] (-3887.508) (-3886.097) (-3881.008) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 595500 -- [-3882.614] (-3887.061) (-3884.786) (-3888.298) * (-3885.913) (-3889.151) [-3881.534] (-3889.307) -- 0:01:54 596000 -- (-3887.574) [-3884.209] (-3887.293) (-3880.506) * (-3888.969) (-3888.825) [-3882.591] (-3883.691) -- 0:01:54 596500 -- (-3886.546) (-3889.414) (-3889.265) [-3883.389] * (-3886.127) (-3891.006) (-3887.753) [-3887.382] -- 0:01:54 597000 -- (-3886.371) [-3885.222] (-3887.427) (-3886.464) * (-3883.158) (-3885.714) (-3889.126) [-3885.146] -- 0:01:54 597500 -- (-3882.204) [-3884.447] (-3882.410) (-3886.638) * (-3885.485) (-3886.847) [-3882.734] (-3885.162) -- 0:01:53 598000 -- (-3885.503) (-3885.458) (-3881.942) [-3884.768] * [-3885.633] (-3883.044) (-3882.538) (-3884.379) -- 0:01:54 598500 -- [-3882.420] (-3883.864) (-3888.327) (-3887.897) * (-3887.863) (-3884.166) [-3883.583] (-3885.374) -- 0:01:54 599000 -- [-3883.784] (-3883.275) (-3884.501) (-3886.860) * [-3886.958] (-3891.744) (-3883.626) (-3881.738) -- 0:01:53 599500 -- [-3883.330] (-3884.715) (-3890.241) (-3880.998) * (-3883.317) (-3887.824) (-3882.372) [-3884.060] -- 0:01:53 600000 -- [-3882.098] (-3887.477) (-3884.288) (-3885.751) * (-3886.126) (-3884.511) [-3887.171] (-3883.726) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 600500 -- (-3884.294) [-3889.576] (-3882.658) (-3881.377) * [-3888.291] (-3891.360) (-3892.940) (-3879.380) -- 0:01:53 601000 -- (-3884.942) (-3885.284) (-3894.488) [-3882.783] * (-3882.972) (-3882.803) (-3891.651) [-3880.930] -- 0:01:52 601500 -- (-3885.606) (-3885.298) (-3883.765) [-3883.823] * (-3886.049) (-3891.134) [-3879.945] (-3889.476) -- 0:01:53 602000 -- (-3890.974) [-3890.418] (-3882.719) (-3886.033) * (-3885.199) (-3883.727) (-3886.099) [-3881.529] -- 0:01:53 602500 -- (-3888.793) (-3886.037) (-3879.751) [-3888.274] * (-3882.363) (-3887.420) (-3883.315) [-3886.157] -- 0:01:52 603000 -- (-3882.416) (-3888.094) [-3889.584] (-3889.745) * (-3884.971) (-3886.034) (-3883.849) [-3883.534] -- 0:01:52 603500 -- (-3884.794) (-3884.012) [-3886.242] (-3886.911) * (-3891.683) (-3881.804) (-3882.661) [-3887.779] -- 0:01:52 604000 -- (-3886.997) (-3885.408) (-3882.995) [-3883.019] * (-3885.676) (-3883.148) (-3886.471) [-3883.802] -- 0:01:52 604500 -- [-3885.286] (-3884.801) (-3882.243) (-3883.989) * (-3884.464) (-3884.707) [-3881.069] (-3884.787) -- 0:01:51 605000 -- (-3884.684) (-3888.883) (-3884.720) [-3884.742] * (-3886.124) (-3887.397) [-3884.314] (-3886.006) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 605500 -- [-3883.970] (-3891.853) (-3885.319) (-3891.854) * (-3890.784) [-3882.516] (-3882.780) (-3881.944) -- 0:01:52 606000 -- [-3883.305] (-3893.254) (-3884.540) (-3897.254) * [-3884.750] (-3881.982) (-3896.624) (-3880.122) -- 0:01:51 606500 -- (-3886.440) [-3888.126] (-3881.987) (-3881.956) * (-3882.039) (-3879.736) [-3882.502] (-3881.018) -- 0:01:51 607000 -- (-3890.416) (-3889.074) [-3881.630] (-3884.579) * (-3884.691) [-3884.044] (-3883.433) (-3887.194) -- 0:01:51 607500 -- (-3885.092) (-3888.697) [-3882.147] (-3886.872) * [-3883.893] (-3883.920) (-3891.796) (-3882.327) -- 0:01:51 608000 -- (-3883.269) (-3893.497) [-3881.073] (-3886.730) * [-3884.086] (-3885.811) (-3892.555) (-3885.826) -- 0:01:50 608500 -- (-3887.458) [-3882.791] (-3883.840) (-3888.816) * (-3885.558) (-3889.994) (-3893.917) [-3890.766] -- 0:01:51 609000 -- (-3883.006) (-3883.908) (-3886.652) [-3889.148] * (-3884.944) (-3885.002) [-3886.327] (-3892.714) -- 0:01:51 609500 -- (-3890.286) [-3880.948] (-3883.026) (-3883.359) * [-3885.001] (-3885.453) (-3887.930) (-3886.203) -- 0:01:50 610000 -- [-3883.610] (-3881.639) (-3885.890) (-3884.501) * [-3882.037] (-3887.619) (-3885.515) (-3889.335) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 610500 -- [-3883.765] (-3891.383) (-3884.964) (-3885.117) * (-3889.406) (-3891.803) (-3886.792) [-3889.921] -- 0:01:50 611000 -- (-3882.468) [-3885.407] (-3885.122) (-3887.495) * (-3884.272) [-3882.930] (-3886.224) (-3887.933) -- 0:01:50 611500 -- (-3889.393) (-3882.761) (-3886.608) [-3882.780] * (-3883.645) (-3884.492) (-3893.526) [-3883.805] -- 0:01:49 612000 -- (-3885.052) [-3880.278] (-3886.840) (-3883.279) * (-3890.273) (-3886.027) (-3883.495) [-3882.257] -- 0:01:50 612500 -- [-3886.226] (-3887.325) (-3884.024) (-3884.513) * (-3880.463) (-3888.966) [-3886.827] (-3882.265) -- 0:01:50 613000 -- (-3882.330) (-3890.744) (-3886.249) [-3889.421] * (-3884.919) [-3880.323] (-3892.364) (-3884.929) -- 0:01:49 613500 -- (-3887.530) (-3887.124) (-3882.866) [-3884.369] * (-3885.303) (-3892.348) (-3894.247) [-3883.395] -- 0:01:49 614000 -- [-3883.823] (-3887.416) (-3886.757) (-3883.980) * [-3883.609] (-3891.980) (-3889.941) (-3888.100) -- 0:01:49 614500 -- [-3887.989] (-3884.696) (-3890.028) (-3888.811) * [-3881.607] (-3889.698) (-3886.887) (-3890.132) -- 0:01:49 615000 -- [-3894.777] (-3882.506) (-3888.060) (-3889.413) * (-3882.158) (-3884.088) (-3883.244) [-3879.127] -- 0:01:48 Average standard deviation of split frequencies: 0.000000 615500 -- [-3883.407] (-3889.154) (-3885.734) (-3884.293) * (-3882.083) (-3883.008) (-3884.421) [-3892.885] -- 0:01:49 616000 -- [-3879.201] (-3882.369) (-3886.250) (-3882.503) * (-3882.148) [-3885.784] (-3894.309) (-3891.994) -- 0:01:49 616500 -- (-3882.302) [-3888.331] (-3884.290) (-3891.017) * [-3881.562] (-3884.885) (-3891.686) (-3891.321) -- 0:01:48 617000 -- (-3890.854) [-3886.090] (-3878.332) (-3886.530) * (-3881.773) (-3883.658) (-3889.028) [-3887.384] -- 0:01:48 617500 -- (-3884.508) [-3885.279] (-3881.293) (-3885.648) * [-3881.583] (-3891.874) (-3882.955) (-3885.250) -- 0:01:48 618000 -- (-3890.367) (-3887.210) (-3880.587) [-3892.796] * (-3884.720) (-3889.358) (-3883.622) [-3888.576] -- 0:01:48 618500 -- (-3890.036) (-3891.188) [-3884.203] (-3899.296) * (-3890.110) (-3889.678) [-3885.301] (-3883.221) -- 0:01:47 619000 -- [-3882.652] (-3891.451) (-3885.533) (-3886.668) * [-3885.194] (-3886.230) (-3892.725) (-3889.252) -- 0:01:48 619500 -- [-3887.565] (-3888.150) (-3881.018) (-3884.978) * (-3888.869) (-3885.866) [-3883.567] (-3886.943) -- 0:01:48 620000 -- (-3883.300) (-3889.226) (-3892.908) [-3881.514] * (-3883.565) (-3888.966) [-3884.020] (-3888.125) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 620500 -- (-3900.794) (-3882.031) [-3885.367] (-3883.545) * (-3889.052) (-3884.222) (-3885.629) [-3890.359] -- 0:01:47 621000 -- (-3893.908) (-3886.525) [-3880.592] (-3881.832) * (-3885.780) (-3883.992) (-3885.291) [-3889.256] -- 0:01:47 621500 -- (-3882.658) [-3887.621] (-3887.092) (-3885.925) * [-3884.268] (-3887.158) (-3888.284) (-3889.820) -- 0:01:47 622000 -- (-3886.123) (-3882.432) (-3888.652) [-3884.195] * (-3884.949) [-3886.159] (-3888.105) (-3886.382) -- 0:01:46 622500 -- (-3887.471) (-3886.797) (-3881.489) [-3881.023] * (-3890.983) [-3886.027] (-3883.218) (-3888.364) -- 0:01:47 623000 -- (-3885.262) [-3882.639] (-3883.318) (-3881.978) * (-3892.355) (-3883.755) [-3883.266] (-3887.098) -- 0:01:47 623500 -- (-3880.433) (-3882.243) (-3886.761) [-3884.487] * (-3898.167) (-3885.600) [-3884.164] (-3885.029) -- 0:01:46 624000 -- (-3886.159) (-3883.480) [-3884.059] (-3886.757) * (-3887.573) [-3882.875] (-3884.680) (-3887.773) -- 0:01:46 624500 -- [-3881.443] (-3892.505) (-3886.622) (-3885.293) * (-3883.855) (-3882.710) (-3893.631) [-3883.341] -- 0:01:46 625000 -- (-3884.753) [-3894.493] (-3884.750) (-3883.927) * (-3882.588) (-3882.460) (-3887.047) [-3882.843] -- 0:01:46 Average standard deviation of split frequencies: 0.000000 625500 -- [-3881.906] (-3887.120) (-3887.735) (-3884.597) * [-3885.218] (-3881.085) (-3885.382) (-3891.880) -- 0:01:45 626000 -- (-3888.031) (-3884.735) [-3880.618] (-3885.754) * (-3889.901) (-3885.011) [-3882.614] (-3895.655) -- 0:01:46 626500 -- (-3881.606) (-3885.047) [-3884.559] (-3883.436) * (-3885.983) [-3885.372] (-3881.872) (-3886.997) -- 0:01:46 627000 -- [-3886.328] (-3886.328) (-3891.759) (-3884.263) * (-3888.259) [-3883.285] (-3889.288) (-3887.153) -- 0:01:45 627500 -- (-3885.109) (-3887.591) (-3886.659) [-3883.144] * (-3887.608) (-3884.110) (-3881.810) [-3886.525] -- 0:01:45 628000 -- (-3884.068) (-3888.679) [-3885.431] (-3890.732) * (-3881.745) [-3890.498] (-3886.614) (-3882.543) -- 0:01:45 628500 -- [-3882.715] (-3892.135) (-3885.440) (-3883.835) * (-3884.665) (-3884.278) (-3885.477) [-3886.018] -- 0:01:45 629000 -- [-3884.231] (-3884.371) (-3889.375) (-3883.537) * [-3887.089] (-3881.625) (-3888.809) (-3885.765) -- 0:01:44 629500 -- (-3885.683) (-3881.728) [-3886.033] (-3886.488) * (-3898.436) (-3886.001) (-3887.029) [-3889.702] -- 0:01:44 630000 -- [-3883.990] (-3884.208) (-3893.620) (-3890.486) * [-3886.124] (-3886.063) (-3889.308) (-3891.764) -- 0:01:45 Average standard deviation of split frequencies: 0.000000 630500 -- [-3882.916] (-3887.456) (-3885.348) (-3890.730) * [-3883.083] (-3887.836) (-3882.670) (-3888.344) -- 0:01:44 631000 -- [-3887.689] (-3887.944) (-3886.392) (-3882.121) * (-3880.031) (-3883.079) [-3886.416] (-3893.113) -- 0:01:44 631500 -- (-3892.365) (-3890.392) (-3883.320) [-3882.587] * [-3886.216] (-3885.334) (-3886.628) (-3885.988) -- 0:01:44 632000 -- [-3886.135] (-3883.533) (-3892.517) (-3892.040) * (-3891.745) [-3883.165] (-3886.860) (-3886.862) -- 0:01:44 632500 -- (-3884.285) (-3881.731) (-3888.244) [-3885.332] * [-3881.035] (-3887.131) (-3884.417) (-3885.194) -- 0:01:44 633000 -- (-3887.580) [-3882.044] (-3891.137) (-3889.569) * [-3884.553] (-3886.238) (-3888.880) (-3883.424) -- 0:01:43 633500 -- (-3888.257) [-3887.847] (-3888.484) (-3884.200) * (-3893.091) (-3885.023) (-3885.959) [-3881.969] -- 0:01:44 634000 -- (-3892.292) [-3886.357] (-3887.347) (-3882.281) * [-3886.563] (-3889.055) (-3889.447) (-3888.644) -- 0:01:43 634500 -- (-3890.271) [-3884.850] (-3888.314) (-3891.193) * (-3887.946) (-3887.714) [-3886.522] (-3886.563) -- 0:01:43 635000 -- (-3888.683) [-3883.837] (-3887.601) (-3882.399) * [-3887.363] (-3884.499) (-3886.096) (-3882.950) -- 0:01:43 Average standard deviation of split frequencies: 0.000000 635500 -- (-3888.001) [-3883.186] (-3884.543) (-3881.438) * [-3887.207] (-3889.629) (-3886.719) (-3884.963) -- 0:01:43 636000 -- [-3883.888] (-3891.352) (-3885.874) (-3890.204) * (-3886.144) (-3890.027) (-3891.406) [-3889.486] -- 0:01:43 636500 -- (-3883.042) (-3880.265) (-3886.263) [-3882.818] * (-3885.225) (-3883.393) (-3887.978) [-3885.689] -- 0:01:42 637000 -- (-3887.781) [-3881.199] (-3887.456) (-3889.030) * (-3886.916) [-3884.778] (-3883.550) (-3885.896) -- 0:01:43 637500 -- (-3895.233) [-3881.495] (-3882.702) (-3886.168) * (-3877.339) (-3887.848) (-3891.166) [-3885.678] -- 0:01:42 638000 -- [-3889.823] (-3886.709) (-3881.213) (-3887.626) * [-3884.510] (-3881.665) (-3882.369) (-3882.184) -- 0:01:42 638500 -- (-3887.580) (-3881.738) [-3882.188] (-3887.053) * (-3884.776) [-3884.177] (-3889.799) (-3887.647) -- 0:01:42 639000 -- (-3890.278) [-3884.370] (-3885.978) (-3892.192) * (-3887.359) (-3881.577) [-3883.347] (-3892.330) -- 0:01:42 639500 -- (-3890.657) [-3884.757] (-3884.337) (-3882.620) * [-3884.220] (-3895.619) (-3882.828) (-3883.686) -- 0:01:42 640000 -- (-3885.048) (-3885.881) [-3884.674] (-3884.407) * (-3885.462) (-3887.795) [-3882.737] (-3885.073) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 640500 -- [-3884.522] (-3882.066) (-3881.868) (-3884.631) * (-3890.442) [-3883.674] (-3885.861) (-3886.158) -- 0:01:42 641000 -- (-3884.511) (-3889.949) (-3879.782) [-3889.076] * [-3886.453] (-3888.140) (-3884.551) (-3884.870) -- 0:01:41 641500 -- [-3885.774] (-3888.140) (-3882.640) (-3888.644) * (-3883.972) (-3893.163) [-3888.863] (-3889.301) -- 0:01:41 642000 -- (-3886.239) (-3889.847) (-3888.393) [-3887.504] * (-3888.479) (-3883.442) [-3890.838] (-3884.941) -- 0:01:41 642500 -- [-3884.305] (-3890.589) (-3883.530) (-3890.215) * (-3884.197) (-3886.128) (-3884.642) [-3886.745] -- 0:01:41 643000 -- (-3899.508) (-3883.936) (-3882.050) [-3882.851] * [-3888.727] (-3882.648) (-3884.252) (-3890.974) -- 0:01:41 643500 -- (-3886.494) (-3886.561) [-3882.290] (-3882.614) * (-3884.359) (-3890.640) [-3884.777] (-3881.315) -- 0:01:40 644000 -- (-3883.101) (-3887.628) [-3880.730] (-3880.262) * (-3887.336) [-3882.090] (-3885.661) (-3883.381) -- 0:01:41 644500 -- [-3883.978] (-3883.500) (-3897.728) (-3887.929) * (-3883.338) [-3887.191] (-3881.057) (-3883.183) -- 0:01:40 645000 -- (-3885.476) [-3887.593] (-3885.959) (-3882.323) * (-3880.945) (-3881.946) (-3884.293) [-3881.335] -- 0:01:40 Average standard deviation of split frequencies: 0.000000 645500 -- (-3891.239) [-3885.133] (-3892.690) (-3882.914) * (-3892.447) [-3895.211] (-3885.135) (-3882.849) -- 0:01:40 646000 -- (-3896.207) (-3880.574) [-3890.179] (-3885.366) * (-3888.722) (-3888.386) (-3884.769) [-3884.833] -- 0:01:40 646500 -- (-3886.549) [-3883.385] (-3883.363) (-3883.653) * (-3888.978) [-3881.031] (-3891.181) (-3886.852) -- 0:01:40 647000 -- (-3885.496) [-3883.202] (-3889.057) (-3888.326) * (-3885.639) (-3886.074) [-3881.942] (-3885.935) -- 0:01:39 647500 -- (-3880.587) [-3882.045] (-3883.783) (-3889.559) * [-3888.877] (-3889.073) (-3884.281) (-3890.083) -- 0:01:40 648000 -- (-3886.592) [-3885.878] (-3886.500) (-3888.143) * [-3883.385] (-3892.347) (-3893.365) (-3889.085) -- 0:01:39 648500 -- (-3880.495) (-3891.676) [-3883.645] (-3886.849) * (-3889.165) (-3881.416) [-3880.900] (-3892.208) -- 0:01:39 649000 -- [-3887.483] (-3890.399) (-3884.555) (-3886.744) * [-3886.910] (-3884.550) (-3883.091) (-3891.149) -- 0:01:39 649500 -- (-3884.662) [-3888.521] (-3884.417) (-3888.659) * (-3885.734) [-3886.536] (-3883.543) (-3884.303) -- 0:01:39 650000 -- (-3882.125) (-3883.921) (-3886.328) [-3884.710] * (-3886.423) (-3886.410) [-3882.818] (-3884.866) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 650500 -- [-3885.162] (-3888.059) (-3883.854) (-3883.876) * (-3886.239) (-3882.831) (-3886.844) [-3881.372] -- 0:01:38 651000 -- (-3886.696) [-3880.257] (-3885.147) (-3888.812) * (-3892.437) [-3882.151] (-3883.186) (-3881.862) -- 0:01:39 651500 -- (-3883.819) [-3885.879] (-3893.472) (-3886.074) * [-3889.689] (-3882.038) (-3883.763) (-3884.898) -- 0:01:38 652000 -- [-3887.316] (-3883.344) (-3891.651) (-3889.550) * (-3881.709) (-3889.048) [-3884.379] (-3884.479) -- 0:01:38 652500 -- (-3881.927) (-3883.707) [-3882.464] (-3881.838) * (-3885.299) (-3889.090) [-3880.735] (-3889.104) -- 0:01:38 653000 -- (-3886.160) (-3885.188) (-3884.121) [-3880.540] * (-3889.960) (-3894.472) [-3883.654] (-3887.513) -- 0:01:38 653500 -- (-3888.907) [-3891.099] (-3883.159) (-3886.751) * [-3887.847] (-3884.575) (-3890.324) (-3889.114) -- 0:01:38 654000 -- [-3886.983] (-3891.395) (-3882.639) (-3882.173) * (-3888.050) (-3883.698) (-3888.503) [-3885.911] -- 0:01:37 654500 -- (-3888.100) (-3890.901) (-3884.993) [-3879.669] * [-3881.665] (-3886.817) (-3881.971) (-3879.672) -- 0:01:38 655000 -- (-3892.457) (-3888.616) [-3884.443] (-3893.897) * [-3882.401] (-3890.772) (-3886.244) (-3883.226) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 655500 -- (-3883.295) (-3888.031) (-3884.916) [-3884.142] * (-3894.052) (-3883.118) (-3883.051) [-3885.278] -- 0:01:37 656000 -- (-3889.569) (-3882.011) [-3882.246] (-3881.116) * [-3883.966] (-3888.864) (-3884.420) (-3882.080) -- 0:01:37 656500 -- (-3888.408) [-3884.652] (-3885.135) (-3885.217) * [-3889.124] (-3881.279) (-3887.260) (-3886.873) -- 0:01:37 657000 -- (-3888.500) (-3895.613) (-3889.010) [-3887.573] * [-3881.433] (-3883.001) (-3882.592) (-3891.808) -- 0:01:37 657500 -- (-3886.144) (-3884.652) (-3880.805) [-3880.246] * [-3882.052] (-3886.920) (-3884.604) (-3891.810) -- 0:01:36 658000 -- (-3885.895) (-3882.021) (-3885.484) [-3887.700] * (-3893.872) (-3888.338) (-3881.978) [-3885.747] -- 0:01:37 658500 -- (-3890.351) [-3888.856] (-3890.461) (-3882.417) * (-3886.499) (-3891.785) (-3883.032) [-3885.591] -- 0:01:36 659000 -- (-3888.107) (-3887.621) (-3885.686) [-3885.344] * [-3881.665] (-3882.403) (-3889.055) (-3893.458) -- 0:01:36 659500 -- (-3890.866) (-3885.702) (-3881.684) [-3882.620] * (-3893.343) [-3888.084] (-3881.566) (-3889.236) -- 0:01:36 660000 -- [-3884.700] (-3887.737) (-3884.943) (-3886.016) * (-3892.738) (-3892.498) (-3886.390) [-3892.631] -- 0:01:36 Average standard deviation of split frequencies: 0.000000 660500 -- [-3886.754] (-3885.334) (-3884.262) (-3886.771) * (-3888.963) (-3883.749) [-3882.810] (-3886.060) -- 0:01:36 661000 -- (-3887.670) [-3887.232] (-3891.579) (-3884.530) * (-3882.366) [-3889.218] (-3880.700) (-3891.142) -- 0:01:35 661500 -- [-3886.847] (-3887.688) (-3885.953) (-3885.626) * (-3879.964) (-3885.058) [-3887.038] (-3886.714) -- 0:01:36 662000 -- [-3883.085] (-3888.118) (-3886.204) (-3890.657) * (-3882.820) (-3883.103) (-3883.085) [-3888.213] -- 0:01:35 662500 -- [-3882.895] (-3882.364) (-3883.948) (-3888.063) * (-3882.582) (-3888.315) (-3885.169) [-3887.354] -- 0:01:35 663000 -- (-3883.632) [-3881.825] (-3889.319) (-3885.905) * (-3880.929) [-3886.421] (-3886.658) (-3884.962) -- 0:01:35 663500 -- [-3884.925] (-3885.319) (-3889.212) (-3893.397) * (-3882.121) (-3887.444) [-3881.860] (-3886.056) -- 0:01:35 664000 -- (-3887.065) (-3882.348) (-3887.899) [-3882.903] * (-3883.615) (-3888.730) (-3886.264) [-3883.202] -- 0:01:35 664500 -- (-3896.026) (-3883.368) [-3885.367] (-3890.050) * [-3885.434] (-3889.451) (-3884.218) (-3884.681) -- 0:01:34 665000 -- (-3889.846) (-3889.670) (-3885.617) [-3881.273] * [-3884.851] (-3891.161) (-3882.478) (-3890.979) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 665500 -- (-3884.807) (-3880.102) (-3885.576) [-3883.389] * [-3886.767] (-3881.244) (-3884.380) (-3891.411) -- 0:01:34 666000 -- (-3888.338) (-3893.999) (-3885.979) [-3885.579] * (-3896.044) (-3881.082) (-3885.214) [-3890.504] -- 0:01:34 666500 -- [-3880.480] (-3880.640) (-3888.088) (-3886.030) * (-3890.253) [-3885.223] (-3888.068) (-3888.358) -- 0:01:34 667000 -- (-3883.157) (-3885.823) [-3886.512] (-3882.639) * (-3881.802) [-3885.624] (-3885.194) (-3884.801) -- 0:01:34 667500 -- [-3887.187] (-3890.597) (-3882.509) (-3884.875) * [-3886.980] (-3884.608) (-3888.105) (-3885.685) -- 0:01:34 668000 -- (-3887.168) (-3890.060) (-3884.729) [-3882.715] * (-3887.892) [-3882.101] (-3885.097) (-3886.977) -- 0:01:33 668500 -- [-3884.374] (-3888.406) (-3888.975) (-3884.927) * (-3882.498) (-3879.033) (-3882.500) [-3882.841] -- 0:01:34 669000 -- (-3883.335) [-3883.141] (-3883.385) (-3880.995) * (-3880.883) (-3882.884) (-3892.791) [-3885.126] -- 0:01:34 669500 -- (-3890.784) (-3881.924) (-3890.047) [-3888.173] * (-3887.400) [-3883.530] (-3884.543) (-3883.233) -- 0:01:33 670000 -- (-3887.431) [-3883.634] (-3886.623) (-3881.941) * (-3885.746) [-3883.729] (-3889.271) (-3888.150) -- 0:01:33 Average standard deviation of split frequencies: 0.000000 670500 -- [-3885.395] (-3892.865) (-3894.137) (-3885.172) * (-3884.011) [-3883.103] (-3888.935) (-3892.851) -- 0:01:33 671000 -- [-3882.484] (-3888.790) (-3886.864) (-3883.239) * (-3886.839) (-3890.684) [-3881.469] (-3886.178) -- 0:01:33 671500 -- [-3883.907] (-3884.615) (-3882.147) (-3884.038) * (-3882.298) [-3888.372] (-3887.067) (-3890.757) -- 0:01:32 672000 -- (-3880.966) (-3887.882) (-3891.709) [-3879.734] * [-3881.646] (-3889.561) (-3886.044) (-3882.950) -- 0:01:33 672500 -- [-3885.684] (-3886.385) (-3885.230) (-3887.082) * (-3882.878) (-3886.478) (-3879.670) [-3881.490] -- 0:01:33 673000 -- [-3883.924] (-3894.045) (-3889.501) (-3890.314) * (-3880.736) (-3886.972) (-3882.119) [-3879.094] -- 0:01:32 673500 -- (-3884.698) (-3890.010) [-3882.914] (-3885.230) * (-3885.004) (-3883.404) (-3881.442) [-3882.799] -- 0:01:32 674000 -- (-3885.496) [-3882.420] (-3885.997) (-3885.618) * (-3882.655) (-3883.527) (-3892.038) [-3882.897] -- 0:01:32 674500 -- (-3886.006) (-3882.003) (-3881.749) [-3880.771] * (-3883.903) (-3883.572) (-3884.457) [-3884.461] -- 0:01:32 675000 -- (-3888.410) (-3883.459) [-3886.959] (-3879.817) * (-3887.882) (-3881.870) (-3888.244) [-3890.362] -- 0:01:31 Average standard deviation of split frequencies: 0.000000 675500 -- [-3883.990] (-3880.048) (-3884.318) (-3885.301) * [-3882.335] (-3883.357) (-3883.806) (-3883.981) -- 0:01:32 676000 -- (-3886.313) (-3888.109) (-3885.435) [-3880.323] * (-3886.528) [-3887.368] (-3886.769) (-3886.497) -- 0:01:32 676500 -- (-3884.248) (-3894.219) [-3885.615] (-3882.686) * [-3886.082] (-3881.755) (-3885.799) (-3884.203) -- 0:01:31 677000 -- (-3885.181) (-3890.019) [-3883.473] (-3883.900) * [-3882.158] (-3878.971) (-3881.510) (-3885.441) -- 0:01:31 677500 -- (-3898.983) [-3887.249] (-3885.001) (-3887.851) * (-3882.172) [-3881.970] (-3881.508) (-3887.090) -- 0:01:31 678000 -- (-3892.242) (-3891.788) (-3884.038) [-3881.622] * (-3882.175) (-3883.027) (-3884.973) [-3880.545] -- 0:01:31 678500 -- (-3885.721) (-3884.616) [-3883.654] (-3881.645) * [-3883.503] (-3883.967) (-3881.372) (-3886.188) -- 0:01:30 679000 -- (-3889.540) (-3887.579) [-3888.505] (-3889.726) * (-3884.186) [-3883.557] (-3891.807) (-3881.318) -- 0:01:31 679500 -- (-3887.448) [-3881.636] (-3888.070) (-3885.760) * (-3885.223) (-3888.248) [-3893.156] (-3884.303) -- 0:01:31 680000 -- (-3883.122) (-3884.202) (-3887.859) [-3882.947] * [-3882.881] (-3883.364) (-3881.935) (-3883.156) -- 0:01:30 Average standard deviation of split frequencies: 0.000000 680500 -- (-3890.371) [-3887.688] (-3881.976) (-3884.006) * (-3880.911) (-3885.997) [-3882.064] (-3889.180) -- 0:01:30 681000 -- [-3881.060] (-3884.435) (-3882.531) (-3885.163) * [-3887.911] (-3884.167) (-3882.401) (-3888.356) -- 0:01:30 681500 -- [-3885.231] (-3882.015) (-3881.322) (-3886.983) * (-3889.222) (-3886.016) [-3881.469] (-3886.208) -- 0:01:30 682000 -- (-3885.245) (-3880.995) [-3882.839] (-3884.664) * (-3881.592) (-3886.881) [-3883.317] (-3889.095) -- 0:01:29 682500 -- (-3887.767) [-3880.247] (-3882.783) (-3888.489) * (-3890.850) (-3888.959) (-3880.667) [-3882.185] -- 0:01:29 683000 -- [-3886.430] (-3882.472) (-3888.640) (-3885.394) * (-3887.445) (-3888.969) (-3880.642) [-3880.393] -- 0:01:30 683500 -- [-3883.231] (-3884.124) (-3887.898) (-3887.339) * (-3884.951) (-3885.931) [-3885.591] (-3892.585) -- 0:01:29 684000 -- (-3882.724) [-3882.729] (-3888.005) (-3882.046) * (-3881.872) (-3887.385) (-3884.714) [-3883.187] -- 0:01:29 684500 -- (-3887.186) [-3889.774] (-3885.632) (-3881.173) * [-3884.513] (-3885.479) (-3889.544) (-3886.081) -- 0:01:29 685000 -- [-3888.281] (-3886.365) (-3887.039) (-3885.676) * (-3888.843) (-3885.232) (-3888.169) [-3887.266] -- 0:01:29 Average standard deviation of split frequencies: 0.000000 685500 -- (-3895.667) (-3888.415) [-3885.596] (-3888.276) * [-3882.246] (-3888.326) (-3892.922) (-3885.458) -- 0:01:29 686000 -- [-3887.852] (-3893.696) (-3884.294) (-3886.190) * (-3897.227) (-3885.502) [-3887.102] (-3884.522) -- 0:01:28 686500 -- (-3892.010) (-3886.047) [-3887.694] (-3892.228) * (-3887.755) (-3890.165) (-3886.023) [-3887.312] -- 0:01:29 687000 -- (-3890.457) (-3885.656) [-3884.343] (-3888.303) * (-3889.931) (-3886.343) [-3884.278] (-3887.474) -- 0:01:28 687500 -- (-3889.812) (-3883.570) (-3889.954) [-3879.023] * (-3892.677) (-3884.109) (-3886.287) [-3882.326] -- 0:01:28 688000 -- (-3891.112) (-3891.789) (-3882.242) [-3879.281] * (-3891.209) [-3885.034] (-3886.837) (-3886.655) -- 0:01:28 688500 -- [-3885.875] (-3884.787) (-3885.852) (-3881.172) * (-3883.657) (-3890.179) (-3888.471) [-3883.123] -- 0:01:28 689000 -- (-3882.259) [-3883.429] (-3879.069) (-3884.344) * (-3885.334) (-3884.330) [-3886.622] (-3885.127) -- 0:01:28 689500 -- (-3890.656) (-3887.501) (-3882.812) [-3883.285] * [-3881.093] (-3888.665) (-3890.895) (-3884.600) -- 0:01:27 690000 -- (-3894.716) [-3885.596] (-3890.976) (-3881.359) * (-3886.418) (-3887.805) [-3891.909] (-3886.026) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 690500 -- (-3897.890) [-3885.197] (-3884.302) (-3886.331) * [-3884.030] (-3887.126) (-3889.094) (-3891.401) -- 0:01:27 691000 -- (-3886.625) (-3890.668) [-3884.528] (-3884.032) * [-3880.129] (-3886.669) (-3891.489) (-3887.563) -- 0:01:27 691500 -- (-3880.808) [-3882.185] (-3884.126) (-3882.299) * (-3888.406) (-3888.746) [-3884.974] (-3885.825) -- 0:01:27 692000 -- (-3885.926) (-3884.690) (-3883.156) [-3881.425] * (-3890.874) (-3884.880) (-3883.762) [-3893.163] -- 0:01:27 692500 -- (-3882.962) (-3886.213) [-3880.868] (-3888.093) * (-3887.251) [-3881.978] (-3884.534) (-3890.622) -- 0:01:27 693000 -- (-3888.779) (-3885.630) [-3884.902] (-3886.580) * [-3887.199] (-3888.554) (-3885.413) (-3882.902) -- 0:01:26 693500 -- (-3887.090) (-3896.135) [-3881.195] (-3887.570) * (-3888.467) (-3890.593) (-3884.924) [-3881.896] -- 0:01:27 694000 -- (-3889.367) [-3883.333] (-3885.303) (-3888.884) * (-3878.636) (-3889.034) (-3879.642) [-3881.861] -- 0:01:26 694500 -- (-3887.606) [-3883.336] (-3888.203) (-3883.127) * (-3885.552) [-3880.732] (-3883.982) (-3892.727) -- 0:01:26 695000 -- (-3885.358) [-3884.198] (-3884.509) (-3884.737) * (-3895.751) (-3882.932) (-3886.456) [-3891.194] -- 0:01:26 Average standard deviation of split frequencies: 0.000000 695500 -- (-3888.969) (-3891.498) (-3894.442) [-3892.899] * (-3889.585) [-3881.971] (-3889.855) (-3885.036) -- 0:01:26 696000 -- (-3889.618) (-3883.607) (-3887.073) [-3889.686] * (-3887.373) (-3881.642) (-3888.272) [-3888.179] -- 0:01:26 696500 -- (-3883.461) (-3888.828) [-3887.069] (-3884.978) * (-3880.943) (-3881.860) (-3884.581) [-3879.741] -- 0:01:25 697000 -- [-3885.465] (-3880.866) (-3888.798) (-3883.535) * [-3888.516] (-3884.049) (-3886.885) (-3890.034) -- 0:01:26 697500 -- (-3885.476) (-3886.400) [-3881.771] (-3887.075) * (-3887.089) (-3892.441) [-3882.797] (-3893.613) -- 0:01:25 698000 -- (-3889.164) (-3883.431) (-3885.004) [-3885.330] * (-3883.752) [-3882.808] (-3885.051) (-3882.073) -- 0:01:25 698500 -- (-3885.260) (-3886.130) [-3887.247] (-3887.014) * [-3881.448] (-3885.534) (-3891.730) (-3892.908) -- 0:01:25 699000 -- (-3888.923) (-3887.510) (-3888.453) [-3883.775] * (-3889.200) (-3882.286) (-3883.944) [-3886.052] -- 0:01:25 699500 -- [-3885.913] (-3888.812) (-3898.251) (-3888.078) * [-3886.023] (-3880.854) (-3884.458) (-3889.379) -- 0:01:25 700000 -- (-3884.239) [-3883.489] (-3888.284) (-3879.816) * (-3881.808) [-3882.856] (-3887.091) (-3883.281) -- 0:01:24 Average standard deviation of split frequencies: 0.000000 700500 -- (-3881.454) (-3891.352) (-3886.209) [-3880.565] * (-3884.895) (-3888.183) [-3888.785] (-3883.716) -- 0:01:25 701000 -- [-3881.605] (-3892.858) (-3886.971) (-3882.752) * (-3885.065) (-3883.035) (-3887.033) [-3888.412] -- 0:01:24 701500 -- [-3884.834] (-3892.744) (-3884.367) (-3889.217) * (-3891.143) (-3888.924) [-3889.986] (-3887.394) -- 0:01:24 702000 -- [-3885.226] (-3886.496) (-3893.268) (-3895.808) * [-3886.086] (-3887.852) (-3891.196) (-3889.502) -- 0:01:24 702500 -- (-3884.526) [-3882.321] (-3894.951) (-3891.857) * (-3881.463) [-3888.232] (-3886.452) (-3889.074) -- 0:01:24 703000 -- (-3880.593) (-3899.522) [-3885.594] (-3886.687) * (-3882.026) (-3888.785) (-3882.907) [-3885.276] -- 0:01:24 703500 -- (-3880.234) [-3891.468] (-3884.211) (-3890.805) * (-3883.521) (-3889.069) [-3882.041] (-3884.275) -- 0:01:23 704000 -- (-3882.248) (-3884.093) [-3886.526] (-3887.644) * (-3885.969) (-3891.832) [-3886.427] (-3887.206) -- 0:01:24 704500 -- [-3887.344] (-3884.202) (-3881.880) (-3887.998) * (-3883.920) (-3883.356) [-3885.330] (-3891.005) -- 0:01:23 705000 -- (-3884.198) (-3887.206) (-3883.408) [-3888.938] * (-3883.095) (-3884.546) [-3886.681] (-3892.299) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 705500 -- (-3883.444) (-3885.524) (-3888.288) [-3889.869] * (-3881.143) (-3894.167) (-3888.947) [-3883.826] -- 0:01:23 706000 -- (-3884.107) (-3888.258) (-3886.234) [-3881.310] * [-3882.775] (-3889.856) (-3885.625) (-3883.735) -- 0:01:23 706500 -- (-3884.428) (-3887.249) [-3884.519] (-3886.410) * (-3881.916) (-3883.361) [-3883.460] (-3886.931) -- 0:01:23 707000 -- (-3878.702) (-3887.270) [-3882.001] (-3882.174) * (-3884.262) (-3886.486) [-3881.940] (-3890.408) -- 0:01:22 707500 -- (-3886.074) [-3882.271] (-3891.367) (-3893.402) * (-3882.749) [-3883.828] (-3884.722) (-3881.405) -- 0:01:23 708000 -- (-3889.006) (-3889.542) (-3884.394) [-3889.654] * [-3882.315] (-3888.490) (-3887.451) (-3885.331) -- 0:01:22 708500 -- (-3889.716) (-3895.352) [-3883.959] (-3893.257) * (-3886.782) (-3888.874) [-3884.565] (-3885.053) -- 0:01:22 709000 -- (-3888.691) (-3888.443) [-3886.351] (-3890.523) * (-3889.580) (-3886.886) [-3884.866] (-3884.588) -- 0:01:22 709500 -- (-3886.097) [-3885.004] (-3886.392) (-3890.597) * (-3882.233) (-3888.236) (-3885.738) [-3881.052] -- 0:01:22 710000 -- (-3885.726) [-3886.843] (-3888.837) (-3892.961) * (-3888.231) (-3893.604) [-3884.953] (-3890.492) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 710500 -- (-3889.937) [-3893.642] (-3887.456) (-3889.040) * (-3884.789) (-3883.100) [-3883.341] (-3886.319) -- 0:01:21 711000 -- (-3887.639) (-3892.170) (-3885.483) [-3889.546] * (-3887.190) (-3892.300) [-3884.394] (-3888.284) -- 0:01:22 711500 -- (-3889.063) (-3888.058) [-3885.276] (-3883.722) * (-3883.947) [-3887.518] (-3880.039) (-3882.912) -- 0:01:21 712000 -- (-3896.986) (-3889.229) [-3881.402] (-3882.003) * (-3886.087) [-3887.603] (-3881.021) (-3891.639) -- 0:01:21 712500 -- (-3885.868) (-3888.357) (-3884.458) [-3883.059] * (-3885.954) [-3880.061] (-3889.570) (-3885.957) -- 0:01:21 713000 -- (-3887.691) (-3887.197) [-3882.887] (-3884.939) * (-3883.555) (-3886.988) [-3884.127] (-3882.315) -- 0:01:21 713500 -- [-3886.019] (-3887.552) (-3885.978) (-3882.818) * (-3889.720) (-3887.451) [-3886.476] (-3889.168) -- 0:01:21 714000 -- (-3887.752) (-3883.266) [-3884.546] (-3885.628) * (-3885.140) (-3891.113) (-3887.948) [-3891.093] -- 0:01:20 714500 -- [-3881.201] (-3881.962) (-3896.575) (-3885.255) * (-3886.540) (-3890.417) (-3884.323) [-3887.637] -- 0:01:21 715000 -- (-3883.162) (-3886.321) [-3886.112] (-3884.371) * (-3882.340) (-3885.095) [-3886.377] (-3885.936) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 715500 -- (-3887.319) (-3885.695) [-3884.790] (-3882.763) * (-3881.552) (-3881.073) [-3884.463] (-3890.094) -- 0:01:20 716000 -- (-3887.124) [-3883.882] (-3885.775) (-3883.634) * (-3883.748) (-3879.105) (-3886.632) [-3883.578] -- 0:01:20 716500 -- (-3886.670) (-3888.346) (-3887.219) [-3886.004] * (-3880.697) (-3883.518) [-3884.661] (-3884.564) -- 0:01:20 717000 -- (-3888.316) (-3885.873) [-3883.144] (-3881.687) * (-3889.116) [-3884.077] (-3889.026) (-3886.645) -- 0:01:20 717500 -- (-3884.220) [-3891.875] (-3882.925) (-3883.534) * (-3887.059) (-3884.443) (-3882.368) [-3886.232] -- 0:01:19 718000 -- (-3885.673) (-3890.581) [-3882.715] (-3882.176) * [-3892.964] (-3893.507) (-3886.460) (-3887.735) -- 0:01:20 718500 -- (-3885.204) (-3881.185) (-3886.108) [-3880.161] * (-3885.947) (-3888.185) (-3888.869) [-3886.241] -- 0:01:19 719000 -- (-3893.317) (-3893.383) [-3884.561] (-3888.145) * (-3888.315) [-3882.383] (-3888.156) (-3889.545) -- 0:01:19 719500 -- (-3886.162) (-3893.762) [-3882.834] (-3879.777) * (-3895.159) (-3886.982) [-3887.242] (-3888.626) -- 0:01:19 720000 -- (-3888.539) (-3887.279) [-3883.405] (-3880.905) * [-3889.231] (-3886.367) (-3883.915) (-3888.337) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 720500 -- (-3884.145) [-3887.945] (-3884.256) (-3884.873) * (-3884.605) [-3887.968] (-3883.192) (-3884.800) -- 0:01:19 721000 -- (-3884.845) [-3884.181] (-3885.190) (-3884.485) * (-3887.788) (-3882.335) [-3885.165] (-3888.301) -- 0:01:18 721500 -- (-3885.601) (-3882.498) (-3883.509) [-3880.756] * (-3892.088) (-3881.705) [-3884.288] (-3887.408) -- 0:01:19 722000 -- (-3882.748) [-3882.131] (-3890.042) (-3883.773) * (-3883.966) (-3888.782) [-3882.466] (-3889.391) -- 0:01:18 722500 -- (-3886.187) (-3886.679) (-3895.763) [-3882.952] * (-3882.772) (-3884.628) [-3882.527] (-3885.158) -- 0:01:18 723000 -- (-3890.425) (-3888.886) (-3886.225) [-3882.871] * [-3884.749] (-3887.335) (-3888.530) (-3881.277) -- 0:01:18 723500 -- [-3883.095] (-3894.924) (-3888.447) (-3884.776) * [-3880.623] (-3882.333) (-3884.862) (-3883.227) -- 0:01:18 724000 -- (-3886.017) (-3894.366) [-3884.670] (-3886.344) * (-3885.745) (-3884.078) [-3884.276] (-3895.340) -- 0:01:18 724500 -- (-3889.535) [-3885.304] (-3885.417) (-3886.722) * (-3881.830) (-3885.608) [-3888.993] (-3887.522) -- 0:01:17 725000 -- (-3890.714) (-3883.796) [-3881.792] (-3886.528) * (-3881.299) (-3883.903) [-3882.686] (-3888.845) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 725500 -- (-3887.890) (-3885.954) [-3888.125] (-3892.954) * (-3882.247) (-3888.219) (-3886.909) [-3884.358] -- 0:01:17 726000 -- [-3886.814] (-3889.765) (-3887.566) (-3890.023) * [-3885.600] (-3889.149) (-3889.036) (-3881.475) -- 0:01:17 726500 -- (-3886.041) (-3882.202) [-3886.300] (-3887.001) * (-3885.690) [-3883.663] (-3890.706) (-3881.691) -- 0:01:17 727000 -- (-3880.593) [-3886.434] (-3885.959) (-3888.632) * [-3883.754] (-3890.197) (-3886.981) (-3889.543) -- 0:01:17 727500 -- [-3883.957] (-3893.962) (-3890.298) (-3884.278) * [-3883.196] (-3887.540) (-3886.536) (-3887.618) -- 0:01:17 728000 -- (-3882.551) (-3890.575) (-3894.770) [-3880.963] * [-3890.649] (-3892.615) (-3886.330) (-3891.914) -- 0:01:16 728500 -- (-3882.585) (-3888.580) [-3885.307] (-3883.169) * (-3887.420) (-3881.651) [-3891.295] (-3889.268) -- 0:01:17 729000 -- (-3886.964) (-3887.437) [-3883.356] (-3887.493) * [-3887.309] (-3888.876) (-3885.444) (-3883.579) -- 0:01:16 729500 -- (-3880.326) (-3890.100) (-3892.321) [-3886.108] * (-3883.261) [-3883.501] (-3884.376) (-3889.326) -- 0:01:16 730000 -- (-3881.240) (-3890.264) [-3889.823] (-3893.626) * (-3890.103) [-3888.550] (-3882.627) (-3880.931) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 730500 -- [-3883.341] (-3890.681) (-3890.103) (-3888.071) * (-3888.774) (-3887.858) [-3882.396] (-3883.740) -- 0:01:16 731000 -- (-3886.923) (-3889.065) (-3884.589) [-3883.762] * [-3888.434] (-3881.286) (-3891.868) (-3887.060) -- 0:01:16 731500 -- (-3890.207) (-3887.546) [-3883.637] (-3884.438) * (-3889.651) (-3881.038) (-3901.615) [-3880.239] -- 0:01:15 732000 -- (-3882.808) (-3881.071) (-3884.829) [-3885.426] * (-3891.788) (-3882.438) (-3890.071) [-3881.852] -- 0:01:16 732500 -- (-3887.125) [-3882.434] (-3881.338) (-3888.675) * (-3883.302) [-3892.810] (-3884.710) (-3881.859) -- 0:01:15 733000 -- [-3881.166] (-3884.414) (-3885.502) (-3889.121) * (-3885.187) (-3885.967) (-3884.538) [-3887.050] -- 0:01:15 733500 -- (-3885.045) [-3884.036] (-3882.710) (-3889.445) * (-3886.006) (-3892.204) (-3883.043) [-3885.232] -- 0:01:15 734000 -- (-3884.492) (-3884.016) (-3884.358) [-3886.343] * (-3883.528) (-3891.939) [-3883.099] (-3889.155) -- 0:01:15 734500 -- (-3882.040) [-3882.456] (-3886.333) (-3886.568) * (-3894.835) [-3889.029] (-3882.466) (-3887.126) -- 0:01:15 735000 -- (-3881.939) (-3888.621) (-3884.114) [-3888.857] * (-3890.252) (-3886.042) [-3879.124] (-3887.345) -- 0:01:14 Average standard deviation of split frequencies: 0.000000 735500 -- (-3880.493) [-3886.374] (-3883.063) (-3899.626) * (-3892.812) (-3884.538) [-3881.732] (-3893.058) -- 0:01:15 736000 -- (-3881.235) (-3883.086) [-3881.079] (-3889.660) * (-3883.978) (-3885.490) [-3884.523] (-3890.021) -- 0:01:14 736500 -- (-3885.735) [-3882.432] (-3882.009) (-3889.057) * [-3887.437] (-3881.914) (-3880.712) (-3886.601) -- 0:01:14 737000 -- (-3881.374) [-3884.685] (-3886.343) (-3887.813) * (-3882.457) (-3886.946) (-3885.252) [-3884.744] -- 0:01:14 737500 -- (-3882.977) (-3888.509) (-3885.170) [-3885.603] * (-3882.301) [-3884.169] (-3886.471) (-3890.068) -- 0:01:14 738000 -- (-3886.058) (-3882.037) (-3892.906) [-3886.053] * (-3885.000) [-3889.127] (-3887.938) (-3886.931) -- 0:01:14 738500 -- [-3886.127] (-3884.817) (-3891.976) (-3884.140) * (-3890.794) [-3881.526] (-3883.953) (-3891.853) -- 0:01:14 739000 -- [-3887.402] (-3882.129) (-3885.242) (-3885.660) * (-3884.067) [-3881.854] (-3883.190) (-3887.015) -- 0:01:13 739500 -- [-3883.156] (-3884.273) (-3884.213) (-3883.045) * [-3887.475] (-3888.568) (-3886.357) (-3884.643) -- 0:01:13 740000 -- (-3886.535) (-3886.679) (-3885.786) [-3890.733] * (-3882.720) (-3889.736) [-3883.288] (-3880.672) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 740500 -- (-3880.768) [-3888.699] (-3882.285) (-3883.882) * (-3882.972) (-3887.002) (-3884.559) [-3884.762] -- 0:01:13 741000 -- (-3885.998) [-3883.223] (-3889.072) (-3884.522) * (-3885.332) (-3886.022) (-3879.485) [-3880.461] -- 0:01:13 741500 -- [-3883.693] (-3891.041) (-3878.812) (-3881.481) * (-3888.929) (-3880.871) (-3885.513) [-3883.772] -- 0:01:13 742000 -- (-3897.785) (-3885.175) [-3885.110] (-3883.679) * (-3885.012) (-3884.218) (-3883.143) [-3889.551] -- 0:01:13 742500 -- (-3891.309) [-3886.685] (-3887.262) (-3890.683) * [-3891.061] (-3887.162) (-3884.911) (-3889.785) -- 0:01:12 743000 -- (-3895.221) [-3884.704] (-3892.108) (-3886.654) * (-3889.591) [-3885.382] (-3883.830) (-3890.026) -- 0:01:12 743500 -- [-3882.396] (-3892.485) (-3886.947) (-3889.599) * (-3889.088) [-3889.306] (-3880.687) (-3888.801) -- 0:01:12 744000 -- (-3888.317) [-3886.184] (-3892.194) (-3882.145) * (-3886.175) (-3882.704) [-3880.002] (-3888.318) -- 0:01:12 744500 -- (-3883.505) (-3886.488) (-3885.123) [-3886.619] * [-3883.946] (-3883.105) (-3883.437) (-3888.891) -- 0:01:12 745000 -- (-3881.281) (-3885.077) (-3880.154) [-3886.439] * [-3883.074] (-3884.505) (-3889.409) (-3879.390) -- 0:01:12 Average standard deviation of split frequencies: 0.000000 745500 -- (-3891.847) (-3882.801) (-3891.525) [-3884.559] * (-3882.711) (-3887.088) [-3885.034] (-3886.504) -- 0:01:12 746000 -- [-3884.939] (-3883.342) (-3886.716) (-3889.986) * (-3882.687) (-3889.985) (-3892.895) [-3888.987] -- 0:01:11 746500 -- (-3884.491) (-3894.045) (-3888.713) [-3890.700] * [-3879.662] (-3887.043) (-3893.904) (-3886.718) -- 0:01:11 747000 -- (-3883.969) [-3892.663] (-3885.475) (-3889.929) * (-3883.622) (-3885.521) (-3885.810) [-3889.308] -- 0:01:11 747500 -- (-3884.100) [-3885.968] (-3889.310) (-3888.384) * [-3885.540] (-3888.873) (-3890.439) (-3886.112) -- 0:01:11 748000 -- (-3887.196) (-3890.655) (-3890.251) [-3888.004] * (-3886.576) (-3881.765) (-3889.015) [-3884.109] -- 0:01:11 748500 -- (-3887.792) [-3883.195] (-3889.843) (-3888.476) * [-3882.314] (-3880.696) (-3889.774) (-3898.763) -- 0:01:11 749000 -- (-3888.189) (-3882.384) (-3880.002) [-3884.633] * [-3882.016] (-3880.522) (-3885.707) (-3883.835) -- 0:01:11 749500 -- (-3886.618) (-3883.672) [-3881.343] (-3887.765) * (-3884.647) (-3882.663) [-3888.354] (-3888.674) -- 0:01:10 750000 -- (-3882.723) (-3886.218) (-3889.627) [-3886.058] * [-3886.059] (-3890.198) (-3890.289) (-3886.736) -- 0:01:11 Average standard deviation of split frequencies: 0.000000 750500 -- (-3886.177) (-3890.782) [-3885.171] (-3883.009) * (-3897.650) [-3887.433] (-3883.343) (-3881.804) -- 0:01:10 751000 -- (-3887.257) [-3886.481] (-3888.581) (-3884.042) * [-3889.474] (-3888.605) (-3884.831) (-3888.935) -- 0:01:10 751500 -- (-3890.580) (-3883.773) (-3887.051) [-3886.324] * (-3887.663) [-3883.094] (-3889.505) (-3889.653) -- 0:01:10 752000 -- (-3890.974) (-3889.471) [-3884.996] (-3885.787) * (-3885.108) [-3886.932] (-3886.536) (-3886.676) -- 0:01:10 752500 -- (-3885.375) (-3884.303) [-3883.478] (-3890.036) * [-3885.357] (-3886.466) (-3896.892) (-3886.355) -- 0:01:10 753000 -- (-3882.331) [-3884.160] (-3882.316) (-3887.308) * (-3888.026) (-3884.150) [-3892.227] (-3883.778) -- 0:01:09 753500 -- (-3885.940) [-3883.000] (-3899.889) (-3890.525) * [-3885.621] (-3883.765) (-3881.407) (-3892.473) -- 0:01:10 754000 -- (-3892.459) [-3885.047] (-3882.105) (-3884.535) * [-3886.950] (-3884.883) (-3885.678) (-3881.907) -- 0:01:09 754500 -- (-3888.306) (-3882.091) [-3883.952] (-3887.562) * [-3885.806] (-3886.560) (-3886.061) (-3885.907) -- 0:01:09 755000 -- (-3895.460) (-3882.155) (-3887.985) [-3883.382] * (-3886.027) (-3883.869) (-3884.899) [-3882.166] -- 0:01:09 Average standard deviation of split frequencies: 0.000000 755500 -- [-3883.377] (-3889.144) (-3884.545) (-3884.393) * (-3883.534) (-3884.878) (-3888.981) [-3887.541] -- 0:01:09 756000 -- (-3880.246) (-3881.733) (-3884.683) [-3884.061] * (-3885.258) (-3887.546) [-3887.284] (-3885.224) -- 0:01:09 756500 -- (-3883.462) (-3884.430) (-3885.943) [-3885.809] * (-3882.251) (-3889.639) [-3880.949] (-3884.322) -- 0:01:08 757000 -- [-3883.557] (-3882.161) (-3891.506) (-3885.614) * [-3883.553] (-3887.022) (-3892.223) (-3885.011) -- 0:01:09 757500 -- (-3884.925) [-3884.894] (-3884.888) (-3888.441) * (-3891.017) (-3884.535) [-3887.881] (-3886.542) -- 0:01:08 758000 -- (-3884.819) (-3887.933) [-3886.073] (-3881.140) * (-3888.018) [-3887.190] (-3886.040) (-3884.667) -- 0:01:08 758500 -- (-3888.251) [-3891.514] (-3884.902) (-3882.505) * (-3885.783) (-3891.875) (-3885.309) [-3882.690] -- 0:01:08 759000 -- (-3884.982) (-3891.122) [-3881.705] (-3891.245) * [-3882.478] (-3886.663) (-3890.500) (-3889.421) -- 0:01:08 759500 -- [-3884.463] (-3883.043) (-3886.766) (-3887.411) * (-3883.938) [-3884.992] (-3886.844) (-3886.411) -- 0:01:08 760000 -- [-3884.406] (-3882.141) (-3884.824) (-3887.948) * (-3887.207) (-3882.156) (-3883.933) [-3882.687] -- 0:01:07 Average standard deviation of split frequencies: 0.000000 760500 -- (-3886.783) (-3884.750) (-3887.986) [-3886.974] * [-3885.743] (-3878.078) (-3887.948) (-3887.674) -- 0:01:08 761000 -- (-3889.878) (-3881.126) [-3883.495] (-3887.937) * (-3886.733) (-3885.645) (-3888.340) [-3888.685] -- 0:01:07 761500 -- (-3891.577) [-3885.386] (-3881.486) (-3884.226) * (-3886.772) [-3885.874] (-3892.014) (-3890.414) -- 0:01:07 762000 -- (-3879.484) (-3882.360) [-3886.064] (-3892.031) * (-3891.171) [-3885.166] (-3886.991) (-3895.224) -- 0:01:07 762500 -- [-3883.286] (-3886.120) (-3885.137) (-3886.298) * (-3887.636) (-3884.282) [-3886.909] (-3883.460) -- 0:01:07 763000 -- (-3886.181) (-3885.151) [-3889.103] (-3886.512) * (-3890.338) [-3888.743] (-3881.412) (-3887.652) -- 0:01:07 763500 -- (-3888.066) (-3888.065) (-3885.856) [-3885.858] * [-3892.660] (-3885.862) (-3890.957) (-3893.935) -- 0:01:06 764000 -- (-3884.584) [-3882.228] (-3891.823) (-3884.547) * (-3890.558) (-3881.401) [-3882.141] (-3889.171) -- 0:01:07 764500 -- (-3883.562) (-3882.429) [-3884.054] (-3882.343) * [-3881.602] (-3884.502) (-3882.516) (-3888.831) -- 0:01:06 765000 -- (-3884.871) (-3887.917) (-3886.534) [-3886.378] * (-3893.877) (-3882.816) [-3886.717] (-3889.284) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 765500 -- [-3884.586] (-3886.347) (-3884.876) (-3886.042) * (-3887.027) (-3881.724) [-3883.849] (-3886.894) -- 0:01:06 766000 -- (-3881.912) (-3893.134) [-3882.271] (-3890.878) * (-3884.235) (-3890.486) (-3885.101) [-3885.027] -- 0:01:06 766500 -- [-3884.118] (-3888.445) (-3885.586) (-3892.678) * (-3883.026) (-3888.406) (-3883.495) [-3882.903] -- 0:01:06 767000 -- (-3881.867) (-3887.861) [-3880.720] (-3888.397) * (-3885.599) (-3884.714) (-3885.545) [-3885.439] -- 0:01:05 767500 -- (-3888.357) (-3887.066) (-3888.085) [-3879.204] * (-3884.603) (-3882.077) (-3883.653) [-3885.750] -- 0:01:06 768000 -- [-3883.406] (-3885.720) (-3885.056) (-3883.086) * (-3881.044) (-3883.197) [-3886.833] (-3885.237) -- 0:01:05 768500 -- (-3891.637) (-3884.588) [-3885.147] (-3880.467) * (-3887.301) (-3879.408) (-3884.326) [-3882.677] -- 0:01:05 769000 -- (-3884.303) (-3882.559) (-3883.653) [-3886.954] * (-3890.609) [-3883.628] (-3883.513) (-3887.130) -- 0:01:05 769500 -- (-3888.252) (-3890.773) (-3886.753) [-3889.636] * [-3884.975] (-3883.023) (-3884.931) (-3883.735) -- 0:01:05 770000 -- (-3883.531) [-3886.260] (-3893.340) (-3882.123) * [-3881.887] (-3883.475) (-3888.352) (-3889.592) -- 0:01:05 Average standard deviation of split frequencies: 0.000000 770500 -- [-3882.980] (-3881.148) (-3880.666) (-3891.932) * [-3879.540] (-3883.658) (-3890.197) (-3886.206) -- 0:01:04 771000 -- (-3881.283) (-3883.800) (-3885.622) [-3884.769] * (-3882.972) (-3886.758) (-3884.815) [-3886.653] -- 0:01:05 771500 -- (-3887.939) (-3886.966) [-3886.964] (-3884.213) * (-3887.312) [-3883.786] (-3893.816) (-3885.064) -- 0:01:04 772000 -- (-3884.601) [-3885.909] (-3886.720) (-3885.849) * (-3888.272) (-3885.863) [-3887.952] (-3888.827) -- 0:01:04 772500 -- (-3886.490) [-3882.746] (-3889.910) (-3885.688) * (-3891.511) (-3879.334) [-3882.962] (-3888.346) -- 0:01:04 773000 -- (-3888.436) [-3881.531] (-3885.140) (-3888.566) * [-3887.028] (-3892.724) (-3891.103) (-3886.380) -- 0:01:04 773500 -- [-3890.289] (-3890.279) (-3887.933) (-3889.086) * (-3886.263) (-3886.902) [-3881.803] (-3884.399) -- 0:01:04 774000 -- (-3885.507) [-3879.379] (-3881.889) (-3881.373) * (-3884.368) (-3886.040) (-3885.555) [-3882.497] -- 0:01:03 774500 -- (-3883.596) (-3885.012) (-3882.735) [-3883.108] * [-3883.311] (-3882.228) (-3887.132) (-3881.105) -- 0:01:04 775000 -- (-3893.789) (-3885.822) (-3884.266) [-3881.807] * [-3885.540] (-3886.332) (-3886.432) (-3882.189) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 775500 -- [-3885.713] (-3889.210) (-3883.539) (-3887.096) * (-3890.310) (-3883.304) (-3880.738) [-3880.736] -- 0:01:03 776000 -- (-3881.906) (-3890.086) (-3887.853) [-3883.535] * (-3885.648) (-3882.312) (-3887.471) [-3887.939] -- 0:01:03 776500 -- (-3884.398) (-3885.431) [-3882.035] (-3882.965) * (-3883.652) (-3884.725) (-3882.422) [-3886.704] -- 0:01:03 777000 -- (-3885.867) (-3891.930) (-3885.367) [-3883.563] * (-3892.802) [-3887.158] (-3886.414) (-3890.945) -- 0:01:03 777500 -- (-3894.653) (-3886.405) [-3884.178] (-3897.360) * [-3886.408] (-3889.231) (-3886.950) (-3885.578) -- 0:01:02 778000 -- (-3884.303) [-3885.979] (-3885.286) (-3882.356) * (-3892.749) (-3895.122) [-3887.742] (-3887.341) -- 0:01:03 778500 -- (-3882.192) [-3886.890] (-3887.108) (-3884.506) * [-3882.432] (-3884.723) (-3890.328) (-3886.861) -- 0:01:02 779000 -- (-3887.425) [-3888.120] (-3884.834) (-3883.081) * [-3882.841] (-3890.461) (-3886.382) (-3880.466) -- 0:01:02 779500 -- (-3884.499) (-3884.014) (-3882.036) [-3881.720] * (-3884.390) (-3885.366) [-3885.098] (-3885.275) -- 0:01:02 780000 -- (-3886.980) [-3886.076] (-3882.091) (-3882.648) * (-3884.483) (-3882.920) (-3885.233) [-3883.980] -- 0:01:02 Average standard deviation of split frequencies: 0.000000 780500 -- (-3885.835) (-3886.084) [-3885.284] (-3885.565) * [-3886.712] (-3888.373) (-3887.247) (-3889.828) -- 0:01:02 781000 -- (-3886.029) (-3884.355) (-3879.867) [-3880.753] * (-3888.655) (-3887.007) (-3888.641) [-3884.485] -- 0:01:01 781500 -- (-3888.078) (-3881.062) (-3884.950) [-3880.986] * [-3884.316] (-3887.733) (-3886.339) (-3888.113) -- 0:01:02 782000 -- (-3887.940) (-3881.553) [-3887.966] (-3886.176) * (-3889.474) (-3884.286) (-3882.683) [-3884.557] -- 0:01:01 782500 -- (-3888.744) (-3882.006) (-3893.591) [-3884.445] * (-3887.088) (-3883.031) [-3883.394] (-3883.155) -- 0:01:01 783000 -- [-3881.803] (-3884.530) (-3883.381) (-3881.702) * (-3884.572) (-3884.331) (-3883.005) [-3881.193] -- 0:01:01 783500 -- (-3882.144) [-3886.696] (-3886.128) (-3889.036) * (-3890.508) (-3886.992) (-3884.452) [-3882.745] -- 0:01:01 784000 -- (-3880.464) (-3888.929) [-3887.331] (-3886.541) * (-3885.659) (-3887.839) [-3882.153] (-3883.855) -- 0:01:01 784500 -- (-3888.540) (-3886.341) [-3882.081] (-3885.229) * (-3888.786) (-3885.002) [-3885.285] (-3884.603) -- 0:01:00 785000 -- (-3884.050) [-3888.358] (-3885.511) (-3890.755) * (-3883.071) (-3890.577) [-3881.573] (-3883.183) -- 0:01:00 Average standard deviation of split frequencies: 0.000000 785500 -- [-3886.217] (-3884.471) (-3882.495) (-3881.639) * (-3885.229) (-3883.786) (-3894.174) [-3881.516] -- 0:01:00 786000 -- (-3885.783) (-3883.177) (-3889.920) [-3881.820] * (-3889.950) (-3888.232) [-3886.223] (-3885.356) -- 0:01:00 786500 -- (-3885.312) [-3888.415] (-3889.014) (-3884.055) * (-3882.801) (-3884.857) [-3887.513] (-3888.638) -- 0:01:00 787000 -- (-3888.177) [-3886.073] (-3883.844) (-3886.291) * [-3885.114] (-3888.447) (-3884.895) (-3881.319) -- 0:01:00 787500 -- (-3883.442) [-3881.865] (-3889.305) (-3880.054) * (-3884.316) (-3888.032) (-3887.511) [-3882.292] -- 0:01:00 788000 -- (-3885.903) [-3884.579] (-3887.938) (-3886.162) * (-3884.268) (-3892.910) (-3887.619) [-3887.427] -- 0:00:59 788500 -- (-3884.764) (-3882.181) [-3882.554] (-3883.903) * [-3882.248] (-3886.796) (-3896.456) (-3884.153) -- 0:00:59 789000 -- [-3883.414] (-3882.896) (-3882.253) (-3885.930) * (-3882.162) (-3891.316) (-3889.499) [-3889.396] -- 0:00:59 789500 -- [-3882.594] (-3881.824) (-3885.011) (-3888.053) * [-3892.460] (-3885.551) (-3892.161) (-3882.119) -- 0:00:59 790000 -- (-3887.303) (-3883.055) (-3883.080) [-3888.549] * (-3888.870) [-3884.857] (-3881.130) (-3880.329) -- 0:00:59 Average standard deviation of split frequencies: 0.000000 790500 -- [-3887.562] (-3882.762) (-3887.337) (-3883.188) * [-3890.799] (-3884.715) (-3886.544) (-3892.010) -- 0:00:59 791000 -- (-3885.365) (-3884.105) [-3886.648] (-3886.830) * (-3883.656) [-3885.833] (-3885.515) (-3897.102) -- 0:00:59 791500 -- [-3885.161] (-3884.514) (-3884.287) (-3881.096) * (-3889.515) (-3881.962) [-3882.257] (-3884.882) -- 0:00:59 792000 -- (-3883.295) (-3889.288) [-3884.175] (-3881.762) * (-3885.940) (-3882.888) [-3885.088] (-3892.353) -- 0:00:58 792500 -- (-3887.355) [-3881.366] (-3882.162) (-3884.714) * (-3883.926) [-3885.234] (-3882.999) (-3883.050) -- 0:00:58 793000 -- (-3886.842) (-3887.931) (-3882.377) [-3884.977] * (-3883.605) (-3886.832) [-3881.189] (-3895.699) -- 0:00:58 793500 -- [-3888.758] (-3882.995) (-3885.498) (-3881.862) * (-3886.635) (-3884.459) [-3888.717] (-3885.425) -- 0:00:58 794000 -- (-3880.578) [-3888.175] (-3882.795) (-3884.611) * (-3882.727) (-3886.279) (-3884.926) [-3883.809] -- 0:00:58 794500 -- (-3881.995) (-3883.982) (-3889.300) [-3882.165] * [-3880.820] (-3883.665) (-3886.611) (-3887.198) -- 0:00:58 795000 -- (-3884.433) [-3884.347] (-3882.699) (-3886.108) * (-3887.636) (-3889.282) (-3886.898) [-3881.926] -- 0:00:58 Average standard deviation of split frequencies: 0.000000 795500 -- (-3883.068) (-3880.382) (-3881.573) [-3885.818] * (-3886.570) (-3888.653) (-3884.416) [-3885.145] -- 0:00:57 796000 -- (-3883.594) (-3882.291) [-3881.956] (-3879.671) * [-3882.073] (-3886.640) (-3886.823) (-3882.265) -- 0:00:57 796500 -- [-3880.595] (-3887.765) (-3884.976) (-3889.505) * (-3886.116) (-3883.102) (-3893.596) [-3887.155] -- 0:00:57 797000 -- (-3888.938) (-3882.786) (-3881.531) [-3878.970] * (-3885.063) (-3885.952) [-3887.460] (-3881.513) -- 0:00:57 797500 -- (-3884.260) (-3887.450) (-3882.948) [-3884.982] * (-3886.640) [-3880.965] (-3884.471) (-3886.133) -- 0:00:57 798000 -- (-3886.983) (-3892.389) (-3889.633) [-3884.399] * (-3886.815) (-3886.728) [-3883.139] (-3883.484) -- 0:00:57 798500 -- (-3890.994) (-3885.689) (-3889.441) [-3886.488] * (-3885.557) (-3885.066) (-3883.555) [-3891.195] -- 0:00:57 799000 -- (-3884.058) (-3886.157) (-3891.334) [-3887.651] * (-3889.396) (-3885.798) [-3882.989] (-3885.002) -- 0:00:56 799500 -- (-3885.737) (-3880.751) [-3884.159] (-3893.450) * [-3884.579] (-3884.725) (-3885.299) (-3888.317) -- 0:00:56 800000 -- [-3880.610] (-3881.331) (-3882.551) (-3892.119) * [-3883.052] (-3884.385) (-3891.113) (-3882.904) -- 0:00:56 Average standard deviation of split frequencies: 0.000000 800500 -- [-3882.456] (-3883.206) (-3886.711) (-3887.903) * (-3888.494) (-3884.256) [-3881.920] (-3884.309) -- 0:00:56 801000 -- (-3881.178) (-3880.619) (-3885.028) [-3880.091] * (-3888.452) (-3882.954) (-3881.427) [-3887.893] -- 0:00:56 801500 -- (-3885.101) [-3881.545] (-3885.181) (-3882.217) * (-3882.769) [-3883.225] (-3888.265) (-3886.766) -- 0:00:56 802000 -- (-3893.350) (-3887.356) (-3879.637) [-3881.575] * (-3887.163) [-3882.688] (-3888.151) (-3888.478) -- 0:00:56 802500 -- (-3887.205) (-3888.008) [-3880.794] (-3893.454) * (-3897.027) [-3881.919] (-3886.058) (-3885.800) -- 0:00:55 803000 -- (-3880.741) [-3886.714] (-3886.164) (-3895.393) * (-3883.079) [-3886.329] (-3880.503) (-3890.415) -- 0:00:55 803500 -- (-3883.380) [-3882.158] (-3887.351) (-3889.513) * (-3885.480) [-3885.507] (-3881.244) (-3882.677) -- 0:00:55 804000 -- (-3888.477) (-3884.140) (-3890.722) [-3883.428] * (-3892.267) [-3881.357] (-3884.571) (-3891.637) -- 0:00:55 804500 -- [-3885.861] (-3885.759) (-3882.320) (-3889.239) * (-3885.311) [-3886.325] (-3892.061) (-3897.103) -- 0:00:55 805000 -- [-3884.430] (-3885.372) (-3882.941) (-3888.576) * (-3888.241) (-3889.632) (-3882.165) [-3884.068] -- 0:00:55 Average standard deviation of split frequencies: 0.000000 805500 -- [-3882.073] (-3891.006) (-3883.986) (-3887.115) * (-3886.638) (-3892.476) [-3885.043] (-3881.215) -- 0:00:55 806000 -- [-3885.319] (-3884.472) (-3886.142) (-3892.742) * [-3885.619] (-3884.452) (-3886.442) (-3883.692) -- 0:00:54 806500 -- [-3883.528] (-3884.830) (-3888.028) (-3885.615) * (-3883.477) (-3887.085) [-3882.600] (-3882.242) -- 0:00:54 807000 -- [-3889.195] (-3879.928) (-3884.801) (-3895.178) * (-3884.000) (-3883.608) [-3884.221] (-3888.781) -- 0:00:54 807500 -- (-3888.563) (-3884.565) [-3886.724] (-3887.240) * [-3892.517] (-3882.531) (-3891.134) (-3884.732) -- 0:00:54 808000 -- (-3882.927) (-3886.218) [-3883.508] (-3889.037) * (-3883.129) (-3887.798) [-3887.799] (-3887.539) -- 0:00:54 808500 -- [-3883.793] (-3884.890) (-3885.994) (-3887.510) * (-3881.260) (-3885.215) (-3884.010) [-3883.081] -- 0:00:54 809000 -- (-3885.793) (-3886.102) [-3884.752] (-3891.553) * [-3883.619] (-3890.061) (-3885.521) (-3884.477) -- 0:00:54 809500 -- (-3882.544) [-3882.297] (-3882.176) (-3884.512) * [-3884.275] (-3891.154) (-3888.050) (-3884.466) -- 0:00:53 810000 -- (-3887.473) (-3886.128) [-3880.035] (-3894.196) * [-3886.092] (-3884.628) (-3888.340) (-3889.662) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 810500 -- (-3887.968) (-3881.258) (-3886.328) [-3887.089] * [-3885.546] (-3889.980) (-3884.960) (-3882.476) -- 0:00:53 811000 -- (-3883.627) [-3884.548] (-3889.777) (-3883.206) * (-3885.901) (-3888.161) (-3887.293) [-3882.298] -- 0:00:53 811500 -- (-3890.280) (-3893.164) [-3888.343] (-3892.254) * [-3885.620] (-3887.385) (-3887.083) (-3885.869) -- 0:00:53 812000 -- (-3887.443) [-3887.019] (-3885.898) (-3889.761) * (-3888.155) (-3886.052) [-3886.349] (-3887.434) -- 0:00:53 812500 -- [-3887.284] (-3883.945) (-3886.274) (-3882.817) * (-3884.247) (-3889.135) (-3880.649) [-3887.701] -- 0:00:53 813000 -- [-3882.996] (-3880.593) (-3884.914) (-3882.467) * [-3879.789] (-3888.326) (-3882.736) (-3885.644) -- 0:00:52 813500 -- [-3885.631] (-3886.520) (-3884.762) (-3884.572) * [-3882.093] (-3889.752) (-3884.524) (-3887.780) -- 0:00:52 814000 -- (-3885.963) (-3891.092) (-3886.815) [-3885.680] * (-3886.525) (-3892.344) [-3881.672] (-3888.129) -- 0:00:52 814500 -- (-3889.868) (-3881.275) (-3884.576) [-3879.276] * (-3886.926) (-3892.399) (-3892.948) [-3880.161] -- 0:00:52 815000 -- (-3883.232) (-3886.080) [-3881.502] (-3884.441) * (-3887.820) (-3886.840) (-3884.538) [-3882.469] -- 0:00:52 Average standard deviation of split frequencies: 0.000000 815500 -- (-3880.898) (-3888.219) (-3885.756) [-3886.679] * (-3885.523) [-3881.912] (-3886.973) (-3882.416) -- 0:00:52 816000 -- (-3897.581) (-3884.999) (-3894.611) [-3886.061] * (-3886.624) [-3886.364] (-3886.592) (-3881.951) -- 0:00:52 816500 -- (-3885.571) [-3881.726] (-3887.372) (-3883.291) * (-3884.743) (-3881.901) [-3886.210] (-3883.694) -- 0:00:51 817000 -- (-3885.661) (-3888.540) [-3885.246] (-3886.716) * (-3880.722) (-3890.128) (-3885.373) [-3883.605] -- 0:00:51 817500 -- (-3892.103) (-3894.311) [-3885.089] (-3885.808) * (-3883.923) (-3885.897) [-3883.956] (-3886.992) -- 0:00:51 818000 -- (-3893.999) [-3889.322] (-3882.282) (-3883.408) * (-3883.995) (-3886.320) [-3882.023] (-3886.643) -- 0:00:51 818500 -- (-3889.659) (-3886.795) [-3884.820] (-3893.119) * (-3884.648) [-3888.403] (-3887.627) (-3885.863) -- 0:00:51 819000 -- (-3892.988) [-3885.782] (-3884.868) (-3884.767) * [-3887.072] (-3890.796) (-3884.796) (-3884.119) -- 0:00:51 819500 -- [-3887.668] (-3885.785) (-3885.751) (-3885.872) * (-3884.674) (-3889.939) (-3889.332) [-3882.868] -- 0:00:51 820000 -- (-3886.834) (-3885.621) (-3882.293) [-3880.140] * (-3886.640) (-3885.591) (-3883.396) [-3886.220] -- 0:00:50 Average standard deviation of split frequencies: 0.000000 820500 -- (-3883.666) (-3888.965) (-3884.044) [-3882.387] * [-3884.113] (-3883.296) (-3885.259) (-3886.117) -- 0:00:50 821000 -- (-3892.436) (-3885.926) (-3883.486) [-3885.031] * (-3886.221) (-3892.910) (-3882.947) [-3880.511] -- 0:00:50 821500 -- (-3889.708) (-3888.745) [-3880.726] (-3895.266) * (-3885.068) (-3886.761) [-3881.887] (-3880.934) -- 0:00:50 822000 -- (-3881.882) (-3890.758) [-3884.742] (-3890.450) * (-3887.762) [-3885.943] (-3894.316) (-3882.599) -- 0:00:50 822500 -- [-3880.926] (-3888.545) (-3883.415) (-3887.369) * (-3893.131) [-3885.425] (-3888.012) (-3885.470) -- 0:00:50 823000 -- (-3884.784) (-3886.986) [-3888.194] (-3887.906) * [-3881.963] (-3886.507) (-3884.358) (-3889.471) -- 0:00:50 823500 -- (-3885.083) (-3892.321) (-3891.572) [-3883.761] * (-3886.914) (-3886.237) (-3884.619) [-3892.555] -- 0:00:49 824000 -- (-3888.493) (-3894.307) (-3889.107) [-3886.536] * (-3885.718) (-3888.645) [-3887.387] (-3887.846) -- 0:00:49 824500 -- [-3892.926] (-3887.300) (-3892.132) (-3890.886) * (-3879.981) [-3885.222] (-3884.799) (-3889.174) -- 0:00:49 825000 -- (-3888.461) [-3883.120] (-3891.018) (-3885.834) * (-3880.977) (-3885.453) (-3887.283) [-3883.295] -- 0:00:49 Average standard deviation of split frequencies: 0.000000 825500 -- (-3883.142) [-3884.067] (-3883.845) (-3889.819) * [-3888.447] (-3887.563) (-3883.565) (-3886.854) -- 0:00:49 826000 -- [-3884.430] (-3887.939) (-3887.112) (-3888.587) * [-3884.304] (-3882.642) (-3883.835) (-3885.810) -- 0:00:49 826500 -- (-3884.575) [-3886.952] (-3882.005) (-3887.567) * (-3884.026) (-3888.361) [-3886.720] (-3882.957) -- 0:00:49 827000 -- (-3887.705) (-3890.386) (-3883.061) [-3883.949] * [-3882.461] (-3887.344) (-3883.819) (-3888.559) -- 0:00:48 827500 -- (-3888.421) (-3889.684) [-3883.531] (-3882.933) * (-3880.304) (-3889.656) (-3886.528) [-3884.661] -- 0:00:48 828000 -- (-3887.522) [-3887.915] (-3880.062) (-3886.134) * (-3884.794) [-3885.882] (-3890.498) (-3891.623) -- 0:00:48 828500 -- [-3891.668] (-3897.660) (-3891.472) (-3889.834) * (-3883.581) [-3885.839] (-3886.522) (-3884.580) -- 0:00:48 829000 -- [-3890.909] (-3884.713) (-3889.466) (-3887.196) * (-3883.377) [-3884.716] (-3888.051) (-3884.332) -- 0:00:48 829500 -- (-3884.820) [-3885.350] (-3887.112) (-3887.604) * (-3886.622) (-3881.453) (-3890.930) [-3886.971] -- 0:00:48 830000 -- [-3883.007] (-3886.860) (-3885.730) (-3886.052) * [-3884.892] (-3893.270) (-3888.263) (-3883.963) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 830500 -- [-3882.886] (-3885.062) (-3887.075) (-3890.959) * (-3882.988) (-3888.564) (-3889.647) [-3887.644] -- 0:00:47 831000 -- [-3885.546] (-3886.441) (-3888.670) (-3887.463) * (-3881.216) (-3882.765) [-3886.126] (-3893.075) -- 0:00:47 831500 -- [-3885.518] (-3885.984) (-3887.900) (-3891.265) * (-3885.481) (-3886.715) [-3883.147] (-3896.028) -- 0:00:47 832000 -- (-3886.989) [-3884.526] (-3892.953) (-3883.332) * (-3884.985) (-3887.738) [-3882.314] (-3888.956) -- 0:00:47 832500 -- [-3881.682] (-3885.030) (-3886.635) (-3887.819) * (-3883.594) (-3890.077) (-3890.987) [-3879.769] -- 0:00:47 833000 -- (-3883.937) (-3884.957) (-3885.517) [-3888.862] * (-3881.727) [-3884.948] (-3884.144) (-3887.250) -- 0:00:47 833500 -- (-3887.694) (-3883.596) [-3889.133] (-3886.922) * (-3884.579) (-3890.522) (-3882.132) [-3883.907] -- 0:00:47 834000 -- (-3890.842) (-3891.232) (-3884.022) [-3881.785] * (-3879.527) (-3892.670) [-3883.643] (-3885.091) -- 0:00:46 834500 -- (-3885.181) (-3885.626) (-3889.070) [-3885.590] * (-3889.027) [-3892.063] (-3889.568) (-3886.201) -- 0:00:46 835000 -- (-3890.447) (-3890.783) [-3887.376] (-3892.409) * (-3889.289) (-3882.546) (-3885.450) [-3883.937] -- 0:00:46 Average standard deviation of split frequencies: 0.000000 835500 -- [-3885.944] (-3887.795) (-3883.979) (-3889.911) * [-3883.385] (-3877.784) (-3880.342) (-3889.247) -- 0:00:46 836000 -- (-3889.810) [-3888.516] (-3888.622) (-3885.691) * [-3881.291] (-3885.016) (-3887.011) (-3886.189) -- 0:00:46 836500 -- (-3882.403) [-3884.903] (-3883.942) (-3889.077) * (-3887.624) (-3883.501) (-3882.945) [-3881.569] -- 0:00:46 837000 -- (-3887.976) [-3885.384] (-3886.648) (-3885.184) * (-3890.231) [-3887.063] (-3886.923) (-3888.887) -- 0:00:46 837500 -- (-3889.381) (-3885.409) [-3884.215] (-3886.865) * (-3884.513) (-3887.934) (-3881.462) [-3883.100] -- 0:00:45 838000 -- [-3893.310] (-3884.591) (-3886.339) (-3884.588) * (-3888.292) (-3886.346) [-3883.715] (-3887.403) -- 0:00:45 838500 -- (-3894.384) (-3886.755) [-3885.362] (-3883.244) * (-3887.172) (-3884.846) [-3884.529] (-3882.361) -- 0:00:45 839000 -- (-3886.953) (-3888.222) (-3885.816) [-3881.708] * (-3889.165) (-3884.060) [-3882.976] (-3884.625) -- 0:00:45 839500 -- [-3884.704] (-3891.597) (-3887.388) (-3885.251) * (-3887.853) [-3883.055] (-3885.957) (-3884.190) -- 0:00:45 840000 -- (-3882.611) [-3884.313] (-3889.319) (-3887.188) * (-3886.108) (-3883.624) [-3888.188] (-3888.941) -- 0:00:45 Average standard deviation of split frequencies: 0.000000 840500 -- (-3884.041) [-3890.908] (-3890.104) (-3887.986) * (-3891.051) (-3880.180) (-3886.974) [-3880.144] -- 0:00:45 841000 -- (-3884.549) (-3884.018) [-3881.338] (-3885.613) * (-3887.692) (-3882.512) (-3889.933) [-3896.641] -- 0:00:44 841500 -- [-3880.963] (-3885.673) (-3888.915) (-3886.033) * (-3886.581) (-3890.233) [-3884.026] (-3890.989) -- 0:00:44 842000 -- (-3887.242) [-3883.384] (-3880.523) (-3882.654) * (-3887.540) (-3886.315) [-3881.334] (-3888.642) -- 0:00:44 842500 -- (-3888.572) (-3885.658) (-3884.333) [-3883.387] * (-3883.417) (-3886.466) (-3883.017) [-3886.689] -- 0:00:44 843000 -- (-3887.053) [-3883.205] (-3882.668) (-3886.804) * [-3888.621] (-3885.766) (-3886.472) (-3883.972) -- 0:00:44 843500 -- (-3889.220) (-3887.563) [-3883.694] (-3883.858) * (-3891.862) [-3886.810] (-3891.431) (-3891.314) -- 0:00:44 844000 -- (-3883.979) (-3886.680) [-3881.997] (-3889.784) * (-3884.468) [-3882.716] (-3889.448) (-3892.853) -- 0:00:44 844500 -- [-3879.096] (-3890.074) (-3890.189) (-3885.509) * (-3882.864) [-3886.859] (-3882.575) (-3887.082) -- 0:00:44 845000 -- (-3882.910) (-3884.511) [-3883.026] (-3886.005) * (-3892.433) (-3885.031) (-3884.801) [-3882.759] -- 0:00:43 Average standard deviation of split frequencies: 0.000000 845500 -- (-3885.485) (-3885.115) [-3886.830] (-3883.510) * [-3887.576] (-3884.863) (-3889.404) (-3885.743) -- 0:00:43 846000 -- [-3889.849] (-3885.714) (-3889.403) (-3887.212) * (-3891.608) [-3886.119] (-3885.924) (-3886.683) -- 0:00:43 846500 -- [-3885.633] (-3883.641) (-3883.532) (-3881.775) * (-3882.830) (-3896.065) (-3884.519) [-3885.776] -- 0:00:43 847000 -- [-3883.621] (-3886.021) (-3884.413) (-3888.151) * [-3890.327] (-3881.808) (-3887.504) (-3885.147) -- 0:00:43 847500 -- (-3887.695) [-3886.225] (-3883.961) (-3884.327) * (-3890.224) [-3880.847] (-3883.856) (-3886.017) -- 0:00:43 848000 -- (-3888.613) [-3885.095] (-3886.416) (-3882.969) * (-3883.315) (-3888.222) [-3882.521] (-3890.566) -- 0:00:43 848500 -- [-3882.002] (-3886.095) (-3886.245) (-3885.958) * (-3889.307) (-3889.386) [-3885.384] (-3886.465) -- 0:00:42 849000 -- (-3887.647) (-3888.276) [-3882.811] (-3883.906) * [-3884.567] (-3885.493) (-3885.698) (-3886.954) -- 0:00:42 849500 -- (-3885.001) [-3890.972] (-3889.198) (-3893.336) * (-3888.271) [-3882.258] (-3885.236) (-3885.783) -- 0:00:42 850000 -- (-3889.302) [-3890.263] (-3892.373) (-3889.224) * (-3895.492) (-3885.556) [-3884.141] (-3881.928) -- 0:00:42 Average standard deviation of split frequencies: 0.000000 850500 -- (-3892.726) [-3884.559] (-3889.787) (-3886.199) * (-3887.972) [-3886.694] (-3883.273) (-3882.458) -- 0:00:42 851000 -- (-3889.482) [-3887.650] (-3881.917) (-3889.918) * (-3895.711) (-3888.560) [-3885.225] (-3883.537) -- 0:00:42 851500 -- (-3890.129) (-3884.621) [-3882.519] (-3882.449) * [-3888.043] (-3885.148) (-3889.427) (-3890.898) -- 0:00:42 852000 -- (-3896.541) [-3881.065] (-3883.861) (-3888.344) * (-3887.702) (-3886.131) [-3889.777] (-3890.977) -- 0:00:41 852500 -- (-3885.497) [-3881.137] (-3889.664) (-3885.150) * [-3882.334] (-3883.021) (-3886.544) (-3883.141) -- 0:00:41 853000 -- (-3884.539) [-3882.493] (-3885.685) (-3891.259) * (-3888.044) [-3887.440] (-3884.067) (-3882.408) -- 0:00:41 853500 -- (-3890.495) [-3888.098] (-3886.078) (-3887.424) * (-3885.499) (-3885.859) [-3883.352] (-3881.912) -- 0:00:41 854000 -- (-3886.676) [-3884.053] (-3893.003) (-3883.762) * (-3883.079) [-3882.857] (-3891.868) (-3884.665) -- 0:00:41 854500 -- (-3883.528) [-3885.968] (-3887.231) (-3881.373) * (-3889.391) [-3882.529] (-3893.805) (-3892.985) -- 0:00:41 855000 -- (-3886.050) (-3886.075) (-3892.350) [-3886.086] * (-3891.148) (-3888.303) (-3884.905) [-3885.758] -- 0:00:41 Average standard deviation of split frequencies: 0.000000 855500 -- (-3890.293) (-3892.213) [-3889.258] (-3879.249) * (-3883.763) [-3885.136] (-3891.735) (-3886.619) -- 0:00:40 856000 -- (-3885.929) [-3885.397] (-3887.115) (-3884.887) * (-3885.572) (-3885.448) (-3885.571) [-3885.629] -- 0:00:40 856500 -- [-3884.670] (-3881.312) (-3893.198) (-3887.980) * [-3882.694] (-3885.397) (-3885.382) (-3884.903) -- 0:00:40 857000 -- (-3887.972) (-3883.735) [-3881.653] (-3882.646) * (-3880.500) [-3882.338] (-3885.035) (-3887.502) -- 0:00:40 857500 -- (-3886.762) (-3883.370) [-3888.453] (-3894.025) * [-3880.943] (-3886.576) (-3892.102) (-3883.203) -- 0:00:40 858000 -- (-3881.349) [-3886.345] (-3888.649) (-3890.612) * (-3885.954) (-3884.306) [-3883.220] (-3883.435) -- 0:00:40 858500 -- (-3880.183) (-3889.688) (-3889.373) [-3881.599] * [-3884.083] (-3882.465) (-3888.214) (-3891.496) -- 0:00:40 859000 -- (-3882.525) [-3882.574] (-3883.557) (-3887.214) * [-3883.608] (-3887.610) (-3881.277) (-3888.601) -- 0:00:39 859500 -- (-3880.957) [-3879.898] (-3890.828) (-3883.203) * (-3881.171) (-3881.319) [-3883.093] (-3885.232) -- 0:00:39 860000 -- (-3885.586) [-3881.751] (-3885.283) (-3883.801) * (-3885.389) (-3885.235) (-3884.269) [-3883.257] -- 0:00:39 Average standard deviation of split frequencies: 0.000000 860500 -- [-3886.374] (-3890.486) (-3890.142) (-3883.818) * (-3890.620) (-3885.088) (-3891.077) [-3890.302] -- 0:00:39 861000 -- (-3886.961) (-3882.621) [-3886.305] (-3880.969) * (-3890.775) [-3883.432] (-3892.618) (-3897.371) -- 0:00:39 861500 -- (-3885.349) (-3883.255) [-3884.769] (-3883.311) * (-3886.866) (-3896.020) (-3886.207) [-3887.970] -- 0:00:39 862000 -- (-3890.724) (-3885.636) [-3886.038] (-3889.737) * (-3886.422) (-3894.657) (-3890.383) [-3882.687] -- 0:00:39 862500 -- (-3883.605) [-3887.670] (-3883.993) (-3886.071) * (-3881.460) [-3880.926] (-3882.657) (-3885.233) -- 0:00:38 863000 -- (-3885.437) [-3884.654] (-3886.400) (-3882.877) * [-3884.321] (-3884.039) (-3884.374) (-3883.877) -- 0:00:38 863500 -- (-3886.775) (-3893.057) [-3888.454] (-3886.324) * (-3888.301) [-3888.500] (-3886.138) (-3890.194) -- 0:00:38 864000 -- (-3884.738) (-3892.014) (-3887.727) [-3886.133] * (-3890.661) (-3883.840) (-3888.157) [-3888.446] -- 0:00:38 864500 -- (-3882.511) (-3895.510) [-3880.452] (-3887.622) * (-3882.388) (-3886.208) [-3883.119] (-3896.011) -- 0:00:38 865000 -- (-3881.887) (-3898.426) [-3884.915] (-3880.944) * [-3884.153] (-3883.983) (-3881.764) (-3892.832) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 865500 -- (-3885.042) (-3891.610) [-3885.236] (-3886.700) * (-3886.262) [-3881.391] (-3885.374) (-3895.097) -- 0:00:38 866000 -- (-3882.395) (-3886.926) (-3883.972) [-3886.989] * [-3883.022] (-3887.369) (-3883.982) (-3890.354) -- 0:00:37 866500 -- (-3883.446) (-3883.324) (-3880.684) [-3890.997] * [-3881.340] (-3885.943) (-3885.423) (-3885.531) -- 0:00:37 867000 -- [-3893.873] (-3884.857) (-3896.610) (-3890.148) * (-3883.606) (-3891.392) (-3883.330) [-3884.676] -- 0:00:37 867500 -- (-3888.459) (-3886.686) (-3885.812) [-3890.570] * (-3882.822) [-3886.420] (-3890.553) (-3882.022) -- 0:00:37 868000 -- [-3882.840] (-3882.932) (-3886.799) (-3895.720) * (-3887.488) [-3884.403] (-3890.013) (-3879.613) -- 0:00:37 868500 -- (-3888.312) (-3889.152) [-3883.572] (-3883.819) * (-3882.061) (-3893.110) (-3888.084) [-3878.497] -- 0:00:37 869000 -- [-3879.594] (-3886.081) (-3886.874) (-3891.304) * (-3882.870) [-3889.142] (-3884.721) (-3880.200) -- 0:00:37 869500 -- [-3879.719] (-3888.819) (-3885.194) (-3886.482) * (-3881.523) (-3887.549) [-3884.635] (-3893.627) -- 0:00:36 870000 -- (-3889.963) (-3882.994) [-3883.692] (-3887.622) * (-3881.083) [-3882.017] (-3883.017) (-3889.902) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 870500 -- [-3888.714] (-3884.392) (-3889.755) (-3885.240) * (-3886.786) [-3882.431] (-3882.759) (-3884.241) -- 0:00:36 871000 -- (-3885.098) (-3884.306) (-3888.103) [-3885.523] * (-3889.772) (-3883.925) (-3881.283) [-3882.846] -- 0:00:36 871500 -- (-3884.531) (-3884.042) [-3885.320] (-3887.263) * [-3885.252] (-3884.713) (-3880.566) (-3882.243) -- 0:00:36 872000 -- [-3883.196] (-3893.182) (-3884.926) (-3888.658) * (-3885.662) (-3887.288) [-3883.618] (-3882.933) -- 0:00:36 872500 -- [-3882.116] (-3889.794) (-3880.655) (-3885.835) * [-3884.974] (-3889.458) (-3885.511) (-3888.750) -- 0:00:36 873000 -- (-3888.120) (-3888.511) (-3882.789) [-3882.367] * [-3882.325] (-3891.988) (-3883.423) (-3885.169) -- 0:00:35 873500 -- (-3882.565) [-3885.977] (-3881.289) (-3882.050) * (-3883.932) (-3892.430) (-3885.161) [-3883.690] -- 0:00:35 874000 -- [-3886.338] (-3882.385) (-3880.500) (-3886.519) * (-3886.039) (-3883.533) (-3882.275) [-3883.854] -- 0:00:35 874500 -- [-3883.458] (-3887.959) (-3889.830) (-3885.204) * (-3887.250) (-3892.174) [-3884.570] (-3884.292) -- 0:00:35 875000 -- (-3885.579) [-3885.852] (-3882.072) (-3889.343) * (-3891.371) [-3884.214] (-3882.954) (-3891.114) -- 0:00:35 Average standard deviation of split frequencies: 0.000000 875500 -- [-3882.538] (-3893.267) (-3882.415) (-3888.623) * (-3887.244) (-3881.647) [-3890.909] (-3885.639) -- 0:00:35 876000 -- (-3882.166) (-3887.645) (-3889.356) [-3880.893] * (-3890.838) (-3889.035) [-3891.483] (-3884.949) -- 0:00:35 876500 -- (-3891.231) (-3887.427) [-3890.110] (-3891.917) * (-3884.415) (-3883.253) [-3886.081] (-3889.805) -- 0:00:34 877000 -- (-3885.181) [-3885.905] (-3883.577) (-3891.118) * (-3882.209) (-3883.296) [-3886.721] (-3887.063) -- 0:00:34 877500 -- (-3885.079) [-3890.079] (-3884.780) (-3883.714) * (-3892.138) [-3883.368] (-3884.557) (-3889.469) -- 0:00:34 878000 -- [-3878.745] (-3902.485) (-3893.032) (-3883.953) * (-3888.760) (-3887.583) (-3880.403) [-3890.054] -- 0:00:34 878500 -- [-3881.439] (-3890.301) (-3887.208) (-3881.913) * (-3885.938) (-3884.040) [-3886.609] (-3884.994) -- 0:00:34 879000 -- (-3886.286) [-3884.083] (-3886.927) (-3883.786) * (-3889.726) (-3888.049) (-3894.581) [-3886.952] -- 0:00:34 879500 -- (-3891.504) (-3889.606) [-3883.875] (-3883.721) * (-3882.715) (-3881.306) [-3890.977] (-3891.754) -- 0:00:34 880000 -- (-3884.654) (-3891.399) [-3885.733] (-3889.313) * (-3889.524) (-3885.329) (-3885.764) [-3885.029] -- 0:00:33 Average standard deviation of split frequencies: 0.000000 880500 -- (-3881.527) (-3891.944) (-3882.017) [-3882.480] * (-3888.914) (-3884.171) (-3888.299) [-3882.489] -- 0:00:33 881000 -- [-3885.642] (-3890.345) (-3882.559) (-3883.275) * (-3882.180) (-3880.340) (-3877.679) [-3880.551] -- 0:00:33 881500 -- (-3881.510) (-3894.061) (-3882.651) [-3889.157] * [-3885.578] (-3883.834) (-3881.876) (-3887.079) -- 0:00:33 882000 -- [-3881.836] (-3894.890) (-3894.201) (-3886.067) * (-3887.913) (-3884.210) (-3884.758) [-3886.357] -- 0:00:33 882500 -- (-3887.751) [-3884.200] (-3897.146) (-3890.257) * [-3886.737] (-3888.989) (-3882.967) (-3884.065) -- 0:00:33 883000 -- (-3885.404) (-3889.182) (-3890.232) [-3885.292] * [-3881.432] (-3884.671) (-3882.772) (-3884.526) -- 0:00:33 883500 -- (-3887.932) (-3887.165) (-3895.985) [-3886.667] * (-3884.129) (-3883.994) [-3879.804] (-3888.649) -- 0:00:32 884000 -- (-3884.298) [-3885.172] (-3895.781) (-3882.502) * (-3880.982) [-3883.336] (-3884.762) (-3884.677) -- 0:00:32 884500 -- (-3889.868) (-3884.182) (-3888.067) [-3884.837] * (-3890.250) (-3887.351) (-3884.162) [-3888.600] -- 0:00:32 885000 -- (-3887.060) (-3886.150) (-3883.157) [-3887.458] * (-3893.463) (-3888.317) [-3882.564] (-3887.331) -- 0:00:32 Average standard deviation of split frequencies: 0.000000 885500 -- (-3884.719) (-3886.978) (-3884.318) [-3886.914] * (-3888.807) (-3887.363) [-3884.713] (-3883.967) -- 0:00:32 886000 -- (-3885.098) (-3886.671) (-3886.790) [-3885.253] * (-3893.612) [-3881.429] (-3884.316) (-3883.009) -- 0:00:32 886500 -- [-3883.319] (-3893.505) (-3892.288) (-3881.614) * (-3884.463) [-3883.064] (-3880.709) (-3886.713) -- 0:00:32 887000 -- [-3884.767] (-3890.953) (-3888.672) (-3891.522) * (-3895.682) (-3891.892) (-3883.441) [-3887.474] -- 0:00:31 887500 -- (-3887.481) [-3886.405] (-3880.804) (-3881.373) * (-3886.464) (-3886.899) (-3882.870) [-3886.933] -- 0:00:31 888000 -- [-3884.157] (-3888.057) (-3889.973) (-3886.337) * (-3896.760) (-3881.580) [-3881.397] (-3887.739) -- 0:00:31 888500 -- (-3883.021) [-3885.005] (-3884.855) (-3890.265) * (-3892.569) (-3882.574) (-3883.936) [-3885.788] -- 0:00:31 889000 -- (-3886.839) [-3879.947] (-3882.300) (-3885.092) * (-3892.007) (-3884.359) (-3883.449) [-3885.482] -- 0:00:31 889500 -- (-3886.283) (-3888.337) [-3880.583] (-3891.631) * (-3892.437) (-3885.808) (-3886.411) [-3880.619] -- 0:00:31 890000 -- (-3884.471) [-3881.225] (-3885.048) (-3890.262) * (-3888.466) (-3888.700) [-3884.628] (-3880.962) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 890500 -- (-3880.375) [-3881.931] (-3889.678) (-3886.526) * (-3883.764) (-3885.731) (-3882.776) [-3892.665] -- 0:00:30 891000 -- [-3881.419] (-3885.236) (-3887.303) (-3886.176) * (-3884.519) [-3887.854] (-3886.313) (-3892.149) -- 0:00:30 891500 -- [-3885.551] (-3884.178) (-3887.225) (-3889.055) * (-3885.158) (-3890.656) [-3886.195] (-3890.398) -- 0:00:30 892000 -- [-3883.163] (-3888.815) (-3885.399) (-3884.538) * [-3886.641] (-3883.050) (-3889.516) (-3891.845) -- 0:00:30 892500 -- (-3879.745) [-3881.855] (-3881.827) (-3888.440) * (-3887.752) (-3886.042) (-3883.379) [-3885.437] -- 0:00:30 893000 -- (-3882.726) (-3888.604) (-3883.283) [-3889.966] * (-3882.992) [-3886.778] (-3883.992) (-3886.242) -- 0:00:30 893500 -- [-3889.583] (-3881.117) (-3888.700) (-3885.241) * (-3890.716) [-3879.885] (-3887.945) (-3883.556) -- 0:00:30 894000 -- (-3890.718) (-3880.243) (-3892.402) [-3884.048] * (-3885.253) [-3883.882] (-3889.697) (-3883.381) -- 0:00:29 894500 -- (-3884.362) (-3886.693) [-3888.762] (-3885.354) * (-3881.369) (-3882.915) [-3889.749] (-3883.028) -- 0:00:29 895000 -- [-3882.967] (-3886.687) (-3882.786) (-3880.841) * (-3881.740) [-3887.329] (-3886.398) (-3880.763) -- 0:00:29 Average standard deviation of split frequencies: 0.000000 895500 -- [-3881.566] (-3887.390) (-3885.440) (-3886.103) * (-3887.837) [-3890.440] (-3884.075) (-3891.866) -- 0:00:29 896000 -- (-3879.557) (-3891.284) (-3883.043) [-3886.463] * (-3883.080) [-3880.165] (-3884.240) (-3884.078) -- 0:00:29 896500 -- (-3885.163) (-3885.723) [-3881.281] (-3886.979) * [-3889.033] (-3888.002) (-3884.080) (-3892.813) -- 0:00:29 897000 -- (-3883.804) (-3887.885) [-3881.048] (-3884.360) * (-3884.724) (-3888.745) (-3888.736) [-3882.557] -- 0:00:29 897500 -- [-3884.728] (-3881.851) (-3882.627) (-3894.585) * (-3886.292) (-3887.228) (-3883.231) [-3886.641] -- 0:00:29 898000 -- (-3883.264) (-3886.418) [-3889.234] (-3889.072) * (-3883.185) (-3881.480) (-3883.978) [-3882.405] -- 0:00:28 898500 -- (-3883.311) (-3882.957) (-3884.560) [-3885.154] * (-3886.047) (-3885.387) [-3881.381] (-3883.664) -- 0:00:28 899000 -- [-3886.225] (-3890.529) (-3883.098) (-3884.479) * (-3893.646) [-3884.265] (-3887.672) (-3884.883) -- 0:00:28 899500 -- (-3884.403) [-3886.669] (-3884.343) (-3887.148) * [-3886.671] (-3883.418) (-3889.002) (-3887.438) -- 0:00:28 900000 -- (-3887.934) (-3885.343) [-3884.882] (-3888.534) * (-3890.829) (-3890.655) [-3883.024] (-3887.454) -- 0:00:28 Average standard deviation of split frequencies: 0.000000 900500 -- (-3883.006) [-3883.492] (-3884.253) (-3887.021) * [-3881.405] (-3897.255) (-3883.762) (-3889.862) -- 0:00:28 901000 -- (-3881.145) [-3887.087] (-3885.057) (-3888.849) * (-3881.892) (-3888.337) [-3882.686] (-3891.724) -- 0:00:28 901500 -- (-3889.026) [-3887.246] (-3889.874) (-3888.778) * (-3881.440) [-3891.197] (-3881.703) (-3891.120) -- 0:00:27 902000 -- (-3883.236) (-3884.176) (-3886.041) [-3889.956] * [-3889.719] (-3885.133) (-3888.452) (-3884.326) -- 0:00:27 902500 -- (-3883.128) [-3882.880] (-3881.652) (-3882.730) * (-3883.795) (-3893.296) (-3883.261) [-3887.177] -- 0:00:27 903000 -- (-3883.965) (-3882.349) (-3883.367) [-3883.326] * (-3881.897) (-3885.698) [-3883.860] (-3886.190) -- 0:00:27 903500 -- (-3888.632) [-3883.070] (-3891.846) (-3887.990) * (-3893.269) [-3887.266] (-3888.655) (-3882.861) -- 0:00:27 904000 -- (-3882.984) (-3884.295) (-3888.769) [-3883.000] * (-3890.823) (-3888.143) (-3890.397) [-3883.692] -- 0:00:27 904500 -- (-3883.011) [-3885.166] (-3886.067) (-3885.486) * (-3891.127) (-3890.906) (-3884.820) [-3888.309] -- 0:00:27 905000 -- (-3881.907) [-3882.007] (-3890.387) (-3892.808) * (-3886.081) (-3891.020) (-3891.912) [-3886.675] -- 0:00:26 Average standard deviation of split frequencies: 0.000000 905500 -- (-3886.765) (-3891.621) (-3887.812) [-3886.963] * (-3887.798) [-3882.807] (-3886.035) (-3888.005) -- 0:00:26 906000 -- (-3882.773) (-3887.181) (-3890.726) [-3885.440] * [-3888.491] (-3888.807) (-3888.949) (-3885.407) -- 0:00:26 906500 -- (-3888.443) (-3884.808) [-3883.393] (-3885.447) * (-3885.288) [-3881.056] (-3887.623) (-3883.802) -- 0:00:26 907000 -- (-3886.250) [-3882.329] (-3890.019) (-3884.547) * (-3885.415) [-3886.864] (-3886.279) (-3881.715) -- 0:00:26 907500 -- (-3899.083) [-3887.484] (-3882.408) (-3884.547) * (-3891.872) [-3887.274] (-3888.144) (-3882.415) -- 0:00:26 908000 -- (-3886.072) (-3886.714) [-3887.564] (-3883.928) * [-3892.437] (-3886.165) (-3887.169) (-3886.564) -- 0:00:26 908500 -- (-3890.299) [-3885.123] (-3882.531) (-3887.842) * (-3886.505) (-3888.375) (-3886.251) [-3884.039] -- 0:00:25 909000 -- [-3883.385] (-3887.083) (-3884.389) (-3885.258) * (-3880.326) [-3888.841] (-3889.395) (-3884.860) -- 0:00:25 909500 -- (-3885.519) [-3885.784] (-3891.608) (-3890.845) * [-3889.482] (-3892.539) (-3886.821) (-3885.610) -- 0:00:25 910000 -- (-3890.567) (-3885.563) (-3884.593) [-3886.206] * (-3887.591) (-3889.358) (-3882.799) [-3881.332] -- 0:00:25 Average standard deviation of split frequencies: 0.000000 910500 -- (-3883.981) (-3885.498) [-3887.481] (-3883.664) * (-3882.892) [-3883.489] (-3885.350) (-3880.456) -- 0:00:25 911000 -- (-3886.427) (-3881.107) [-3889.827] (-3885.678) * (-3884.827) (-3885.732) (-3884.496) [-3883.580] -- 0:00:25 911500 -- (-3887.221) [-3880.996] (-3888.624) (-3886.809) * [-3885.326] (-3889.229) (-3887.506) (-3886.049) -- 0:00:25 912000 -- [-3884.054] (-3887.164) (-3891.599) (-3889.980) * (-3888.733) (-3889.145) [-3884.386] (-3889.591) -- 0:00:24 912500 -- (-3888.215) (-3892.769) [-3882.500] (-3884.978) * (-3887.181) (-3887.458) (-3886.236) [-3888.974] -- 0:00:24 913000 -- (-3890.212) (-3886.320) (-3884.941) [-3882.716] * [-3880.638] (-3886.321) (-3881.003) (-3890.539) -- 0:00:24 913500 -- (-3889.291) (-3888.734) (-3882.937) [-3885.565] * [-3882.597] (-3890.129) (-3887.498) (-3880.212) -- 0:00:24 914000 -- (-3882.620) (-3891.494) (-3888.737) [-3882.755] * (-3885.953) (-3887.413) (-3883.863) [-3882.270] -- 0:00:24 914500 -- (-3887.877) (-3885.530) (-3883.265) [-3887.118] * [-3884.784] (-3883.829) (-3892.090) (-3881.425) -- 0:00:24 915000 -- [-3894.376] (-3885.685) (-3882.442) (-3886.683) * (-3888.491) (-3886.933) [-3885.825] (-3885.372) -- 0:00:24 Average standard deviation of split frequencies: 0.000000 915500 -- (-3899.141) [-3883.389] (-3886.482) (-3887.332) * (-3888.082) (-3891.581) (-3887.329) [-3884.953] -- 0:00:23 916000 -- (-3886.271) (-3885.076) [-3884.596] (-3889.760) * [-3884.327] (-3884.052) (-3887.886) (-3882.796) -- 0:00:23 916500 -- (-3881.959) [-3884.653] (-3887.401) (-3887.899) * (-3885.157) (-3887.267) (-3886.464) [-3886.811] -- 0:00:23 917000 -- [-3881.416] (-3883.307) (-3894.216) (-3892.707) * (-3885.173) (-3880.203) [-3884.111] (-3883.610) -- 0:00:23 917500 -- [-3890.645] (-3885.111) (-3884.705) (-3887.213) * [-3885.206] (-3885.349) (-3888.292) (-3887.172) -- 0:00:23 918000 -- [-3883.541] (-3884.038) (-3887.977) (-3886.902) * (-3881.098) (-3885.369) (-3881.598) [-3888.432] -- 0:00:23 918500 -- (-3885.979) [-3885.616] (-3888.777) (-3884.642) * [-3885.103] (-3891.388) (-3891.116) (-3884.235) -- 0:00:23 919000 -- (-3887.743) [-3883.104] (-3892.908) (-3889.367) * (-3887.981) [-3889.656] (-3884.618) (-3893.770) -- 0:00:22 919500 -- [-3883.344] (-3891.679) (-3886.467) (-3885.455) * (-3889.297) [-3884.928] (-3885.832) (-3889.352) -- 0:00:22 920000 -- (-3886.017) (-3883.438) [-3888.794] (-3884.454) * [-3887.227] (-3884.966) (-3889.285) (-3886.826) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 920500 -- (-3891.078) [-3880.279] (-3887.346) (-3886.172) * (-3886.409) (-3888.130) [-3883.046] (-3893.208) -- 0:00:22 921000 -- (-3883.393) (-3885.595) (-3892.772) [-3883.491] * (-3884.079) (-3885.566) [-3893.084] (-3886.253) -- 0:00:22 921500 -- (-3884.294) (-3883.706) (-3885.791) [-3882.141] * (-3886.725) (-3888.949) (-3880.675) [-3889.046] -- 0:00:22 922000 -- (-3883.933) (-3886.513) [-3881.128] (-3884.826) * (-3893.466) (-3882.550) (-3886.755) [-3884.258] -- 0:00:22 922500 -- (-3882.221) (-3888.198) (-3885.796) [-3884.662] * [-3886.001] (-3883.269) (-3889.427) (-3885.739) -- 0:00:21 923000 -- (-3900.452) (-3882.489) [-3889.216] (-3884.251) * (-3888.805) (-3883.984) [-3884.983] (-3887.981) -- 0:00:21 923500 -- (-3887.875) [-3885.472] (-3880.752) (-3885.574) * (-3892.638) (-3890.374) [-3891.658] (-3880.953) -- 0:00:21 924000 -- (-3889.614) (-3890.500) (-3887.294) [-3881.377] * (-3887.689) [-3882.148] (-3888.321) (-3878.228) -- 0:00:21 924500 -- (-3890.302) (-3887.811) (-3884.497) [-3883.556] * (-3890.470) (-3883.153) (-3888.570) [-3886.952] -- 0:00:21 925000 -- (-3885.863) (-3894.011) (-3884.564) [-3887.551] * (-3887.509) (-3885.372) (-3884.474) [-3888.893] -- 0:00:21 Average standard deviation of split frequencies: 0.000000 925500 -- (-3881.724) [-3890.745] (-3881.971) (-3886.566) * (-3890.761) [-3883.305] (-3885.068) (-3887.820) -- 0:00:21 926000 -- [-3884.528] (-3886.080) (-3883.527) (-3887.299) * (-3880.824) (-3883.791) (-3892.723) [-3883.046] -- 0:00:20 926500 -- [-3885.106] (-3886.223) (-3882.401) (-3894.641) * [-3882.042] (-3884.471) (-3883.211) (-3890.234) -- 0:00:20 927000 -- [-3884.701] (-3887.500) (-3885.786) (-3887.145) * (-3888.392) [-3886.790] (-3887.897) (-3893.764) -- 0:00:20 927500 -- (-3886.473) [-3883.635] (-3889.110) (-3886.209) * (-3891.145) (-3888.010) [-3882.211] (-3880.258) -- 0:00:20 928000 -- [-3882.971] (-3884.075) (-3888.514) (-3889.299) * [-3889.511] (-3883.317) (-3885.416) (-3881.822) -- 0:00:20 928500 -- (-3884.857) [-3882.898] (-3887.674) (-3885.703) * (-3887.504) (-3895.270) [-3882.131] (-3887.151) -- 0:00:20 929000 -- [-3882.160] (-3887.642) (-3884.590) (-3896.992) * (-3886.886) (-3883.481) (-3883.571) [-3882.810] -- 0:00:20 929500 -- [-3881.457] (-3885.108) (-3883.854) (-3890.175) * [-3891.510] (-3888.725) (-3882.145) (-3885.162) -- 0:00:19 930000 -- [-3881.310] (-3888.775) (-3888.439) (-3895.540) * (-3891.640) [-3885.887] (-3887.650) (-3889.743) -- 0:00:19 Average standard deviation of split frequencies: 0.000000 930500 -- [-3883.078] (-3884.714) (-3887.210) (-3891.918) * [-3882.503] (-3888.302) (-3892.514) (-3881.936) -- 0:00:19 931000 -- (-3887.748) (-3886.183) [-3885.663] (-3886.784) * [-3882.404] (-3888.276) (-3888.437) (-3882.028) -- 0:00:19 931500 -- (-3886.556) (-3883.729) (-3882.536) [-3883.855] * (-3882.739) (-3885.473) (-3881.686) [-3880.605] -- 0:00:19 932000 -- [-3883.369] (-3882.561) (-3888.412) (-3886.845) * (-3887.614) [-3886.555] (-3884.764) (-3888.922) -- 0:00:19 932500 -- (-3883.128) [-3885.199] (-3885.181) (-3893.426) * (-3883.052) [-3883.318] (-3888.034) (-3885.635) -- 0:00:19 933000 -- (-3890.762) [-3884.487] (-3887.410) (-3886.893) * (-3881.981) [-3882.960] (-3888.895) (-3883.945) -- 0:00:18 933500 -- (-3884.542) [-3881.803] (-3890.682) (-3880.860) * [-3882.037] (-3894.337) (-3884.613) (-3886.371) -- 0:00:18 934000 -- (-3888.854) (-3887.863) [-3884.275] (-3890.995) * (-3884.596) (-3894.082) (-3885.952) [-3880.384] -- 0:00:18 934500 -- [-3891.328] (-3881.653) (-3885.870) (-3885.062) * (-3886.802) [-3890.980] (-3883.441) (-3880.060) -- 0:00:18 935000 -- (-3886.847) (-3887.579) [-3881.727] (-3887.125) * (-3888.214) [-3882.296] (-3879.028) (-3883.985) -- 0:00:18 Average standard deviation of split frequencies: 0.000000 935500 -- (-3888.107) [-3883.568] (-3887.148) (-3884.503) * (-3884.428) (-3886.556) [-3883.627] (-3883.691) -- 0:00:18 936000 -- (-3884.876) [-3887.295] (-3880.126) (-3881.991) * (-3890.646) (-3881.596) (-3892.048) [-3884.299] -- 0:00:18 936500 -- (-3886.018) [-3887.527] (-3882.044) (-3885.991) * [-3886.175] (-3884.184) (-3893.896) (-3886.839) -- 0:00:17 937000 -- (-3885.637) (-3890.840) (-3883.292) [-3884.407] * (-3883.909) (-3883.723) (-3893.643) [-3890.230] -- 0:00:17 937500 -- (-3884.380) (-3887.082) [-3881.880] (-3886.750) * (-3896.513) [-3886.972] (-3884.612) (-3883.159) -- 0:00:17 938000 -- [-3885.566] (-3884.260) (-3884.126) (-3886.441) * (-3884.041) (-3881.663) [-3884.673] (-3882.304) -- 0:00:17 938500 -- [-3885.117] (-3888.712) (-3884.806) (-3887.017) * (-3882.454) (-3887.816) [-3885.471] (-3893.791) -- 0:00:17 939000 -- (-3891.729) (-3883.771) (-3888.040) [-3884.406] * (-3883.695) (-3885.026) (-3883.422) [-3888.797] -- 0:00:17 939500 -- (-3883.886) (-3889.357) [-3885.067] (-3887.674) * (-3887.098) [-3886.863] (-3884.483) (-3886.651) -- 0:00:17 940000 -- [-3885.392] (-3885.553) (-3884.218) (-3885.007) * [-3882.630] (-3884.057) (-3890.199) (-3884.126) -- 0:00:16 Average standard deviation of split frequencies: 0.000000 940500 -- (-3887.020) (-3884.342) (-3891.809) [-3888.199] * (-3885.221) (-3890.965) (-3888.119) [-3893.059] -- 0:00:16 941000 -- [-3886.662] (-3883.339) (-3887.466) (-3892.530) * (-3892.590) (-3889.875) (-3886.369) [-3883.872] -- 0:00:16 941500 -- (-3889.624) [-3883.065] (-3885.064) (-3887.890) * (-3889.569) (-3888.685) [-3879.861] (-3887.615) -- 0:00:16 942000 -- (-3896.192) [-3888.033] (-3887.136) (-3882.056) * [-3886.366] (-3883.732) (-3882.942) (-3884.366) -- 0:00:16 942500 -- (-3887.736) (-3884.388) [-3886.383] (-3884.547) * (-3884.993) [-3886.150] (-3885.003) (-3886.219) -- 0:00:16 943000 -- (-3890.281) (-3885.123) (-3885.977) [-3882.348] * (-3885.589) (-3883.097) [-3886.821] (-3889.061) -- 0:00:16 943500 -- (-3886.524) (-3884.778) [-3887.260] (-3887.375) * (-3887.123) (-3890.747) [-3885.321] (-3881.443) -- 0:00:15 944000 -- [-3886.226] (-3884.686) (-3889.238) (-3883.282) * (-3887.281) (-3885.775) (-3885.801) [-3883.710] -- 0:00:15 944500 -- [-3892.103] (-3879.997) (-3881.758) (-3888.364) * (-3885.370) (-3884.089) (-3883.789) [-3882.267] -- 0:00:15 945000 -- (-3883.249) (-3879.774) [-3880.931] (-3883.939) * (-3883.633) (-3883.373) [-3885.064] (-3887.280) -- 0:00:15 Average standard deviation of split frequencies: 0.000000 945500 -- (-3890.238) (-3885.858) [-3881.408] (-3886.328) * (-3884.713) (-3884.246) [-3890.124] (-3889.083) -- 0:00:15 946000 -- (-3882.316) [-3885.536] (-3886.089) (-3885.619) * (-3887.606) (-3886.590) [-3884.093] (-3884.806) -- 0:00:15 946500 -- (-3883.883) [-3887.787] (-3888.145) (-3882.416) * (-3882.929) (-3884.371) (-3890.919) [-3885.595] -- 0:00:15 947000 -- (-3881.567) (-3884.537) (-3886.264) [-3882.021] * (-3890.390) [-3887.131] (-3881.746) (-3894.575) -- 0:00:14 947500 -- [-3883.368] (-3882.656) (-3885.482) (-3885.631) * (-3886.262) (-3889.530) [-3881.781] (-3884.337) -- 0:00:14 948000 -- (-3884.338) (-3888.929) [-3887.581] (-3885.980) * (-3883.323) (-3884.690) [-3883.458] (-3885.699) -- 0:00:14 948500 -- (-3881.857) [-3882.993] (-3890.245) (-3889.735) * [-3882.764] (-3887.926) (-3884.986) (-3883.113) -- 0:00:14 949000 -- (-3884.678) [-3883.969] (-3886.949) (-3885.014) * (-3886.197) [-3891.345] (-3886.742) (-3882.134) -- 0:00:14 949500 -- (-3886.049) [-3881.476] (-3889.879) (-3884.754) * (-3888.794) (-3886.118) [-3883.569] (-3883.416) -- 0:00:14 950000 -- [-3884.255] (-3889.569) (-3885.700) (-3886.270) * [-3883.142] (-3883.534) (-3886.798) (-3884.590) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 950500 -- (-3884.602) (-3884.688) [-3884.724] (-3884.190) * (-3885.537) (-3886.782) (-3888.213) [-3883.119] -- 0:00:14 951000 -- (-3884.999) (-3886.590) [-3882.311] (-3887.236) * (-3891.200) (-3885.677) [-3889.633] (-3884.240) -- 0:00:13 951500 -- (-3894.827) (-3881.064) (-3882.388) [-3888.976] * (-3884.765) [-3883.857] (-3886.442) (-3887.075) -- 0:00:13 952000 -- (-3888.472) (-3883.207) [-3888.084] (-3887.617) * (-3886.646) [-3883.712] (-3890.679) (-3883.244) -- 0:00:13 952500 -- (-3883.747) [-3891.714] (-3886.611) (-3887.589) * (-3888.717) [-3880.000] (-3887.565) (-3880.970) -- 0:00:13 953000 -- [-3893.975] (-3885.294) (-3883.015) (-3888.102) * (-3890.165) (-3889.149) [-3879.721] (-3881.738) -- 0:00:13 953500 -- (-3887.589) (-3886.612) [-3881.814] (-3887.433) * (-3887.752) (-3891.088) (-3891.081) [-3882.494] -- 0:00:13 954000 -- (-3886.872) (-3883.737) [-3886.013] (-3884.597) * (-3881.950) (-3884.592) [-3885.049] (-3886.339) -- 0:00:13 954500 -- (-3884.071) (-3884.624) [-3882.683] (-3887.106) * (-3885.716) (-3883.025) [-3891.551] (-3882.911) -- 0:00:12 955000 -- (-3887.150) [-3884.339] (-3885.834) (-3882.666) * (-3887.851) (-3884.292) [-3885.283] (-3889.014) -- 0:00:12 Average standard deviation of split frequencies: 0.000000 955500 -- [-3884.423] (-3879.773) (-3890.456) (-3890.688) * (-3887.553) [-3888.936] (-3885.243) (-3881.427) -- 0:00:12 956000 -- (-3884.318) (-3885.700) [-3890.627] (-3890.399) * [-3885.941] (-3886.572) (-3887.354) (-3885.260) -- 0:00:12 956500 -- [-3882.355] (-3879.345) (-3882.023) (-3890.874) * (-3884.661) (-3885.084) (-3885.526) [-3885.308] -- 0:00:12 957000 -- (-3883.235) (-3882.561) [-3891.604] (-3885.685) * (-3889.612) (-3879.409) [-3885.147] (-3883.038) -- 0:00:12 957500 -- (-3883.539) [-3882.997] (-3885.966) (-3886.293) * (-3893.151) (-3884.256) [-3885.701] (-3884.635) -- 0:00:12 958000 -- (-3884.533) (-3883.445) [-3881.639] (-3884.545) * (-3882.917) (-3884.954) [-3888.823] (-3884.206) -- 0:00:11 958500 -- (-3889.278) (-3887.535) (-3881.975) [-3891.443] * [-3882.944] (-3891.670) (-3884.936) (-3886.235) -- 0:00:11 959000 -- (-3884.629) (-3887.478) (-3882.207) [-3884.247] * (-3884.863) (-3890.624) [-3884.176] (-3889.357) -- 0:00:11 959500 -- (-3884.572) (-3883.279) (-3883.017) [-3890.391] * [-3887.248] (-3885.342) (-3884.152) (-3884.394) -- 0:00:11 960000 -- (-3883.407) (-3887.487) [-3884.304] (-3891.132) * [-3885.650] (-3888.327) (-3887.343) (-3889.045) -- 0:00:11 Average standard deviation of split frequencies: 0.000000 960500 -- (-3888.478) (-3886.493) [-3886.405] (-3880.954) * [-3883.845] (-3882.042) (-3887.763) (-3886.784) -- 0:00:11 961000 -- [-3886.549] (-3886.177) (-3882.343) (-3882.466) * (-3893.444) (-3884.435) (-3885.886) [-3882.351] -- 0:00:11 961500 -- (-3885.736) [-3885.336] (-3885.171) (-3890.404) * (-3888.756) (-3881.314) (-3888.558) [-3883.433] -- 0:00:10 962000 -- (-3886.366) (-3883.667) [-3888.492] (-3889.883) * [-3885.587] (-3882.610) (-3889.399) (-3883.335) -- 0:00:10 962500 -- [-3882.842] (-3879.685) (-3894.786) (-3889.713) * [-3885.924] (-3882.403) (-3887.620) (-3887.912) -- 0:00:10 963000 -- [-3885.135] (-3881.191) (-3892.077) (-3888.282) * (-3887.903) [-3882.028] (-3884.213) (-3893.136) -- 0:00:10 963500 -- (-3887.498) [-3882.035] (-3888.618) (-3887.095) * (-3879.895) [-3890.767] (-3882.284) (-3883.231) -- 0:00:10 964000 -- (-3887.561) (-3884.432) [-3885.969] (-3886.398) * [-3889.844] (-3885.329) (-3889.778) (-3889.462) -- 0:00:10 964500 -- (-3885.248) (-3884.019) [-3883.343] (-3886.526) * [-3882.966] (-3886.627) (-3883.946) (-3886.421) -- 0:00:10 965000 -- (-3890.892) (-3886.388) (-3881.782) [-3880.340] * (-3887.231) [-3883.395] (-3883.043) (-3886.264) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 965500 -- (-3886.811) [-3884.957] (-3885.766) (-3887.401) * [-3886.403] (-3881.194) (-3888.430) (-3887.090) -- 0:00:09 966000 -- [-3884.092] (-3893.274) (-3890.232) (-3887.098) * (-3884.176) (-3887.561) (-3883.793) [-3883.990] -- 0:00:09 966500 -- (-3884.880) (-3895.237) [-3883.222] (-3884.639) * [-3887.391] (-3895.196) (-3885.944) (-3884.214) -- 0:00:09 967000 -- (-3892.748) (-3883.967) [-3880.363] (-3884.651) * (-3887.823) (-3892.214) (-3881.135) [-3882.021] -- 0:00:09 967500 -- (-3886.076) (-3888.960) [-3885.712] (-3884.198) * (-3883.848) (-3891.125) [-3882.210] (-3891.234) -- 0:00:09 968000 -- [-3880.882] (-3882.492) (-3884.760) (-3887.767) * (-3888.174) [-3882.175] (-3884.112) (-3889.261) -- 0:00:09 968500 -- (-3888.939) [-3884.277] (-3883.607) (-3885.800) * (-3885.539) [-3884.883] (-3883.600) (-3885.802) -- 0:00:08 969000 -- (-3888.265) (-3881.493) [-3890.989] (-3885.700) * (-3886.407) (-3881.355) (-3879.414) [-3880.999] -- 0:00:08 969500 -- [-3893.491] (-3886.311) (-3885.020) (-3885.387) * (-3889.042) (-3883.174) [-3887.513] (-3883.444) -- 0:00:08 970000 -- (-3893.773) (-3883.661) [-3886.312] (-3886.557) * [-3884.201] (-3890.394) (-3887.596) (-3892.053) -- 0:00:08 Average standard deviation of split frequencies: 0.000000 970500 -- (-3891.423) (-3889.077) (-3881.705) [-3884.731] * (-3894.477) (-3890.575) [-3883.902] (-3892.140) -- 0:00:08 971000 -- [-3882.079] (-3882.905) (-3885.435) (-3883.069) * (-3883.135) (-3884.596) [-3884.140] (-3890.701) -- 0:00:08 971500 -- (-3883.096) (-3888.277) (-3892.037) [-3880.934] * (-3885.467) (-3885.432) [-3886.069] (-3892.216) -- 0:00:08 972000 -- (-3885.529) (-3885.677) [-3885.320] (-3888.890) * (-3881.541) [-3886.584] (-3884.156) (-3884.554) -- 0:00:07 972500 -- (-3885.604) (-3884.136) [-3882.496] (-3880.784) * (-3884.439) (-3890.042) (-3889.697) [-3881.583] -- 0:00:07 973000 -- (-3890.154) (-3887.582) (-3884.624) [-3888.046] * (-3888.794) [-3884.084] (-3882.212) (-3884.766) -- 0:00:07 973500 -- (-3883.065) (-3888.742) [-3888.502] (-3882.864) * [-3884.031] (-3888.981) (-3885.280) (-3881.896) -- 0:00:07 974000 -- [-3882.288] (-3886.876) (-3882.367) (-3885.520) * (-3883.099) (-3892.701) [-3885.075] (-3885.838) -- 0:00:07 974500 -- [-3882.891] (-3885.820) (-3880.191) (-3883.894) * [-3883.456] (-3893.311) (-3883.006) (-3886.573) -- 0:00:07 975000 -- (-3885.230) (-3884.321) [-3883.991] (-3885.794) * [-3886.596] (-3882.307) (-3885.299) (-3887.453) -- 0:00:07 Average standard deviation of split frequencies: 0.000000 975500 -- [-3883.481] (-3892.908) (-3882.708) (-3891.111) * (-3883.139) [-3882.349] (-3879.883) (-3880.929) -- 0:00:06 976000 -- (-3887.503) (-3885.163) [-3883.339] (-3880.667) * (-3893.783) [-3887.841] (-3889.865) (-3883.622) -- 0:00:06 976500 -- (-3882.352) [-3881.536] (-3887.785) (-3886.230) * (-3886.035) (-3892.680) (-3888.276) [-3885.453] -- 0:00:06 977000 -- (-3884.696) (-3886.341) (-3896.613) [-3887.033] * (-3886.971) (-3887.124) (-3883.845) [-3883.541] -- 0:00:06 977500 -- [-3882.788] (-3886.664) (-3885.849) (-3892.668) * (-3883.158) [-3888.895] (-3885.963) (-3892.545) -- 0:00:06 978000 -- (-3882.873) [-3883.696] (-3883.851) (-3888.438) * [-3882.969] (-3890.442) (-3887.442) (-3893.479) -- 0:00:06 978500 -- [-3883.531] (-3884.418) (-3887.474) (-3884.360) * [-3883.774] (-3887.445) (-3881.716) (-3885.919) -- 0:00:06 979000 -- (-3881.862) (-3881.966) [-3883.280] (-3890.853) * (-3884.303) (-3880.519) (-3884.466) [-3888.108] -- 0:00:05 979500 -- (-3884.910) (-3879.686) (-3883.288) [-3886.919] * (-3883.434) [-3884.514] (-3889.038) (-3885.832) -- 0:00:05 980000 -- (-3887.088) [-3883.084] (-3882.115) (-3887.603) * (-3883.248) (-3890.584) (-3883.968) [-3884.592] -- 0:00:05 Average standard deviation of split frequencies: 0.000000 980500 -- (-3884.158) [-3882.731] (-3891.548) (-3887.861) * [-3884.980] (-3887.818) (-3882.287) (-3881.665) -- 0:00:05 981000 -- [-3885.691] (-3891.955) (-3881.015) (-3884.429) * [-3886.293] (-3893.633) (-3882.115) (-3893.138) -- 0:00:05 981500 -- (-3883.971) (-3885.916) (-3884.517) [-3886.331] * (-3883.067) [-3888.838] (-3883.914) (-3891.955) -- 0:00:05 982000 -- (-3885.286) (-3883.646) [-3882.403] (-3893.006) * (-3883.723) [-3884.439] (-3884.380) (-3886.626) -- 0:00:05 982500 -- [-3885.261] (-3886.897) (-3882.151) (-3885.137) * [-3882.454] (-3884.332) (-3885.112) (-3890.590) -- 0:00:04 983000 -- (-3884.426) (-3881.865) [-3879.357] (-3884.401) * [-3884.165] (-3885.858) (-3886.045) (-3883.606) -- 0:00:04 983500 -- [-3883.326] (-3884.943) (-3884.055) (-3882.723) * [-3887.148] (-3887.829) (-3889.783) (-3886.199) -- 0:00:04 984000 -- (-3894.071) (-3896.265) (-3883.853) [-3890.578] * [-3885.941] (-3891.028) (-3882.330) (-3890.910) -- 0:00:04 984500 -- (-3888.749) (-3888.872) (-3885.429) [-3883.225] * (-3885.365) (-3892.383) (-3879.332) [-3881.539] -- 0:00:04 985000 -- (-3882.286) (-3895.224) [-3885.719] (-3886.739) * (-3886.551) (-3883.934) [-3890.705] (-3884.055) -- 0:00:04 Average standard deviation of split frequencies: 0.000000 985500 -- (-3883.424) (-3889.898) [-3888.938] (-3882.470) * (-3881.234) (-3884.616) (-3884.149) [-3883.889] -- 0:00:04 986000 -- (-3888.982) (-3886.546) [-3886.680] (-3885.832) * [-3882.689] (-3883.471) (-3887.380) (-3891.276) -- 0:00:03 986500 -- (-3886.216) (-3883.498) [-3885.003] (-3887.027) * (-3891.482) [-3887.673] (-3881.765) (-3892.939) -- 0:00:03 987000 -- [-3883.679] (-3884.132) (-3883.136) (-3889.066) * [-3887.255] (-3886.658) (-3886.545) (-3880.546) -- 0:00:03 987500 -- [-3882.955] (-3885.713) (-3887.135) (-3882.950) * (-3886.932) (-3889.624) (-3884.737) [-3880.881] -- 0:00:03 988000 -- (-3888.175) (-3884.762) [-3888.465] (-3888.415) * (-3889.834) (-3883.650) (-3888.315) [-3880.851] -- 0:00:03 988500 -- [-3880.532] (-3886.839) (-3889.126) (-3885.143) * (-3884.181) [-3893.016] (-3888.185) (-3882.059) -- 0:00:03 989000 -- (-3888.943) (-3881.550) (-3886.485) [-3886.999] * (-3881.297) (-3891.705) [-3882.046] (-3890.197) -- 0:00:03 989500 -- (-3889.906) (-3887.214) [-3885.608] (-3881.398) * [-3881.920] (-3884.709) (-3889.608) (-3888.474) -- 0:00:02 990000 -- [-3884.229] (-3885.617) (-3881.838) (-3884.196) * (-3883.861) (-3886.855) [-3883.271] (-3882.088) -- 0:00:02 Average standard deviation of split frequencies: 0.000000 990500 -- (-3881.829) (-3889.737) (-3881.887) [-3882.572] * (-3880.687) [-3884.358] (-3882.977) (-3885.945) -- 0:00:02 991000 -- (-3890.392) [-3883.091] (-3894.711) (-3885.275) * (-3885.120) (-3884.800) (-3883.713) [-3886.243] -- 0:00:02 991500 -- (-3881.034) [-3885.034] (-3894.688) (-3883.163) * [-3892.925] (-3885.542) (-3883.175) (-3888.073) -- 0:00:02 992000 -- (-3891.344) (-3887.531) (-3890.276) [-3885.934] * (-3896.550) (-3886.054) (-3888.373) [-3883.221] -- 0:00:02 992500 -- (-3891.322) (-3888.476) [-3880.178] (-3883.194) * (-3884.150) (-3894.935) [-3885.354] (-3888.696) -- 0:00:02 993000 -- (-3890.919) (-3891.509) [-3881.961] (-3885.661) * (-3887.605) (-3890.185) (-3888.176) [-3885.118] -- 0:00:01 993500 -- [-3881.302] (-3887.409) (-3885.831) (-3882.245) * (-3888.743) (-3883.466) (-3889.572) [-3883.651] -- 0:00:01 994000 -- (-3882.264) (-3889.547) [-3887.331] (-3890.422) * [-3887.071] (-3886.782) (-3882.979) (-3887.952) -- 0:00:01 994500 -- (-3884.933) (-3886.631) (-3889.669) [-3882.823] * [-3883.790] (-3882.579) (-3881.048) (-3888.975) -- 0:00:01 995000 -- (-3894.170) (-3887.229) [-3886.945] (-3883.622) * (-3888.059) (-3887.644) (-3885.368) [-3883.138] -- 0:00:01 Average standard deviation of split frequencies: 0.000000 995500 -- (-3890.211) (-3886.500) (-3887.415) [-3890.397] * (-3886.670) (-3894.235) [-3884.265] (-3881.703) -- 0:00:01 996000 -- [-3889.379] (-3886.167) (-3896.114) (-3883.724) * [-3883.169] (-3888.349) (-3883.786) (-3883.387) -- 0:00:01 996500 -- (-3893.316) [-3882.885] (-3884.452) (-3883.129) * (-3888.478) (-3885.894) (-3888.403) [-3887.776] -- 0:00:00 997000 -- (-3885.369) [-3884.069] (-3886.039) (-3884.427) * (-3882.510) [-3886.523] (-3887.635) (-3884.894) -- 0:00:00 997500 -- (-3885.498) [-3887.962] (-3891.215) (-3886.415) * (-3883.616) (-3886.626) (-3885.234) [-3886.059] -- 0:00:00 998000 -- [-3882.877] (-3885.261) (-3886.520) (-3889.639) * (-3885.361) (-3886.979) (-3881.955) [-3884.140] -- 0:00:00 998500 -- (-3889.910) [-3884.813] (-3889.343) (-3881.095) * [-3882.824] (-3884.780) (-3884.703) (-3884.586) -- 0:00:00 999000 -- (-3884.865) (-3886.140) [-3889.561] (-3882.427) * (-3879.647) (-3883.469) [-3887.729] (-3895.286) -- 0:00:00 999500 -- [-3884.878] (-3889.373) (-3885.157) (-3884.841) * (-3883.529) [-3885.863] (-3893.271) (-3891.084) -- 0:00:00 1000000 -- (-3884.385) (-3893.555) (-3885.867) [-3882.124] * (-3886.951) (-3887.236) [-3885.807] (-3890.664) -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3884.385250 -- 15.063259 Chain 1 -- -3884.385249 -- 15.063259 Chain 2 -- -3893.555182 -- 17.167596 Chain 2 -- -3893.555182 -- 17.167596 Chain 3 -- -3885.867417 -- 5.509547 Chain 3 -- -3885.867416 -- 5.509547 Chain 4 -- -3882.124123 -- 13.382187 Chain 4 -- -3882.124125 -- 13.382187 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3886.950523 -- 13.503885 Chain 1 -- -3886.950523 -- 13.503885 Chain 2 -- -3887.236389 -- 16.349981 Chain 2 -- -3887.236389 -- 16.349981 Chain 3 -- -3885.806530 -- 12.220700 Chain 3 -- -3885.806530 -- 12.220700 Chain 4 -- -3890.663800 -- 17.064563 Chain 4 -- -3890.663800 -- 17.064563 Analysis completed in 4 mins 43 seconds Analysis used 283.69 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3877.22 Likelihood of best state for "cold" chain of run 2 was -3877.27 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 40.9 % ( 31 %) Dirichlet(Revmat{all}) 57.2 % ( 47 %) Slider(Revmat{all}) 21.1 % ( 26 %) Dirichlet(Pi{all}) 25.3 % ( 27 %) Slider(Pi{all}) 56.4 % ( 31 %) Multiplier(Alpha{1,2}) 52.7 % ( 21 %) Multiplier(Alpha{3}) 75.3 % ( 51 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.0 % ( 25 %) Multiplier(V{all}) 15.5 % ( 14 %) Nodeslider(V{all}) 24.9 % ( 23 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 40.5 % ( 33 %) Dirichlet(Revmat{all}) 57.9 % ( 42 %) Slider(Revmat{all}) 21.0 % ( 21 %) Dirichlet(Pi{all}) 25.0 % ( 23 %) Slider(Pi{all}) 55.8 % ( 28 %) Multiplier(Alpha{1,2}) 52.8 % ( 22 %) Multiplier(Alpha{3}) 74.8 % ( 56 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.0 % ( 30 %) Multiplier(V{all}) 15.4 % ( 14 %) Nodeslider(V{all}) 24.8 % ( 27 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.84 0.69 0.57 2 | 166576 0.85 0.71 3 | 166616 166575 0.86 4 | 167175 166505 166553 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.83 0.69 0.56 2 | 166280 0.85 0.71 3 | 167341 166319 0.86 4 | 166902 166736 166422 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3883.59 | 1 1 | | 2 1 1 2 | | 21 1 | | 2 12 1 2 2 1 2 | | 1 1 2 1 2 2 1 1 1 11 | | 1 2 112 21 1 2 1 22 12 1* 2 | | 2 21 2 * 1 2 1 1 1 212 1 1 1| | 11 221 1 1 2 2 1 12 2 21 12 2| | 2 2 1 11 2 1 2 2 1 | | 121 22 * 2 2 2 1 2 | | 2 2 1 2 12 2 2 2 | |1 2 1 2 | |2 1 2 | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3886.39 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3882.16 -3889.71 2 -3882.47 -3890.31 -------------------------------------- TOTAL -3882.30 -3890.05 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.192018 0.000230 0.164019 0.223078 0.191201 1501.00 1501.00 1.000 r(A<->C){all} 0.094366 0.000348 0.060480 0.131674 0.093236 1010.08 1125.91 1.000 r(A<->G){all} 0.266440 0.000907 0.210801 0.327079 0.265084 1121.78 1126.55 1.000 r(A<->T){all} 0.105062 0.000300 0.071603 0.138665 0.104578 1210.21 1230.27 1.000 r(C<->G){all} 0.099944 0.000650 0.055093 0.154201 0.097318 957.00 961.47 1.000 r(C<->T){all} 0.314798 0.001116 0.251491 0.382323 0.314590 1091.55 1092.00 1.000 r(G<->T){all} 0.119390 0.000546 0.075072 0.164635 0.118413 1123.00 1174.28 1.000 pi(A){all} 0.344832 0.000119 0.324132 0.366266 0.344944 1144.65 1202.19 1.001 pi(C){all} 0.199577 0.000081 0.183092 0.217414 0.199489 1042.93 1137.10 1.001 pi(G){all} 0.189009 0.000080 0.171448 0.205791 0.189023 1052.59 1247.20 1.000 pi(T){all} 0.266582 0.000097 0.246605 0.285338 0.266432 1152.41 1212.68 1.000 alpha{1,2} 0.336077 0.054126 0.000227 0.724996 0.289816 1272.04 1314.83 1.000 alpha{3} 1.336119 0.394169 0.389948 2.634542 1.199624 1228.14 1315.02 1.000 pinvar{all} 0.133372 0.009649 0.000012 0.322162 0.116036 1247.67 1251.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 Key to taxon bipartitions (saved to file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------- 1 -- .**** 2 -- .*... 3 -- ..*.. 4 -- ...*. 5 -- ....* 6 -- ...** 7 -- .**.. ----------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 6 3002 1.000000 0.000000 1.000000 1.000000 2 7 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.019216 0.000016 0.011752 0.027008 0.019037 1.000 2 length{all}[2] 0.003514 0.000002 0.001005 0.006576 0.003312 1.000 2 length{all}[3] 0.003046 0.000002 0.000688 0.005923 0.002830 1.002 2 length{all}[4] 0.047105 0.000049 0.033840 0.060909 0.046866 1.000 2 length{all}[5] 0.034275 0.000033 0.023870 0.046079 0.033991 1.000 2 length{all}[6] 0.061182 0.000068 0.045975 0.077206 0.060556 1.000 2 length{all}[7] 0.023680 0.000020 0.015129 0.032108 0.023404 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.002 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------ C2 (2) |----------------100----------------+ + \------------------------------------ C3 (3) | | /------------------------------------ C4 (4) \----------------100----------------+ \------------------------------------ C5 (5) Phylogram (based on average branch lengths): /------------- C1 (1) | | /-- C2 (2) |---------------+ + \-- C3 (3) | | /------------------------------- C4 (4) \----------------------------------------+ \---------------------- C5 (5) |------------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 5 ls = 1773 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Sites with gaps or missing data are removed. 18 ambiguity characters in seq. 1 21 ambiguity characters in seq. 2 21 ambiguity characters in seq. 3 12 ambiguity characters in seq. 4 12 ambiguity characters in seq. 5 8 sites are removed. 20 21 91 273 308 589 590 591 Sequences read.. Counting site patterns.. 0:00 252 patterns at 583 / 583 sites (100.0%), 0:00 Counting codons.. 80 bytes for distance 245952 bytes for conP 34272 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), (4, 5)); MP score: 257 368928 bytes for conP, adjusted 0.053192 0.062442 0.007475 0.008015 0.144347 0.122817 0.091151 0.300000 1.300000 ntime & nrate & np: 7 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 9 lnL0 = -3969.097381 Iterating by ming2 Initial: fx= 3969.097381 x= 0.05319 0.06244 0.00748 0.00802 0.14435 0.12282 0.09115 0.30000 1.30000 1 h-m-p 0.0000 0.0001 373.4804 +CCYCCC 3962.019709 5 0.0001 25 | 0/9 2 h-m-p 0.0000 0.0005 4994.1394 +YYCCC 3929.282757 4 0.0001 44 | 0/9 3 h-m-p 0.0000 0.0002 1222.2209 +CYYCYCCC 3878.250495 7 0.0002 68 | 0/9 4 h-m-p 0.0001 0.0006 285.8294 CCCCC 3873.311841 4 0.0002 88 | 0/9 5 h-m-p 0.0003 0.0014 193.3719 YCC 3871.359458 2 0.0002 103 | 0/9 6 h-m-p 0.0003 0.0026 128.2812 CCCC 3869.460955 3 0.0004 121 | 0/9 7 h-m-p 0.0002 0.0046 245.1760 ++YYYYYYCC 3834.653830 7 0.0032 143 | 0/9 8 h-m-p 0.0000 0.0001 2393.7070 YCCCCCC 3831.188507 6 0.0000 166 | 0/9 9 h-m-p 0.0178 0.0890 2.8742 YC 3831.095467 1 0.0028 179 | 0/9 10 h-m-p 0.0048 0.1724 1.6673 ++YCYCCCC 3805.791171 6 0.0926 203 | 0/9 11 h-m-p 1.5246 8.0000 0.1013 CYCCC 3800.444014 4 1.0773 222 | 0/9 12 h-m-p 0.2303 1.1515 0.2285 +YCYCCC 3796.608759 5 0.6307 252 | 0/9 13 h-m-p 0.7419 4.7017 0.1942 YCCCC 3791.893486 4 1.3305 280 | 0/9 14 h-m-p 0.9237 4.6185 0.1471 CCC 3789.277621 2 1.4216 305 | 0/9 15 h-m-p 1.5570 7.7850 0.1155 CCCC 3787.436973 3 1.6857 332 | 0/9 16 h-m-p 1.6000 8.0000 0.0270 CC 3787.189529 1 1.5870 355 | 0/9 17 h-m-p 1.3581 8.0000 0.0315 CC 3787.122177 1 2.0761 378 | 0/9 18 h-m-p 1.6000 8.0000 0.0079 YC 3787.116939 1 1.1228 400 | 0/9 19 h-m-p 1.6000 8.0000 0.0011 Y 3787.116875 0 1.0923 421 | 0/9 20 h-m-p 1.6000 8.0000 0.0000 Y 3787.116874 0 1.1354 442 | 0/9 21 h-m-p 1.2977 8.0000 0.0000 Y 3787.116874 0 0.8450 463 | 0/9 22 h-m-p 1.6000 8.0000 0.0000 Y 3787.116874 0 1.6000 484 | 0/9 23 h-m-p 1.6000 8.0000 0.0000 Y 3787.116874 0 0.6896 505 | 0/9 24 h-m-p 1.3331 8.0000 0.0000 ----------------.. | 0/9 25 h-m-p 0.0160 8.0000 0.0005 ------------- | 0/9 26 h-m-p 0.0160 8.0000 0.0005 ------------- Out.. lnL = -3787.116874 605 lfun, 605 eigenQcodon, 4235 P(t) Time used: 0:02 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), (4, 5)); MP score: 257 0.053192 0.062442 0.007475 0.008015 0.144347 0.122817 0.091151 1.992084 0.573207 0.492243 ntime & nrate & np: 7 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.044816 np = 10 lnL0 = -3801.322332 Iterating by ming2 Initial: fx= 3801.322332 x= 0.05319 0.06244 0.00748 0.00802 0.14435 0.12282 0.09115 1.99208 0.57321 0.49224 1 h-m-p 0.0000 0.0001 137.0013 YC 3801.126150 1 0.0000 26 | 0/10 2 h-m-p 0.0000 0.0065 113.7314 ++CYC 3799.108557 2 0.0005 54 | 0/10 3 h-m-p 0.0000 0.0001 474.2016 CYCCC 3798.536737 4 0.0000 84 | 0/10 4 h-m-p 0.0000 0.0010 453.7381 ++YYCCC 3791.016225 4 0.0004 115 | 0/10 5 h-m-p 0.0000 0.0002 1548.9559 YCYCCCC 3783.770888 6 0.0001 148 | 0/10 6 h-m-p 0.0004 0.0022 58.7137 CC 3783.577452 1 0.0002 173 | 0/10 7 h-m-p 0.0002 0.0045 41.9886 CC 3783.427887 1 0.0003 198 | 0/10 8 h-m-p 0.0003 0.0044 41.6462 +CCC 3782.698973 2 0.0018 226 | 0/10 9 h-m-p 0.0031 0.0153 12.9648 YC 3782.661581 1 0.0005 250 | 0/10 10 h-m-p 0.0017 0.8642 4.6574 +++CYC 3780.241119 2 0.1322 279 | 0/10 11 h-m-p 0.2674 1.3372 1.0661 YCCC 3772.630357 3 0.6390 307 | 0/10 12 h-m-p 0.6046 3.0229 0.1221 YC 3772.325484 1 1.0357 331 | 0/10 13 h-m-p 0.5043 2.5215 0.0575 CC 3772.279987 1 0.7043 356 | 0/10 14 h-m-p 0.5779 2.8894 0.0157 CC 3772.267096 1 0.8321 381 | 0/10 15 h-m-p 1.1212 5.6062 0.0084 C 3772.264561 0 1.0046 404 | 0/10 16 h-m-p 1.6000 8.0000 0.0010 C 3772.264481 0 1.3905 427 | 0/10 17 h-m-p 1.6000 8.0000 0.0003 C 3772.264471 0 1.2896 450 | 0/10 18 h-m-p 1.6000 8.0000 0.0000 Y 3772.264471 0 1.0595 473 | 0/10 19 h-m-p 1.6000 8.0000 0.0000 C 3772.264471 0 1.4478 496 | 0/10 20 h-m-p 1.6000 8.0000 0.0000 Y 3772.264471 0 1.0029 519 | 0/10 21 h-m-p 1.6000 8.0000 0.0000 -----Y 3772.264471 0 0.0004 547 Out.. lnL = -3772.264471 548 lfun, 1644 eigenQcodon, 7672 P(t) Time used: 0:06 Model 2: PositiveSelection TREE # 1 (1, (2, 3), (4, 5)); MP score: 257 initial w for M2:NSpselection reset. 0.053192 0.062442 0.007475 0.008015 0.144347 0.122817 0.091151 2.058053 0.986220 0.117156 0.463564 2.408838 ntime & nrate & np: 7 3 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.619911 np = 12 lnL0 = -3809.467427 Iterating by ming2 Initial: fx= 3809.467427 x= 0.05319 0.06244 0.00748 0.00802 0.14435 0.12282 0.09115 2.05805 0.98622 0.11716 0.46356 2.40884 1 h-m-p 0.0000 0.0002 161.5793 +YCCC 3809.079293 3 0.0000 35 | 0/12 2 h-m-p 0.0000 0.0022 199.4106 +YCCC 3807.359082 3 0.0002 68 | 0/12 3 h-m-p 0.0000 0.0001 255.8636 CYCCC 3807.016924 4 0.0000 102 | 0/12 4 h-m-p 0.0000 0.0015 170.9821 +YCCC 3804.762997 3 0.0004 135 | 0/12 5 h-m-p 0.0002 0.0014 299.4658 ++ 3787.273105 m 0.0014 162 | 1/12 6 h-m-p 0.0020 0.0283 78.2623 YCC 3786.463169 2 0.0016 192 | 1/12 7 h-m-p 0.0007 0.0033 77.2182 CCC 3786.318925 2 0.0003 222 | 1/12 8 h-m-p 0.0009 0.0248 22.0762 YCC 3785.959193 2 0.0015 251 | 0/12 9 h-m-p 0.0007 0.0218 49.1170 +CYCC 3783.145517 3 0.0033 283 | 0/12 10 h-m-p 0.0022 0.0111 68.2294 CCCCC 3779.707372 4 0.0027 318 | 0/12 11 h-m-p 0.0357 0.2569 5.0952 +YCCC 3776.921645 3 0.1911 351 | 0/12 12 h-m-p 0.1208 0.6038 1.5900 +YCCC 3774.285070 3 0.3743 384 | 0/12 13 h-m-p 0.0528 0.2638 2.0183 +YCCC 3772.432921 3 0.1649 417 | 0/12 14 h-m-p 0.0597 0.2986 0.5069 ++ 3772.348358 m 0.2986 444 | 1/12 15 h-m-p 0.7221 3.9702 0.1435 CYC 3772.274637 2 0.6753 474 | 1/12 16 h-m-p 1.6000 8.0000 0.0429 YC 3772.265158 1 1.0988 501 | 1/12 17 h-m-p 1.6000 8.0000 0.0115 C 3772.264540 0 1.6816 527 | 1/12 18 h-m-p 1.6000 8.0000 0.0026 Y 3772.264474 0 1.0763 553 | 1/12 19 h-m-p 1.6000 8.0000 0.0004 Y 3772.264471 0 1.0202 579 | 1/12 20 h-m-p 1.6000 8.0000 0.0000 Y 3772.264471 0 0.8888 605 | 1/12 21 h-m-p 1.6000 8.0000 0.0000 Y 3772.264471 0 1.2328 631 | 1/12 22 h-m-p 1.6000 8.0000 0.0000 Y 3772.264471 0 0.4000 657 | 1/12 23 h-m-p 0.5387 8.0000 0.0000 -C 3772.264471 0 0.0337 684 | 1/12 24 h-m-p 0.0160 8.0000 0.0000 Y 3772.264471 0 0.0160 710 | 1/12 25 h-m-p 0.1312 8.0000 0.0000 C 3772.264471 0 0.1312 736 | 1/12 26 h-m-p 0.1261 8.0000 0.0000 ----------C 3772.264471 0 0.0000 772 Out.. lnL = -3772.264471 773 lfun, 3092 eigenQcodon, 16233 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3780.226212 S = -3515.782684 -256.793657 Calculating f(w|X), posterior probabilities of site classes. did 10 / 252 patterns 0:15 did 20 / 252 patterns 0:15 did 30 / 252 patterns 0:15 did 40 / 252 patterns 0:15 did 50 / 252 patterns 0:15 did 60 / 252 patterns 0:15 did 70 / 252 patterns 0:15 did 80 / 252 patterns 0:15 did 90 / 252 patterns 0:15 did 100 / 252 patterns 0:15 did 110 / 252 patterns 0:15 did 120 / 252 patterns 0:15 did 130 / 252 patterns 0:15 did 140 / 252 patterns 0:15 did 150 / 252 patterns 0:15 did 160 / 252 patterns 0:15 did 170 / 252 patterns 0:15 did 180 / 252 patterns 0:15 did 190 / 252 patterns 0:15 did 200 / 252 patterns 0:15 did 210 / 252 patterns 0:16 did 220 / 252 patterns 0:16 did 230 / 252 patterns 0:16 did 240 / 252 patterns 0:16 did 250 / 252 patterns 0:16 did 252 / 252 patterns 0:16 Time used: 0:16 Model 3: discrete TREE # 1 (1, (2, 3), (4, 5)); MP score: 257 0.053192 0.062442 0.007475 0.008015 0.144347 0.122817 0.091151 2.058052 0.331355 0.382499 0.167910 0.419175 0.701861 ntime & nrate & np: 7 4 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 8.604328 np = 13 lnL0 = -3783.270713 Iterating by ming2 Initial: fx= 3783.270713 x= 0.05319 0.06244 0.00748 0.00802 0.14435 0.12282 0.09115 2.05805 0.33136 0.38250 0.16791 0.41918 0.70186 1 h-m-p 0.0000 0.0001 136.9110 YC 3783.084523 1 0.0000 32 | 0/13 2 h-m-p 0.0000 0.0035 99.6937 +YCCC 3782.243197 3 0.0002 67 | 0/13 3 h-m-p 0.0000 0.0002 115.0690 YYC 3782.139281 2 0.0000 98 | 0/13 4 h-m-p 0.0000 0.0011 171.2670 +YCCC 3781.374440 3 0.0002 133 | 0/13 5 h-m-p 0.0001 0.0007 187.4698 ++ 3777.172577 m 0.0007 162 | 1/13 6 h-m-p 0.0010 0.0076 55.2938 CCCC 3776.642341 3 0.0017 197 | 1/13 7 h-m-p 0.0004 0.0020 169.8912 YCC 3776.443517 2 0.0002 228 | 1/13 8 h-m-p 0.0016 0.0240 22.2168 CC 3776.183274 1 0.0024 258 | 1/13 9 h-m-p 0.0005 0.0046 117.2186 +YCCC 3775.328410 3 0.0014 292 | 1/13 10 h-m-p 0.0662 0.3710 2.4892 YYC 3774.293396 2 0.0560 322 | 0/13 11 h-m-p 0.0047 0.0598 29.4293 YCCC 3773.764775 3 0.0020 355 | 0/13 12 h-m-p 0.0193 0.4563 2.9974 ++YCCC 3772.675831 3 0.2237 391 | 0/13 13 h-m-p 0.1469 0.7346 0.2742 +YCCC 3772.469463 3 0.4758 426 | 0/13 14 h-m-p 0.0404 0.2022 0.6844 +CC 3772.371000 1 0.1485 458 | 0/13 15 h-m-p 0.0931 0.4656 0.7824 YCCC 3772.304002 3 0.1995 492 | 0/13 16 h-m-p 0.1416 0.7078 0.0970 ++ 3772.273887 m 0.7078 521 | 1/13 17 h-m-p 0.1389 0.9280 0.4906 C 3772.266037 0 0.1320 550 | 1/13 18 h-m-p 0.4195 2.0976 0.0917 ++ 3772.211983 m 2.0976 578 | 2/13 19 h-m-p 0.6843 8.0000 0.2712 YC 3772.205826 1 0.1227 607 | 2/13 20 h-m-p 1.2379 8.0000 0.0269 CC 3772.189459 1 0.9907 636 | 2/13 21 h-m-p 1.2344 8.0000 0.0216 +YC 3772.187357 1 3.1893 665 | 2/13 22 h-m-p 1.6000 8.0000 0.0390 CC 3772.185698 1 2.1910 694 | 2/13 23 h-m-p 1.6000 8.0000 0.0077 YC 3772.185479 1 1.1092 722 | 2/13 24 h-m-p 0.6218 8.0000 0.0137 Y 3772.185447 0 1.0891 749 | 2/13 25 h-m-p 1.6000 8.0000 0.0018 Y 3772.185444 0 1.0484 776 | 2/13 26 h-m-p 1.6000 8.0000 0.0002 Y 3772.185444 0 1.0870 803 | 2/13 27 h-m-p 1.6000 8.0000 0.0000 Y 3772.185444 0 1.6000 830 | 2/13 28 h-m-p 1.6000 8.0000 0.0000 ---------Y 3772.185444 0 0.0000 866 Out.. lnL = -3772.185444 867 lfun, 3468 eigenQcodon, 18207 P(t) Time used: 0:25 Model 7: beta TREE # 1 (1, (2, 3), (4, 5)); MP score: 257 0.053192 0.062442 0.007475 0.008015 0.144347 0.122817 0.091151 2.040100 0.665673 1.549129 ntime & nrate & np: 7 1 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 10.171969 np = 10 lnL0 = -3778.474608 Iterating by ming2 Initial: fx= 3778.474608 x= 0.05319 0.06244 0.00748 0.00802 0.14435 0.12282 0.09115 2.04010 0.66567 1.54913 1 h-m-p 0.0000 0.0001 137.1878 YC 3778.281247 1 0.0000 26 | 0/10 2 h-m-p 0.0000 0.0052 103.1061 +CCC 3777.651281 2 0.0002 54 | 0/10 3 h-m-p 0.0000 0.0002 65.5274 YC 3777.620633 1 0.0000 78 | 0/10 4 h-m-p 0.0000 0.0025 43.0853 +CC 3777.556472 1 0.0001 104 | 0/10 5 h-m-p 0.0005 0.0162 8.8677 YC 3777.546213 1 0.0003 128 | 0/10 6 h-m-p 0.0004 0.0773 6.2585 +CC 3777.520545 1 0.0019 154 | 0/10 7 h-m-p 0.0002 0.0305 59.9708 +CC 3777.378797 1 0.0011 180 | 0/10 8 h-m-p 0.0024 0.0308 28.2779 YC 3777.357905 1 0.0004 204 | 0/10 9 h-m-p 0.0017 0.2614 6.3428 +++YYYYYCYCYC 3775.543241 10 0.1456 242 | 0/10 10 h-m-p 0.0065 0.0323 24.0332 +YCYC 3774.741068 3 0.0184 270 | 0/10 11 h-m-p 0.0103 0.0517 6.2958 CCYCC 3774.089191 4 0.0301 302 | 0/10 12 h-m-p 0.0762 0.3812 0.5719 YCCCCC 3773.810340 5 0.1094 334 | 0/10 13 h-m-p 0.0309 8.0000 2.0246 +YYCC 3772.425248 3 0.1781 362 | 0/10 14 h-m-p 1.2464 6.2320 0.0289 CYC 3772.296945 2 2.2386 388 | 0/10 15 h-m-p 0.5503 2.7514 0.0395 YCYCCC 3772.258835 5 0.8615 419 | 0/10 16 h-m-p 0.6651 3.3257 0.0206 YYYCCC 3772.221797 5 0.8637 449 | 0/10 17 h-m-p 1.6000 8.0000 0.0043 CC 3772.220337 1 1.3176 474 | 0/10 18 h-m-p 1.6000 8.0000 0.0008 C 3772.220299 0 0.4130 497 | 0/10 19 h-m-p 0.3750 8.0000 0.0009 +Y 3772.220274 0 1.1616 521 | 0/10 20 h-m-p 1.6000 8.0000 0.0001 C 3772.220274 0 1.3352 544 | 0/10 21 h-m-p 1.6000 8.0000 0.0000 C 3772.220273 0 2.2961 567 | 0/10 22 h-m-p 1.6000 8.0000 0.0000 -Y 3772.220273 0 0.0540 591 | 0/10 23 h-m-p 0.0579 8.0000 0.0000 -Y 3772.220273 0 0.0024 615 | 0/10 24 h-m-p 0.0160 8.0000 0.0000 ++C 3772.220273 0 0.3286 640 | 0/10 25 h-m-p 0.3319 8.0000 0.0000 --------C 3772.220273 0 0.0000 671 Out.. lnL = -3772.220273 672 lfun, 7392 eigenQcodon, 47040 P(t) Time used: 0:49 Model 8: beta&w>1 TREE # 1 (1, (2, 3), (4, 5)); MP score: 257 initial w for M8:NSbetaw>1 reset. 0.053192 0.062442 0.007475 0.008015 0.144347 0.122817 0.091151 2.047978 0.900000 0.401601 1.403915 2.022819 ntime & nrate & np: 7 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 8.643672 np = 12 lnL0 = -3775.482688 Iterating by ming2 Initial: fx= 3775.482688 x= 0.05319 0.06244 0.00748 0.00802 0.14435 0.12282 0.09115 2.04798 0.90000 0.40160 1.40392 2.02282 1 h-m-p 0.0000 0.0001 143.6695 +YYC 3775.180655 2 0.0000 32 | 0/12 2 h-m-p 0.0000 0.0063 177.6202 +CYCC 3774.077198 3 0.0001 65 | 0/12 3 h-m-p 0.0000 0.0001 204.7811 YYCC 3773.905954 3 0.0000 96 | 0/12 4 h-m-p 0.0001 0.0025 43.1063 YCC 3773.783997 2 0.0002 126 | 0/12 5 h-m-p 0.0006 0.0128 11.9748 YC 3773.762007 1 0.0003 154 | 0/12 6 h-m-p 0.0005 0.0845 7.4966 YC 3773.736881 1 0.0012 182 | 0/12 7 h-m-p 0.0004 0.0175 20.4874 CC 3773.717770 1 0.0004 211 | 0/12 8 h-m-p 0.0006 0.0223 13.1101 +CC 3773.659331 1 0.0022 241 | 0/12 9 h-m-p 0.0012 0.0092 24.9846 YC 3773.635004 1 0.0005 269 | 0/12 10 h-m-p 0.0072 0.5947 1.7974 +++YCYC 3772.968502 3 0.3559 303 | 0/12 11 h-m-p 0.0533 0.2667 1.9831 CCC 3772.890833 2 0.0705 334 | 0/12 12 h-m-p 0.4616 4.5455 0.3030 CCCC 3772.758815 3 0.7830 367 | 0/12 13 h-m-p 0.3438 1.7189 0.6007 +YYCCC 3772.509067 4 1.0985 401 | 0/12 14 h-m-p 0.0630 0.3152 1.1828 YYYYC 3772.477971 4 0.0633 432 | 0/12 15 h-m-p 0.1169 0.5846 0.5541 +CYC 3772.297362 2 0.4841 463 | 0/12 16 h-m-p 0.0474 0.2371 0.2293 +YYC 3772.268932 2 0.1729 493 | 0/12 17 h-m-p 0.0280 0.1402 0.1019 ++ 3772.263267 m 0.1402 520 | 1/12 18 h-m-p 0.0295 7.6270 0.2768 YC 3772.258640 1 0.0674 548 | 1/12 19 h-m-p 1.6000 8.0000 0.0060 YC 3772.254671 1 2.9743 575 | 1/12 20 h-m-p 0.5723 8.0000 0.0312 YYY 3772.251181 2 0.5181 603 | 1/12 21 h-m-p 0.4614 4.2102 0.0350 C 3772.245696 0 0.4614 629 | 1/12 22 h-m-p 0.4970 2.9356 0.0325 YCCYC 3772.231877 4 0.7155 661 | 1/12 23 h-m-p 1.2573 8.0000 0.0185 YC 3772.222971 1 0.7114 688 | 1/12 24 h-m-p 1.5437 7.7595 0.0085 Y 3772.222560 0 0.3859 714 | 1/12 25 h-m-p 0.6989 8.0000 0.0047 C 3772.222293 0 0.9460 740 | 1/12 26 h-m-p 1.6000 8.0000 0.0011 +Y 3772.222106 0 5.2693 767 | 1/12 27 h-m-p 1.6000 8.0000 0.0032 +YC 3772.221465 1 4.0720 795 | 1/12 28 h-m-p 1.0345 5.1726 0.0120 Y 3772.221069 0 1.0345 821 | 1/12 29 h-m-p 1.6000 8.0000 0.0032 Y 3772.220938 0 0.6465 847 | 1/12 30 h-m-p 0.4700 8.0000 0.0045 +Y 3772.220820 0 1.8799 874 | 1/12 31 h-m-p 1.6000 8.0000 0.0009 C 3772.220802 0 1.6000 900 | 1/12 32 h-m-p 1.6000 8.0000 0.0009 ----------Y 3772.220802 0 0.0000 936 Out.. lnL = -3772.220802 937 lfun, 11244 eigenQcodon, 72149 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3779.707911 S = -3516.033700 -256.913309 Calculating f(w|X), posterior probabilities of site classes. did 10 / 252 patterns 1:26 did 20 / 252 patterns 1:26 did 30 / 252 patterns 1:26 did 40 / 252 patterns 1:26 did 50 / 252 patterns 1:27 did 60 / 252 patterns 1:27 did 70 / 252 patterns 1:27 did 80 / 252 patterns 1:27 did 90 / 252 patterns 1:27 did 100 / 252 patterns 1:28 did 110 / 252 patterns 1:28 did 120 / 252 patterns 1:28 did 130 / 252 patterns 1:28 did 140 / 252 patterns 1:28 did 150 / 252 patterns 1:28 did 160 / 252 patterns 1:29 did 170 / 252 patterns 1:29 did 180 / 252 patterns 1:29 did 190 / 252 patterns 1:29 did 200 / 252 patterns 1:29 did 210 / 252 patterns 1:30 did 220 / 252 patterns 1:30 did 230 / 252 patterns 1:30 did 240 / 252 patterns 1:30 did 250 / 252 patterns 1:30 did 252 / 252 patterns 1:30 Time used: 1:31 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=591 D_melanogaster_Zyx-PB MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR D_sechellia_Zyx-PB MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR D_simulans_Zyx-PB MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR D_yakuba_Zyx-PB MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR D_erecta_Zyx-PB MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR *******:: :**.*.: ** *********::*.:**:.** *: :* D_melanogaster_Zyx-PB LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK D_sechellia_Zyx-PB LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK D_simulans_Zyx-PB LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK D_yakuba_Zyx-PB SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK D_erecta_Zyx-PB LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK * *** ****:*********** *************.** : ****** D_melanogaster_Zyx-PB YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK D_sechellia_Zyx-PB YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK D_simulans_Zyx-PB YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK D_yakuba_Zyx-PB YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK D_erecta_Zyx-PB YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK * :****.***::***:*****************************: ** D_melanogaster_Zyx-PB PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS D_sechellia_Zyx-PB PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS D_simulans_Zyx-PB PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS D_yakuba_Zyx-PB PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA D_erecta_Zyx-PB PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA ***..:**::************.**. ::. : ** *: * :*.**: D_melanogaster_Zyx-PB NVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSEL D_sechellia_Zyx-PB NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL D_simulans_Zyx-PB NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL D_yakuba_Zyx-PB NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL D_erecta_Zyx-PB NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL **:*:*:.*. **:*:*: *******:** *:****************** D_melanogaster_Zyx-PB RHATLEFNKPIDYLQNNQTTNP-LQIYANQYAMQHDATGKSSSTYDSIYE D_sechellia_Zyx-PB RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE D_simulans_Zyx-PB RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE D_yakuba_Zyx-PB RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE D_erecta_Zyx-PB RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE *:** ***********::*:** ********::***. .**: ******* D_melanogaster_Zyx-PB PINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIH D_sechellia_Zyx-PB PINPRPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH D_simulans_Zyx-PB PINPRPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH D_yakuba_Zyx-PB PINPRPS-ADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIH D_erecta_Zyx-PB PINPRPS-ADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIH ******. .* :***. *::****.*. *.*.:: ** ***:**** *** D_melanogaster_Zyx-PB GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLG D_sechellia_Zyx-PB GNAKTTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG D_simulans_Zyx-PB GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG D_yakuba_Zyx-PB GNARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLG D_erecta_Zyx-PB GNAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLG ***:*.**. .: ****:*****::**.*:****:*************** D_melanogaster_Zyx-PB ESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK D_sechellia_Zyx-PB ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK D_simulans_Zyx-PB ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK D_yakuba_Zyx-PB ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK D_erecta_Zyx-PB ESSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEK ************** ****:****************************** D_melanogaster_Zyx-PB CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI D_sechellia_Zyx-PB CSVCMEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI D_simulans_Zyx-PB CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI D_yakuba_Zyx-PB CSVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI D_erecta_Zyx-PB CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI *****:*********:********************************** D_melanogaster_Zyx-PB TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL D_sechellia_Zyx-PB TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL D_simulans_Zyx-PB TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL D_yakuba_Zyx-PB TDFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLL D_erecta_Zyx-PB TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL ******************** ***************************** D_melanogaster_Zyx-PB LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHoo- D_sechellia_Zyx-PB LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo D_simulans_Zyx-PB LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEHooo D_yakuba_Zyx-PB LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- D_erecta_Zyx-PB LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH--- ************************:******:******
>D_melanogaster_Zyx-PB ATGGAGTCTGTGGCCCAGCAACTTAGAGAGCTGTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCTTGTATGTATTGGACATGGAAAAGTTGCGA AGCTAGTCGCCAAGATAAGTAATAATCAAAATGCATCAGTAAAGAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTGTGTTCGCGGGAACCACTATATTCACAAC CTCTGATTGGAGTCGAGAAAACAATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATAAACAGAAAAAC AACTTTAGATAATCCGGCAATTTTGGAACAGCAATTAGAAGCTCTTGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTACAAGCTAAG CCAACACAACCTCTCAACAGCTTTACAAAGCCCCTTTCAAAGACTTTAAG CAAAAGCTTAATATATTCTAATTTAGGTTCTGTTCGCAAAGAAATAGAAA CATTAGAACTATTAACAGACGAAACTAAGATTTCTGCGAGTACATATTCA AACGTTAATGAAACTGCAATGGACTCTTCTCATAGCTCAACGCAAAAGAT GCTATCCGTCTGCACTAATTTTATTTCAGACAACGAAAAAGATGAGTTAC CGCCACCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA CCAGACAACGAATCCT---TTACAAATATATGCAAACCAATATGCGATGC AGCATGATGCCACAGGCAAGAGCTCTTCTACATATGATTCAATATATGAA CCTATAAACCCTCGACCCTGTGTTGCAGATACGCTGCCTCGTGAAAGTTA TAATCTGCATAATTCATACGTTAATGATAATAATCCAAACATTTCCCATG AATACAATATTTCGAATTCGATTGAAGCTAACCAAACACTATACATACAT GGTAATGCTAGAACTACATTTTATGACGTGAACAGCATCCATAGAAATGA TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG AATTGGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCACATATTTTGCTT CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCTTTCTATGCAT TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAG ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCATGT TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA TGACGTCAGAACAT--------- >D_sechellia_Zyx-PB ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCGAGATAAGTAAAAAGCAAAATGCATCATTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA TATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGCAATGGACTCTCCTCTTAGCTCAGCGCAAAAGAT GCTATTTGTCTGCACTAACTTTATTTCAGACAACGAAAAAGATGAGTTAC CGCCCCCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA CCAGACATCGAATCCT---TTGCAAATATATGCAAACCAATATGCGTTGC AACATGATGCCACAGGCAAGAGCTCTTATACATATGATTCAATATATGAA CCTATAAACCCTCGACCCTGTGTTGTAGATACGCTGCCTCGTGAAAGTTG TAATCTGCATAATTCATACGTCAATGATAATAATCCAAACATTTGCCATG AATACAATATTTCGAATTCGATTGATGCTAACCAAACACTATACATACAT GGTAATGCTAAAACTACATTTTATGACGTGAACACCATACATAGAAATGA TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG AATTTGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGCGGATGTACAGCAATGGATCAAATATACCACATATCTTGCTT CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCATTTTATGCAT TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTTCTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAG ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGT TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA TGACGTCAGAACAT--------- >D_simulans_Zyx-PB ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCAAGATAAGTAAAAAGCAAAATGCATCAGTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA CATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGCAATGGACTCTCCTCTTAGCTCAGCGCAAAAGAT GCTATTTGTCTGCACTAACTTTATTTCAGACAACGAAAAAGATGAGTTAC CGCCCCCACCTAGTCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTT CGTCACGCCACTTTGGAATTCAACAAACCAATTGATTATTTACAAAATAA CCAGACATCGAATCCT---TTGCAAATATATGCAAACCAATATGCGTTGC AACATGATGCCACAGGCAAGAGCTCTTATACATATGATTCAATATATGAA CCTATAAACCCTCGACCCTGTGTTGTAGATACGCTGCCTCGTGAAAATTG TAATCTGCATAATTCATACGTCAATGATAATAATCCAAACATTTGCCATG AATACAATATTTCGAATTCGATTGATGCTAACCAAACACTATACATACAT GGTAATGCTAGAACTACATTTTATGACGTGAACTCCATACATAGAAATGA TAAGGAAGGTCTAAAAAATTACATTTCAATACCCACCGAACCGGTTCAAG AATTTGAAAACTACGGTAGATGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGCGGATGTACAGCAATGGATCAAATATACCACATATCTTGCTT CACATGTACAGATTGCCAAATTAACTTACAGGGAAAACCATTTTATGCAT TAGACGGCAAACCCTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGACTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAG ATCGAAGTTTTCATCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGT TCTATGTAAAAGCTGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCA TGACGTCAGAACAT--------- >D_yakuba_Zyx-PB ATGGAGTCAGTGGCCCAGCAAATTAGAGAGATGTCGCTTTCAAAAGACGA AATATTAAAAAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTGGCAG AGTTAGTCGGCAAGATAAGTCAAAAGCAAAATGAATCTGTATACAGGAGA TCGGATACACCTCCTAAGCTGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCCGACAGGTTTCGTGTTCGAGGGAACCACTTTACTCACAAC CTCTGATTGGAGCCGAGAAAACAATAAGTGTGCATATGCCTTTTAGAAAA TACCATACCTCTGAATTTGGAGTTGCTGATACTGAAATAAACAGAAAATC AACTTTGGATAATCCAGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAGAAGGGTCTTTTGGGAGTACCAGCTAAA CCAACACAATCTTTCAACAGCTTTTCAGAGCCACTTTCAAAGACTTTAAG CAAAAGCTTAATATATTGTAATTTAGATTCTGTACACAAAAGTGAAAATA GATCAGAACTATTAACAGAGGAAACTCCGATTGCTGCAAATACATATGCA AATGTTCATGAAGCCGCAGTGGGCTCGTCTCATAGCTCAACTCAAAAGAT GATATCCGTCTGCACTAACTTTATTTCAAACAACGAAATAGATGACTTAC CGCCACCTCCTAGTCCAGAGAGCGCTGTGAGCTCTTCATACAGCGAGCTT CGGCGCGCCACTTCGGAATTTAACAAACCAATTGATTATTTGCAAAATGA CCAGACATCGAATCCTTCTTTGCAAATATATGCAAACCAATATTCGTTGC AGCATGATCCCATTAGCAAGAGCTCTTCAACATATGATTCAATATATGAA CCTATAAACCCACGACCCTCT---GCAGATATGTTTCCTCGTGAAAGTTG TAATATGTATAATTCATACGTCAATGATAATACTCCAAGCATTTCCAACA AATTAAATATTTTAAATTCGATCGAAGCGAACCAAACACTATACATACAT GGTAACGCTAGAACTAAATTTTATAAAGGGAGCACTGATCATAGAAATGA TAAGGAAGGTCTAAAAAACTACATTTCAATAACCACCGATCCAGTTCAAG AATTAGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTGCTTGGA GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCATATATCTTGCTT CACATGTACGGATTGCCAAATTAACTTACAGGGAAAACCATTCTATGCAC TAGACGGCAAACCTTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGCATGAAACCTATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTCGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCTCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCATTTCCAGGACAAGAAGAAACGATCAGGGTAGTGGCCCTAG ATCGAAGTTTTCACCTAGAATGTTATAAGTGCGAGGACTGCGGGCTTTTA CTGTCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGT TCTATGTAAAAGCTGCAATGCACAACGAGTTCAGGCTTTAACGAAGCGCA TGACATCAGAACAT--------- >D_erecta_Zyx-PB ATGGAGTCAGTGGCCCAGCAACTTAAAGAGCTGTCGCTTTCAAAAGACGA AACATTAAATAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTTGCAG AGTTAGTCGGCAAGATAAGTCAAAGGCAAAATGATTCCGTATATAAGAGA TTGGATACACCTCCTAAGCCGCCGATAAAATATAAGGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTATGTTCGCGGGAACCACTTTATTCACAAC CGCTGATTGGAGTCGAGAAAACAATAAGTGGGCATATGCCTTTTAGAAAA TACCTTAGCTCTGAATTCGGAGCTGCTGATACTGAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGTCTACAAGCTAAA CCAACACAATCTGTAAACAGCTTTTCAGAGCCTCTTTCAAAGACTTTGAG CAAAAGCTTAATATATTGCAATTTAGATTCTGTACACAAAAGTGCAGAAA GATCAGAACTATTTACAGAGACAACTAAGATTACTGCAAGTACATACGCA AATGTTCATGAAGCTGCAGTGGGCTCTTCTCTTAGCTCGACGCAAAATAT GATATCCGTCTGCACTAACTTTATTTCAGACAACGAAATAGATGACTTAC CGCCACCACCTAGTCCAGAAAGCGCTGTGAGTTCTTCATACAGCGAGCTT CGGCGTGCCACTTCGGAATTTAACAAGCCAATTGATTATTTGCAAAATGA CGAGACATCGAATCCTTCTTTACAAATATATGCAAACCAATATGCGTTGC AGCATGATGCCATAAGCAAGAGCACTTCTACATATGATTCAATATATGAG CCTATAAACCCGCGACCGTCT---GCAGATATGTTGCCTCGTGAAACTTG TAATCTGTATAATTCATACGTCAGTGATAGTATTCCAAGCATTTCCAATG AATTAAATATTTTAAATTCGATTGAAGCAAACCAAACAGCATACATACAT GGTAATGCTAAAACAAAATTTTATAACTTGAACACTGTCCATAGAAATGA TAATGAAGGTCTAAAAAACTTCGTTTCAATACCCACCGATCCAGTTCAAG AATTAGAAAACTACGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGA GAAAGTAGTGGATGTACAGCAATGGATCAAATATACCATATAACTTGCTT CACATGTGCAGATTGTCAAATTAATTTGCAGGGAAAACCATTCTATGCAT TAGACGGCAAACCGTATTGCGAATATGATTATTTACAAACACTGGAAAAA TGCTCTGTTTGTATGGAACCTATTTTAGAGAGAATTCTTAGAGCTACTGG AAAACCATATCATCCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCT TAGATGGGCTATTATTTACAGTTGATGCTACTAATCAAAACTATTGCATA ACAGATTTTCATAAAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACC AATTATGCCAGATCCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAG ATCGAAGTTTTCACCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTA CTATCATCTGAAGCTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGT TCTATGTAAAAGCTGTAATGCACAACGAGTTCAGGCTTTAACGAAGCGCA TGACGTCAGAACAT---------
>D_melanogaster_Zyx-PB MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTTNP-LQIYANQYAMQHDATGKSSSTYDSIYE PINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH >D_sechellia_Zyx-PB MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRESCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNAKTTFYDVNTIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRASGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH >D_simulans_Zyx-PB MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETAMDSPLSSAQKMLFVCTNFISDNEKDELPPPPSPESAVSSSYSEL RHATLEFNKPIDYLQNNQTSNP-LQIYANQYALQHDATGKSSYTYDSIYE PINPRPCVVDTLPRENCNLHNSYVNDNNPNICHEYNISNSIDANQTLYIH GNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQEFENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSEH >D_yakuba_Zyx-PB MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEAAVGSSHSSTQKMISVCTNFISNNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDQTSNPSLQIYANQYSLQHDPISKSSSTYDSIYE PINPRPS-ADMFPRESCNMYNSYVNDNTPSISNKLNILNSIEANQTLYIH GNARTKFYKGSTDHRNDKEGLKNYISITTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHISCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMKPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPFPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH >D_erecta_Zyx-PB MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEAAVGSSLSSTQNMISVCTNFISDNEIDDLPPPPSPESAVSSSYSEL RRATSEFNKPIDYLQNDETSNPSLQIYANQYALQHDAISKSTSTYDSIYE PINPRPS-ADMLPRETCNLYNSYVSDSIPSISNELNILNSIEANQTAYIH GNAKTKFYNLNTVHRNDNEGLKNFVSIPTDPVQELENYGRCVKCNSRVLG ESSGCTAMDQIYHITCFTCADCQINLQGKPFYALDGKPYCEYDYLQTLEK CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLL LSSEAEGRGCYPLDDHVLCKSCNAQRVQALTKRMTSEH
#NEXUS [ID: 1004151151] begin taxa; dimensions ntax=5; taxlabels D_melanogaster_Zyx-PB D_sechellia_Zyx-PB D_simulans_Zyx-PB D_yakuba_Zyx-PB D_erecta_Zyx-PB ; end; begin trees; translate 1 D_melanogaster_Zyx-PB, 2 D_sechellia_Zyx-PB, 3 D_simulans_Zyx-PB, 4 D_yakuba_Zyx-PB, 5 D_erecta_Zyx-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01903728,(2:0.003312495,3:0.0028302)1.000:0.02340386,(4:0.04686577,5:0.03399108)1.000:0.06055556); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01903728,(2:0.003312495,3:0.0028302):0.02340386,(4:0.04686577,5:0.03399108):0.06055556); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3882.16 -3889.71 2 -3882.47 -3890.31 -------------------------------------- TOTAL -3882.30 -3890.05 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/Zyx-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.192018 0.000230 0.164019 0.223078 0.191201 1501.00 1501.00 1.000 r(A<->C){all} 0.094366 0.000348 0.060480 0.131674 0.093236 1010.08 1125.91 1.000 r(A<->G){all} 0.266440 0.000907 0.210801 0.327079 0.265084 1121.78 1126.55 1.000 r(A<->T){all} 0.105062 0.000300 0.071603 0.138665 0.104578 1210.21 1230.27 1.000 r(C<->G){all} 0.099944 0.000650 0.055093 0.154201 0.097318 957.00 961.47 1.000 r(C<->T){all} 0.314798 0.001116 0.251491 0.382323 0.314590 1091.55 1092.00 1.000 r(G<->T){all} 0.119390 0.000546 0.075072 0.164635 0.118413 1123.00 1174.28 1.000 pi(A){all} 0.344832 0.000119 0.324132 0.366266 0.344944 1144.65 1202.19 1.001 pi(C){all} 0.199577 0.000081 0.183092 0.217414 0.199489 1042.93 1137.10 1.001 pi(G){all} 0.189009 0.000080 0.171448 0.205791 0.189023 1052.59 1247.20 1.000 pi(T){all} 0.266582 0.000097 0.246605 0.285338 0.266432 1152.41 1212.68 1.000 alpha{1,2} 0.336077 0.054126 0.000227 0.724996 0.289816 1272.04 1314.83 1.000 alpha{3} 1.336119 0.394169 0.389948 2.634542 1.199624 1228.14 1315.02 1.000 pinvar{all} 0.133372 0.009649 0.000012 0.322162 0.116036 1247.67 1251.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/444/Zyx-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 5 ls = 583 Codon usage in sequences ---------------------------------------------------------------------------------------------------------------------- Phe TTT 10 13 13 13 11 | Ser TCT 12 10 9 11 10 | Tyr TAT 19 19 19 18 19 | Cys TGT 15 16 16 14 18 TTC 4 3 3 3 4 | TCC 2 0 1 2 3 | TAC 9 9 9 10 8 | TGC 11 12 12 13 9 Leu TTA 18 14 13 18 18 | TCA 15 18 18 19 16 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 6 8 8 5 9 | TCG 4 5 5 9 6 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 10 11 11 9 11 | Pro CCT 13 14 14 14 12 | His CAT 14 13 13 12 10 | Arg CGT 3 3 3 2 3 CTC 3 3 3 0 1 | CCC 5 5 5 3 2 | CAC 2 4 4 4 4 | CGC 4 3 3 4 3 CTA 11 10 10 8 8 | CCA 14 15 15 17 14 | Gln CAA 21 20 20 21 22 | CGA 2 2 2 4 3 CTG 6 5 5 7 7 | CCG 7 7 7 5 10 | CAG 8 8 8 8 7 | CGG 1 1 1 1 2 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 14 12 12 14 13 | Thr ACT 10 8 9 12 13 | Asn AAT 23 20 21 19 19 | Ser AGT 9 8 7 8 11 ATC 2 1 1 2 1 | ACC 1 4 3 3 1 | AAC 15 16 16 15 13 | AGC 11 11 11 14 13 ATA 14 17 16 17 16 | ACA 20 18 19 14 17 | Lys AAA 23 29 28 25 24 | Arg AGA 10 10 12 9 9 Met ATG 12 12 12 12 11 | ACG 5 3 3 3 4 | AAG 14 10 11 12 12 | AGG 4 4 3 4 2 ---------------------------------------------------------------------------------------------------------------------- Val GTT 13 11 11 9 11 | Ala GCT 11 11 11 11 11 | Asp GAT 19 20 20 22 23 | Gly GGT 6 5 5 4 5 GTC 5 6 6 6 7 | GCC 6 6 6 6 6 | GAC 8 8 8 5 6 | GGC 4 4 4 4 4 GTA 6 6 7 6 7 | GCA 8 8 8 10 14 | Glu GAA 30 29 29 29 29 | GGA 12 12 13 12 11 GTG 4 4 4 7 4 | GCG 3 4 4 1 1 | GAG 9 10 9 11 12 | GGG 3 5 4 3 3 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Zyx-PB position 1: T:0.21441 C:0.21269 A:0.32075 G:0.25214 position 2: T:0.23671 C:0.23328 A:0.36707 G:0.16295 position 3: T:0.34477 C:0.15780 A:0.34991 G:0.14751 Average T:0.26529 C:0.20126 A:0.34591 G:0.18754 #2: D_sechellia_Zyx-PB position 1: T:0.21784 C:0.21269 A:0.31389 G:0.25557 position 2: T:0.23328 C:0.23328 A:0.36878 G:0.16467 position 3: T:0.33276 C:0.16295 A:0.35678 G:0.14751 Average T:0.26129 C:0.20297 A:0.34648 G:0.18925 #3: D_simulans_Zyx-PB position 1: T:0.21612 C:0.21269 A:0.31561 G:0.25557 position 2: T:0.23156 C:0.23499 A:0.36878 G:0.16467 position 3: T:0.33276 C:0.16295 A:0.36021 G:0.14408 Average T:0.26015 C:0.20354 A:0.34820 G:0.18811 #4: D_yakuba_Zyx-PB position 1: T:0.23156 C:0.20412 A:0.31389 G:0.25043 position 2: T:0.23328 C:0.24014 A:0.36192 G:0.16467 position 3: T:0.32933 C:0.16123 A:0.35849 G:0.15094 Average T:0.26472 C:0.20183 A:0.34477 G:0.18868 #5: D_erecta_Zyx-PB position 1: T:0.22470 C:0.20412 A:0.30703 G:0.26415 position 2: T:0.23842 C:0.24014 A:0.35678 G:0.16467 position 3: T:0.34305 C:0.14580 A:0.35678 G:0.15437 Average T:0.26872 C:0.19668 A:0.34019 G:0.19440 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 60 | Ser S TCT 52 | Tyr Y TAT 94 | Cys C TGT 79 TTC 17 | TCC 8 | TAC 45 | TGC 57 Leu L TTA 81 | TCA 86 | *** * TAA 0 | *** * TGA 0 TTG 36 | TCG 29 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 52 | Pro P CCT 67 | His H CAT 62 | Arg R CGT 14 CTC 10 | CCC 20 | CAC 18 | CGC 17 CTA 47 | CCA 75 | Gln Q CAA 104 | CGA 13 CTG 30 | CCG 36 | CAG 39 | CGG 6 ------------------------------------------------------------------------------ Ile I ATT 65 | Thr T ACT 52 | Asn N AAT 102 | Ser S AGT 43 ATC 7 | ACC 12 | AAC 75 | AGC 60 ATA 80 | ACA 88 | Lys K AAA 129 | Arg R AGA 50 Met M ATG 59 | ACG 18 | AAG 59 | AGG 17 ------------------------------------------------------------------------------ Val V GTT 55 | Ala A GCT 55 | Asp D GAT 104 | Gly G GGT 25 GTC 30 | GCC 30 | GAC 35 | GGC 20 GTA 32 | GCA 48 | Glu E GAA 146 | GGA 60 GTG 23 | GCG 13 | GAG 51 | GGG 18 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.22093 C:0.20926 A:0.31424 G:0.25557 position 2: T:0.23465 C:0.23636 A:0.36467 G:0.16432 position 3: T:0.33654 C:0.15815 A:0.35643 G:0.14889 Average T:0.26404 C:0.20126 A:0.34511 G:0.18959 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Zyx-PB D_sechellia_Zyx-PB 0.3968 (0.0309 0.0778) D_simulans_Zyx-PB 0.3429 (0.0286 0.0833) 1.0108 (0.0052 0.0051) D_yakuba_Zyx-PB 0.3600 (0.0763 0.2119) 0.4157 (0.0854 0.2054) 0.3955 (0.0838 0.2118) D_erecta_Zyx-PB 0.4111 (0.0727 0.1768) 0.4156 (0.0771 0.1856) 0.3979 (0.0763 0.1918) 0.3117 (0.0476 0.1527) Model 0: one-ratio TREE # 1: (1, (2, 3), (4, 5)); MP score: 257 check convergence.. lnL(ntime: 7 np: 9): -3787.116874 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.054212 0.064230 0.008779 0.007035 0.159029 0.126128 0.093637 1.992084 0.335821 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.51305 (1: 0.054212, (2: 0.008779, 3: 0.007035): 0.064230, (4: 0.126128, 5: 0.093637): 0.159029); (D_melanogaster_Zyx-PB: 0.054212, (D_sechellia_Zyx-PB: 0.008779, D_simulans_Zyx-PB: 0.007035): 0.064230, (D_yakuba_Zyx-PB: 0.126128, D_erecta_Zyx-PB: 0.093637): 0.159029); Detailed output identifying parameters kappa (ts/tv) = 1.99208 omega (dN/dS) = 0.33582 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.054 1363.4 385.6 0.3358 0.0126 0.0375 17.2 14.4 6..7 0.064 1363.4 385.6 0.3358 0.0149 0.0444 20.3 17.1 7..2 0.009 1363.4 385.6 0.3358 0.0020 0.0061 2.8 2.3 7..3 0.007 1363.4 385.6 0.3358 0.0016 0.0049 2.2 1.9 6..8 0.159 1363.4 385.6 0.3358 0.0369 0.1099 50.3 42.4 8..4 0.126 1363.4 385.6 0.3358 0.0293 0.0872 39.9 33.6 8..5 0.094 1363.4 385.6 0.3358 0.0217 0.0647 29.6 25.0 tree length for dN: 0.1191 tree length for dS: 0.3546 Time used: 0:02 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 257 lnL(ntime: 7 np: 10): -3772.264471 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.057068 0.066786 0.008918 0.007325 0.172746 0.134511 0.097875 2.058053 0.613207 0.008692 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54523 (1: 0.057068, (2: 0.008918, 3: 0.007325): 0.066786, (4: 0.134511, 5: 0.097875): 0.172746); (D_melanogaster_Zyx-PB: 0.057068, (D_sechellia_Zyx-PB: 0.008918, D_simulans_Zyx-PB: 0.007325): 0.066786, (D_yakuba_Zyx-PB: 0.134511, D_erecta_Zyx-PB: 0.097875): 0.172746); Detailed output identifying parameters kappa (ts/tv) = 2.05805 dN/dS (w) for site classes (K=2) p: 0.61321 0.38679 w: 0.00869 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1361.2 387.8 0.3921 0.0142 0.0361 19.3 14.0 6..7 0.067 1361.2 387.8 0.3921 0.0166 0.0423 22.6 16.4 7..2 0.009 1361.2 387.8 0.3921 0.0022 0.0056 3.0 2.2 7..3 0.007 1361.2 387.8 0.3921 0.0018 0.0046 2.5 1.8 6..8 0.173 1361.2 387.8 0.3921 0.0429 0.1093 58.3 42.4 8..4 0.135 1361.2 387.8 0.3921 0.0334 0.0851 45.4 33.0 8..5 0.098 1361.2 387.8 0.3921 0.0243 0.0619 33.1 24.0 Time used: 0:06 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 257 lnL(ntime: 7 np: 12): -3772.264471 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.057068 0.066786 0.008918 0.007325 0.172746 0.134511 0.097875 2.058052 0.613207 0.275542 0.008692 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54523 (1: 0.057068, (2: 0.008918, 3: 0.007325): 0.066786, (4: 0.134511, 5: 0.097875): 0.172746); (D_melanogaster_Zyx-PB: 0.057068, (D_sechellia_Zyx-PB: 0.008918, D_simulans_Zyx-PB: 0.007325): 0.066786, (D_yakuba_Zyx-PB: 0.134511, D_erecta_Zyx-PB: 0.097875): 0.172746); Detailed output identifying parameters kappa (ts/tv) = 2.05805 dN/dS (w) for site classes (K=3) p: 0.61321 0.27554 0.11125 w: 0.00869 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1361.2 387.8 0.3921 0.0142 0.0361 19.3 14.0 6..7 0.067 1361.2 387.8 0.3921 0.0166 0.0423 22.6 16.4 7..2 0.009 1361.2 387.8 0.3921 0.0022 0.0056 3.0 2.2 7..3 0.007 1361.2 387.8 0.3921 0.0018 0.0046 2.5 1.8 6..8 0.173 1361.2 387.8 0.3921 0.0429 0.1093 58.3 42.4 8..4 0.135 1361.2 387.8 0.3921 0.0334 0.0851 45.4 33.0 8..5 0.098 1361.2 387.8 0.3921 0.0243 0.0619 33.1 24.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zyx-PB) Pr(w>1) post mean +- SE for w 185 L 0.531 1.410 +- 0.585 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.745 0.249 0.005 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.802 0.159 0.032 0.006 0.001 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.243 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.039 0.234 0.096 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.070 0.072 0.066 0.020 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.040 0.048 0.047 0.008 0.001 sum of density on p0-p1 = 1.000000 Time used: 0:16 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 257 lnL(ntime: 7 np: 13): -3772.185444 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056934 0.066666 0.008918 0.007311 0.172027 0.134085 0.097669 2.040100 0.357035 0.232379 0.000001 0.000001 0.923673 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54361 (1: 0.056934, (2: 0.008918, 3: 0.007311): 0.066666, (4: 0.134085, 5: 0.097669): 0.172027); (D_melanogaster_Zyx-PB: 0.056934, (D_sechellia_Zyx-PB: 0.008918, D_simulans_Zyx-PB: 0.007311): 0.066666, (D_yakuba_Zyx-PB: 0.134085, D_erecta_Zyx-PB: 0.097669): 0.172027); Detailed output identifying parameters kappa (ts/tv) = 2.04010 dN/dS (w) for site classes (K=3) p: 0.35704 0.23238 0.41059 w: 0.00000 0.00000 0.92367 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1361.8 387.2 0.3792 0.0139 0.0367 19.0 14.2 6..7 0.067 1361.8 387.2 0.3792 0.0163 0.0430 22.2 16.7 7..2 0.009 1361.8 387.2 0.3792 0.0022 0.0058 3.0 2.2 7..3 0.007 1361.8 387.2 0.3792 0.0018 0.0047 2.4 1.8 6..8 0.172 1361.8 387.2 0.3792 0.0421 0.1110 57.3 43.0 8..4 0.134 1361.8 387.2 0.3792 0.0328 0.0865 44.7 33.5 8..5 0.098 1361.8 387.2 0.3792 0.0239 0.0630 32.5 24.4 Naive Empirical Bayes (NEB) analysis Time used: 0:25 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 257 lnL(ntime: 7 np: 10): -3772.220273 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056973 0.066696 0.008912 0.007314 0.172356 0.134255 0.097727 2.047978 0.031194 0.051235 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54423 (1: 0.056973, (2: 0.008912, 3: 0.007314): 0.066696, (4: 0.134255, 5: 0.097727): 0.172356); (D_melanogaster_Zyx-PB: 0.056973, (D_sechellia_Zyx-PB: 0.008912, D_simulans_Zyx-PB: 0.007314): 0.066696, (D_yakuba_Zyx-PB: 0.134255, D_erecta_Zyx-PB: 0.097727): 0.172356); Detailed output identifying parameters kappa (ts/tv) = 2.04798 Parameters in M7 (beta): p = 0.03119 q = 0.05124 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00003 0.01800 0.82598 0.99971 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1361.6 387.4 0.3844 0.0140 0.0365 19.1 14.1 6..7 0.067 1361.6 387.4 0.3844 0.0164 0.0427 22.3 16.5 7..2 0.009 1361.6 387.4 0.3844 0.0022 0.0057 3.0 2.2 7..3 0.007 1361.6 387.4 0.3844 0.0018 0.0047 2.5 1.8 6..8 0.172 1361.6 387.4 0.3844 0.0424 0.1103 57.7 42.7 8..4 0.134 1361.6 387.4 0.3844 0.0330 0.0859 45.0 33.3 8..5 0.098 1361.6 387.4 0.3844 0.0240 0.0626 32.7 24.2 Time used: 0:49 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 257 lnL(ntime: 7 np: 12): -3772.220802 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.057017 0.066731 0.008916 0.007315 0.172464 0.134322 0.097792 2.050996 0.741011 0.015087 0.078091 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54456 (1: 0.057017, (2: 0.008916, 3: 0.007315): 0.066731, (4: 0.134322, 5: 0.097792): 0.172464); (D_melanogaster_Zyx-PB: 0.057017, (D_sechellia_Zyx-PB: 0.008916, D_simulans_Zyx-PB: 0.007315): 0.066731, (D_yakuba_Zyx-PB: 0.134322, D_erecta_Zyx-PB: 0.097792): 0.172464); Detailed output identifying parameters kappa (ts/tv) = 2.05100 Parameters in M8 (beta&w>1): p0 = 0.74101 p = 0.01509 q = 0.07809 (p1 = 0.25899) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.07410 0.07410 0.07410 0.07410 0.07410 0.07410 0.07410 0.07410 0.07410 0.07410 0.25899 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00056 0.72562 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1361.5 387.5 0.3869 0.0141 0.0364 19.2 14.1 6..7 0.067 1361.5 387.5 0.3869 0.0165 0.0426 22.4 16.5 7..2 0.009 1361.5 387.5 0.3869 0.0022 0.0057 3.0 2.2 7..3 0.007 1361.5 387.5 0.3869 0.0018 0.0047 2.5 1.8 6..8 0.172 1361.5 387.5 0.3869 0.0425 0.1100 57.9 42.6 8..4 0.134 1361.5 387.5 0.3869 0.0331 0.0857 45.1 33.2 8..5 0.098 1361.5 387.5 0.3869 0.0241 0.0624 32.8 24.2 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zyx-PB) Pr(w>1) post mean +- SE for w 19 G 0.734 1.421 +- 0.605 39 N 0.596 1.222 +- 0.576 40 N 0.654 1.306 +- 0.592 43 A 0.583 1.205 +- 0.573 46 K 0.664 1.321 +- 0.595 72 L 0.689 1.357 +- 0.602 110 I 0.589 1.212 +- 0.571 145 Q 0.619 1.256 +- 0.584 152 L 0.741 1.429 +- 0.601 178 E 0.758 1.448 +- 0.565 179 I 0.771 1.466 +- 0.568 180 E 0.563 1.177 +- 0.566 181 T 0.611 1.245 +- 0.580 185 L 0.822 1.535 +- 0.568 188 E 0.603 1.234 +- 0.581 190 K 0.661 1.316 +- 0.595 192 S 0.622 1.259 +- 0.583 208 H 0.609 1.242 +- 0.582 311 S 0.591 1.216 +- 0.576 323 N 0.569 1.185 +- 0.568 330 Y 0.677 1.339 +- 0.598 342 L 0.669 1.327 +- 0.596 349 R 0.591 1.216 +- 0.573 354 D 0.623 1.261 +- 0.583 355 V 0.705 1.380 +- 0.603 357 S 0.641 1.288 +- 0.591 358 I 0.672 1.333 +- 0.600 410 F 0.641 1.288 +- 0.590 516 D 0.583 1.205 +- 0.578 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.159 0.533 0.309 p : 0.369 0.413 0.163 0.049 0.006 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.086 0.090 0.091 0.075 0.095 0.135 0.142 0.140 0.144 ws: 0.816 0.157 0.024 0.002 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:31
Model 1: NearlyNeutral -3772.264471 Model 2: PositiveSelection -3772.264471 Model 0: one-ratio -3787.116874 Model 3: discrete -3772.185444 Model 7: beta -3772.220273 Model 8: beta&w>1 -3772.220802 Model 0 vs 1 29.704805999999735 Model 2 vs 1 0.0 Model 8 vs 7 0.0010579999998299172