--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Dec 09 12:42:51 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/444/Zyx-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3719.64 -3730.11 2 -3719.51 -3729.33 -------------------------------------- TOTAL -3719.58 -3729.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.189077 0.000257 0.159200 0.222165 0.188174 1398.94 1449.97 1.001 r(A<->C){all} 0.097242 0.000380 0.060532 0.135450 0.096057 1173.53 1200.98 1.000 r(A<->G){all} 0.258165 0.001002 0.196821 0.318386 0.256882 845.78 849.69 1.000 r(A<->T){all} 0.106706 0.000340 0.070165 0.142745 0.106066 1122.21 1133.18 1.000 r(C<->G){all} 0.108685 0.000685 0.057809 0.158378 0.107646 990.69 1152.01 1.000 r(C<->T){all} 0.317615 0.001242 0.251182 0.389749 0.316655 720.05 913.54 1.000 r(G<->T){all} 0.111587 0.000581 0.068112 0.159611 0.110006 979.26 1054.62 1.000 pi(A){all} 0.347158 0.000123 0.325303 0.368486 0.347037 955.78 1069.91 1.000 pi(C){all} 0.197939 0.000085 0.179615 0.215731 0.197720 1186.62 1198.37 1.000 pi(G){all} 0.190215 0.000080 0.173522 0.208727 0.190064 948.74 1126.14 1.000 pi(T){all} 0.264688 0.000107 0.246279 0.286423 0.264693 1061.93 1175.99 1.000 alpha{1,2} 0.330111 0.056640 0.000106 0.776169 0.278501 1293.65 1338.83 1.000 alpha{3} 1.306965 0.422380 0.352092 2.605617 1.162313 902.98 1201.99 1.000 pinvar{all} 0.146599 0.011462 0.000009 0.348673 0.125051 970.68 1077.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3608.849137 Model 2: PositiveSelection -3608.849137 Model 0: one-ratio -3625.019945 Model 3: discrete -3608.809899 Model 7: beta -3608.845265 Model 8: beta&w>1 -3608.823375 Model 0 vs 1 32.3416159999997 Model 2 vs 1 0.0 Model 8 vs 7 0.04377999999996973
>C1 MESVAQQLRELSLPKGDTGSPLVCIGHGKVAKLVAKISNNQNASVKRRLD IPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRKYL SSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAKPT QPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYSNV NETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTNPL QIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHNSYV NDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNY ISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQI NLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQC FTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQ EETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNA KRVQALTNRMTSEHoo >C2 MESVAQQLRGLSLPKGDTGSPPVCIGHGKVAEIVAEISKKQNASLNRRLD IPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKMRGHMPFRKYLS SEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAKPTQ PLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYSNVH ETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSNPLQ IYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHNSYVN DNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGLKNYI SIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTDCQIN LQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYHPQCF TCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQE ETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAK RVQALTNRMTSEHooo >C3 MESVAQQLRGLSLPKGDTGSPPVCIGHGKVAEIVAKISKKQNASVNRRLD IPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKMRGHMPFRKYLS SEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAKPTQ PLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYSNVH ETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSNPLQ IYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHNSYVN DNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGLKNYI SIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTDCQIN LQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHPQCF TCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQE ETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAK RVQALTNRMTSEHooo >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPSADMFPRESCNMYNS YVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGLK NYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTDC QINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYHP QCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPFP GQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSC NAQRVQALTKRMTSEH >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPSADMLPRETCNLYNS YVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGLK NFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCADC QINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYHP QCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDP GQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSC NAQRVQALTKRMTSEH CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=570 C1 MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR C2 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR C3 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR *******:: :**.*.: ** *********::*.:**:.** *: :* C1 LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK C2 LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK C3 LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK C4 SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK C5 LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK * *** ****:*********** *************.** : ****** C1 YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK C2 YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK C3 YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK C4 YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK C5 YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK * :****.***::***:*****************************: ** C1 PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS C2 PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS C3 PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS C4 PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA C5 PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA ***..:**::************.**. ::. : ** *: * :*.**: C1 NVNETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTN C2 NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN C3 NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN C4 NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN C5 NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN **:*:*** *:*******************:** ***********::*:* C1 P-LQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN C2 P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHN C3 P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHN C4 PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPS-ADMFPRESCNMYN C5 PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPS-ADMLPRETCNLYN * ********::***. .**: *************. .* :***. *::* C1 SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL C2 SYVNDNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGL C3 SYVNDNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGL C4 SYVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGL C5 SYVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGL ***.*. *.*.:: ** ***:**** ******:*.**. .: ****:*** C1 KNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTD C2 KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD C3 KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD C4 KNYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD C5 KNFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCAD **::**.*:****:***************************** ****:* C1 CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH C2 CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYH C3 CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH C4 CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYH C5 CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH **********************************:*********:***** C1 PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD C2 PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD C3 PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD C4 PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPF C5 PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD ************************************************* C1 PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS C2 PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS C3 PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS C4 PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS C5 PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS ************************************************** C1 CNAKRVQALTNRMTSEHoo- C2 CNAKRVQALTNRMTSEHooo C3 CNAKRVQALTNRMTSEHooo C4 CNAQRVQALTKRMTSEH--- C5 CNAQRVQALTKRMTSEH--- ***:******:****** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 566 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 566 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11610] Library Relaxation: Multi_proc [72] Relaxation Summary: [11610]--->[11522] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/Zyx-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.354 Mb, Max= 30.845 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTN P-LQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEHoo- >C2 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEHooo >C3 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEHooo >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPS-ADMFPRESCNMYN SYVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGL KNYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPF PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH--- >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPS-ADMLPRETCNLYN SYVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGL KNFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCAD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH--- FORMAT of file /tmp/tmp1048149034923260827aln Not Supported[FATAL:T-COFFEE] >C1 MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTN P-LQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEHoo- >C2 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEHooo >C3 MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEHooo >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPS-ADMFPRESCNMYN SYVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGL KNYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPF PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH--- >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPS-ADMLPRETCNLYN SYVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGL KNFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCAD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH--- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:570 S:99 BS:570 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 93.81 C1 C2 93.81 TOP 1 0 93.81 C2 C1 93.81 BOT 0 2 94.69 C1 C3 94.69 TOP 2 0 94.69 C3 C1 94.69 BOT 0 3 85.44 C1 C4 85.44 TOP 3 0 85.44 C4 C1 85.44 BOT 0 4 86.32 C1 C5 86.32 TOP 4 0 86.32 C5 C1 86.32 BOT 1 2 98.76 C2 C3 98.76 TOP 2 1 98.76 C3 C2 98.76 BOT 1 3 84.34 C2 C4 84.34 TOP 3 1 84.34 C4 C2 84.34 BOT 1 4 85.23 C2 C5 85.23 TOP 4 1 85.23 C5 C2 85.23 BOT 2 3 84.70 C3 C4 84.70 TOP 3 2 84.70 C4 C3 84.70 BOT 2 4 85.41 C3 C5 85.41 TOP 4 2 85.41 C5 C3 85.41 BOT 3 4 90.46 C4 C5 90.46 TOP 4 3 90.46 C5 C4 90.46 AVG 0 C1 * 90.06 AVG 1 C2 * 90.54 AVG 2 C3 * 90.89 AVG 3 C4 * 86.23 AVG 4 C5 * 86.86 TOT TOT * 88.92 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGAGTCTGTGGCCCAGCAACTTAGAGAGCTGTCGCTTCCAAAAGGTGA C2 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA C3 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA C4 ATGGAGTCAGTGGCCCAGCAAATTAGAGAGATGTCGCTTTCAAAAGACGA C5 ATGGAGTCAGTGGCCCAGCAACTTAAAGAGCTGTCGCTTTCAAAAGACGA ********:************.***.**.*.* ****** ******. ** C1 CACAGGC------TCACCGCTTGTATGTATTGGACATGGAAAAGTTGCGA C2 CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG C3 CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG C4 AATATTAAAAAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTGGCAG C5 AACATTAAATAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTTGCAG .* * . ******* ************************ **.. C1 AGCTAGTCGCCAAGATAAGTAATAATCAAAATGCATCAGTAAAGAGGAGA C2 AGATAGTCGCCGAGATAAGTAAAAAGCAAAATGCATCATTAAACAGGAGA C3 AGATAGTCGCCAAGATAAGTAAAAAGCAAAATGCATCAGTAAACAGGAGA C4 AGTTAGTCGGCAAGATAAGTCAAAAGCAAAATGAATCTGTATACAGGAGA C5 AGTTAGTCGGCAAGATAAGTCAAAGGCAAAATGATTCCGTATATAAGAGA ** ****** *.********.*:*. *******.:** **:* *.**** C1 TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT C2 TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT C3 TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT C4 TCGGATACACCTCCTAAGCTGCCGATAAAATATAATGAAATGCCTCAGGT C5 TTGGATACACCTCCTAAGCCGCCGATAAAATATAAGGAAATGCCTCAGGT * ***** *********** *************** ************** C1 TCCATCAAGCAGACAGGTTTTGTGTTCGCGGGAACCACTATATTCACAAC C2 TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC C3 TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC C4 TCCATCAAGCCGACAGGTTTCGTGTTCGAGGGAACCACTTTACTCACAAC C5 TCCATCAAGCAGACAGGTTTTATGTTCGCGGGAACCACTTTATTCACAAC **********.********* .******.**********:** ******* C1 CTCTGATTGGAGTCGAGAAAACAATGAGGGGGCATATGCCTTTTAGAAAA C2 CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA C3 CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA C4 CTCTGATTGGAGCCGAGAAAACAATAAGTGTGCATATGCCTTTTAGAAAA C5 CGCTGATTGGAGTCGAGAAAACAATAAGTGGGCATATGCCTTTTAGAAAA * ********** ******* **.** * ******************* C1 TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATAAACAGAAAAAC C2 TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC C3 TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC C4 TACCATACCTCTGAATTTGGAGTTGCTGATACTGAAATAAACAGAAAATC C5 TACCTTAGCTCTGAATTCGGAGCTGCTGATACTGAAATGAACAGAAAAAC ****: * ********* **** ********** ****.*********:* C1 AACTTTAGATAATCCGGCAATTTTGGAACAGCAATTAGAAGCTCTTGCTT C2 AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT C3 AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT C4 AACTTTGGATAATCCAGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT C5 AACTTTGGATAATCCGGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ******.********.*****: ******************* ** **** C1 ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTACAAGCTAAG C2 ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA C3 ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA C4 ACCACAAACTTCAAATGGAAAAGAAGGGTCTTTTGGGAGTACCAGCTAAA C5 ACCACAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGTCTACAAGCTAAA **** *****************.**************: **..******. C1 CCAACACAACCTCTCAACAGCTTTACAAAGCCCCTTTCAAAGACTTTAAG C2 CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG C3 CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG C4 CCAACACAATCTTTCAACAGCTTTTCAGAGCCACTTTCAAAGACTTTAAG C5 CCAACACAATCTGTAAACAGCTTTTCAGAGCCTCTTTCAAAGACTTTGAG ********. ** *.**.******:**.**** ********.*****.** C1 CAAAAGCTTAATATATTCTAATTTAGGTTCTGTTCGCAAAGAAATAGAAA C2 CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA C3 CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA C4 CAAAAGCTTAATATATTGTAATTTAGATTCTGTACACAAAAGTGAAAATA C5 CAAAAGCTTAATATATTGCAATTTAGATTCTGTACACAAAAGTGCAGAAA ***************** *******. * **::*.***:..:. *.*:* C1 CATTAGAACTATTAACAGACGAAACTAAGATTTCTGCGAGTACATATTCA C2 TATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA C3 CATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA C4 GATCAGAACTATTAACAGAGGAAACTCCGATTGCTGCAAATACATATGCA C5 GATCAGAACTATTTACAGAGACAACTAAGATTACTGCAAGTACATACGCA ** ******* :***** ..****..** : *:**.*.***.** ** C1 AACGTTAATGAAACTGACAACGAAAAAGATGAGTTACCGCCACCACCTAG C2 AACGTTCATGAAACCGACAACGAAAAAGATGAGTTACCGCCCCCACCTAG C3 AACGTTCATGAAACCGACAACGAAAAAGATGAGTTACCGCCCCCACCTAG C4 AATGTTCATGAAGCCGACAACGAAATAGATGACTTACCGCCACCTCCTAG C5 AATGTTCATGAAGCTGACAACGAAATAGATGACTTACCGCCACCACCTAG ** ***.*****.* **********:****** ********.**:***** C1 TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT C2 TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT C3 TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT C4 TCCAGAGAGCGCTGTGAGCTCTTCATACAGCGAGCTTCGGCGCGCCACTT C5 TCCAGAAAGCGCTGTGAGTTCTTCATACAGCGAGCTTCGGCGTGCCACTT ******.*********** *********** ******** *. ******* C1 TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACAACGAAT C2 TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACATCGAAT C3 TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACATCGAAT C4 CGGAATTTAACAAACCAATTGATTATTTGCAAAATGACCAGACATCGAAT C5 CGGAATTTAACAAGCCAATTGATTATTTGCAAAATGACGAGACATCGAAT ****** *****.**************.******.** *****:***** C1 CCT---TTACAAATATATGCAAACCAATATGCGATGCAGCATGATGCCAC C2 CCT---TTGCAAATATATGCAAACCAATATGCGTTGCAACATGATGCCAC C3 CCT---TTGCAAATATATGCAAACCAATATGCGTTGCAACATGATGCCAC C4 CCTTCTTTGCAAATATATGCAAACCAATATTCGTTGCAGCATGATCCCAT C5 CCTTCTTTACAAATATATGCAAACCAATATGCGTTGCAGCATGATGCCAT *** **.********************* **:****.****** *** C1 AGGCAAGAGCTCTTCTACATATGATTCAATATATGAACCTATAAACCCTC C2 AGGCAAGAGCTCTTATACATATGATTCAATATATGAACCTATAAACCCTC C3 AGGCAAGAGCTCTTATACATATGATTCAATATATGAACCTATAAACCCTC C4 TAGCAAGAGCTCTTCAACATATGATTCAATATATGAACCTATAAACCCAC C5 AAGCAAGAGCACTTCTACATATGATTCAATATATGAGCCTATAAACCCGC :.********:***.:********************.*********** * C1 GACCCTGTGTTGCAGATACGCTGCCTCGTGAAAGTTATAATCTGCATAAT C2 GACCCTGTGTTGTAGATACGCTGCCTCGTGAAAGTTGTAATCTGCATAAT C3 GACCCTGTGTTGTAGATACGCTGCCTCGTGAAAATTGTAATCTGCATAAT C4 GACCCTCT---GCAGATATGTTTCCTCGTGAAAGTTGTAATATGTATAAT C5 GACCGTCT---GCAGATATGTTGCCTCGTGAAACTTGTAATCTGTATAAT **** * * * ***** * * ********** **.****.** ***** C1 TCATACGTTAATGATAATAATCCAAACATTTCCCATGAATACAATATTTC C2 TCATACGTCAATGATAATAATCCAAACATTTGCCATGAATACAATATTTC C3 TCATACGTCAATGATAATAATCCAAACATTTGCCATGAATACAATATTTC C4 TCATACGTCAATGATAATACTCCAAGCATTTCCAACAAATTAAATATTTT C5 TCATACGTCAGTGATAGTATTCCAAGCATTTCCAATGAATTAAATATTTT ******** *.*****.** *****.***** *.* .***:.******* C1 GAATTCGATTGAAGCTAACCAAACACTATACATACATGGTAATGCTAGAA C2 GAATTCGATTGATGCTAACCAAACACTATACATACATGGTAATGCTAAAA C3 GAATTCGATTGATGCTAACCAAACACTATACATACATGGTAATGCTAGAA C4 AAATTCGATCGAAGCGAACCAAACACTATACATACATGGTAACGCTAGAA C5 AAATTCGATTGAAGCAAACCAAACAGCATACATACATGGTAATGCTAAAA .******** **:** ********* *************** ****.** C1 CTACATTTTATGACGTGAACAGCATCCATAGAAATGATAAGGAAGGTCTA C2 CTACATTTTATGACGTGAACACCATACATAGAAATGATAAGGAAGGTCTA C3 CTACATTTTATGACGTGAACTCCATACATAGAAATGATAAGGAAGGTCTA C4 CTAAATTTTATAAAGGGAGCACTGATCATAGAAATGATAAGGAAGGTCTA C5 CAAAATTTTATAACTTGAACACTGTCCATAGAAATGATAATGAAGGTCTA *:*.*******.*. **.*: .: ************** ********* C1 AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTGGAAAACTA C2 AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTTGAAAACTA C3 AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTTGAAAACTA C4 AAAAACTACATTTCAATAACCACCGATCCAGTTCAAGAATTAGAAAACTA C5 AAAAACTTCGTTTCAATACCCACCGATCCAGTTCAAGAATTAGAAAACTA ***** *:*.********.*******:**.*********** ******** C1 CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGTGGAT C2 CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGCGGAT C3 CGGTAGATGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGCGGAT C4 CGGTAGGTGTGTCAAATGCAATTCACGTGTGCTTGGAGAAAGTAGTGGAT C5 CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGTGGAT ******.***********************.************** **** C1 GTACAGCAATGGATCAAATATACCACATATTTTGCTTCACATGTACAGAT C2 GTACAGCAATGGATCAAATATACCACATATCTTGCTTCACATGTACAGAT C3 GTACAGCAATGGATCAAATATACCACATATCTTGCTTCACATGTACAGAT C4 GTACAGCAATGGATCAAATATACCATATATCTTGCTTCACATGTACGGAT C5 GTACAGCAATGGATCAAATATACCATATAACTTGCTTCACATGTGCAGAT ************************* ***: *************.*.*** C1 TGCCAAATTAACTTACAGGGAAAACCTTTCTATGCATTAGACGGCAAACC C2 TGCCAAATTAACTTACAGGGAAAACCATTTTATGCATTAGACGGCAAACC C3 TGCCAAATTAACTTACAGGGAAAACCATTTTATGCATTAGACGGCAAACC C4 TGCCAAATTAACTTACAGGGAAAACCATTCTATGCACTAGACGGCAAACC C5 TGTCAAATTAATTTGCAGGGAAAACCATTCTATGCATTAGACGGCAAACC ** ******** **.***********:** ****** ************* C1 CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA C2 CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA C3 CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA C4 TTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA C5 GTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGTA *********************************************** * C1 TGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT C2 TGGAACCAATTTTAGAGAGAATTCTTAGAGCTTCTGGAAAACCATATCAT C3 TGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT C4 TGAAACCTATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT C5 TGGAACCTATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT **.****:************************:***************** C1 CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT C2 CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT C3 CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGACTATT C4 CCGCAATGTTTTACATGTGTCGTATGCGGAAAAAGCTTAGATGGGCTATT C5 CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ******************** ***********************.***** C1 ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA C2 ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA C3 ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA C4 ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA C5 ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA ************************************************** C1 AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT C2 AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT C3 AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT C4 AAAAATTTGCTCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCATTT C5 AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT ********** ************************************ :* C1 CCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAGATCGAAGTTTTCA C2 CCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAGATCGAAGTTTTCA C3 CCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAGATCGAAGTTTTCA C4 CCAGGACAAGAAGAAACGATCAGGGTAGTGGCCCTAGATCGAAGTTTTCA C5 CCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAGATCGAAGTTTTCA ***********************.******** ***************** C1 TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG C2 TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG C3 TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG C4 CCTAGAATGTTATAAGTGCGAGGACTGCGGGCTTTTACTGTCATCTGAAG C5 CCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG ***************** ******** ***** *****.********** C1 CTGAGGGCCGCGGATGTTATCCCCTGGATGACCATGTTCTATGTAAAAGC C2 CTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGTTCTATGTAAAAGC C3 CTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGTTCTATGTAAAAGC C4 CTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGTTCTATGTAAAAGC C5 CTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGTTCTATGTAAAAGC ******************************* ** *************** C1 TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA C2 TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA C3 TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA C4 TGCAATGCACAACGAGTTCAGGCTTTAACGAAGCGCATGACATCAGAACA C5 TGTAATGCACAACGAGTTCAGGCTTTAACGAAGCGCATGACGTCAGAACA ** ******.**.*.**************.** ********.******** C1 T--------- C2 T--------- C3 T--------- C4 T--------- C5 T--------- * >C1 ATGGAGTCTGTGGCCCAGCAACTTAGAGAGCTGTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCTTGTATGTATTGGACATGGAAAAGTTGCGA AGCTAGTCGCCAAGATAAGTAATAATCAAAATGCATCAGTAAAGAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTGTGTTCGCGGGAACCACTATATTCACAAC CTCTGATTGGAGTCGAGAAAACAATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATAAACAGAAAAAC AACTTTAGATAATCCGGCAATTTTGGAACAGCAATTAGAAGCTCTTGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTACAAGCTAAG CCAACACAACCTCTCAACAGCTTTACAAAGCCCCTTTCAAAGACTTTAAG CAAAAGCTTAATATATTCTAATTTAGGTTCTGTTCGCAAAGAAATAGAAA CATTAGAACTATTAACAGACGAAACTAAGATTTCTGCGAGTACATATTCA AACGTTAATGAAACTGACAACGAAAAAGATGAGTTACCGCCACCACCTAG TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACAACGAAT CCT---TTACAAATATATGCAAACCAATATGCGATGCAGCATGATGCCAC AGGCAAGAGCTCTTCTACATATGATTCAATATATGAACCTATAAACCCTC GACCCTGTGTTGCAGATACGCTGCCTCGTGAAAGTTATAATCTGCATAAT TCATACGTTAATGATAATAATCCAAACATTTCCCATGAATACAATATTTC GAATTCGATTGAAGCTAACCAAACACTATACATACATGGTAATGCTAGAA CTACATTTTATGACGTGAACAGCATCCATAGAAATGATAAGGAAGGTCTA AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTGGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGTGGAT GTACAGCAATGGATCAAATATACCACATATTTTGCTTCACATGTACAGAT TGCCAAATTAACTTACAGGGAAAACCTTTCTATGCATTAGACGGCAAACC CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAGATCGAAGTTTTCA TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGACCATGTTCTATGTAAAAGC TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA T--------- >C2 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCGAGATAAGTAAAAAGCAAAATGCATCATTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA TATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGACAACGAAAAAGATGAGTTACCGCCCCCACCTAG TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACATCGAAT CCT---TTGCAAATATATGCAAACCAATATGCGTTGCAACATGATGCCAC AGGCAAGAGCTCTTATACATATGATTCAATATATGAACCTATAAACCCTC GACCCTGTGTTGTAGATACGCTGCCTCGTGAAAGTTGTAATCTGCATAAT TCATACGTCAATGATAATAATCCAAACATTTGCCATGAATACAATATTTC GAATTCGATTGATGCTAACCAAACACTATACATACATGGTAATGCTAAAA CTACATTTTATGACGTGAACACCATACATAGAAATGATAAGGAAGGTCTA AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTTGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGCGGAT GTACAGCAATGGATCAAATATACCACATATCTTGCTTCACATGTACAGAT TGCCAAATTAACTTACAGGGAAAACCATTTTATGCATTAGACGGCAAACC CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGGAACCAATTTTAGAGAGAATTCTTAGAGCTTCTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAGATCGAAGTTTTCA TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGTTCTATGTAAAAGC TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA T--------- >C3 ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCAAGATAAGTAAAAAGCAAAATGCATCAGTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA CATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGACAACGAAAAAGATGAGTTACCGCCCCCACCTAG TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACATCGAAT CCT---TTGCAAATATATGCAAACCAATATGCGTTGCAACATGATGCCAC AGGCAAGAGCTCTTATACATATGATTCAATATATGAACCTATAAACCCTC GACCCTGTGTTGTAGATACGCTGCCTCGTGAAAATTGTAATCTGCATAAT TCATACGTCAATGATAATAATCCAAACATTTGCCATGAATACAATATTTC GAATTCGATTGATGCTAACCAAACACTATACATACATGGTAATGCTAGAA CTACATTTTATGACGTGAACTCCATACATAGAAATGATAAGGAAGGTCTA AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTTGAAAACTA CGGTAGATGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGCGGAT GTACAGCAATGGATCAAATATACCACATATCTTGCTTCACATGTACAGAT TGCCAAATTAACTTACAGGGAAAACCATTTTATGCATTAGACGGCAAACC CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGACTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAGATCGAAGTTTTCA TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGTTCTATGTAAAAGC TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA T--------- >C4 ATGGAGTCAGTGGCCCAGCAAATTAGAGAGATGTCGCTTTCAAAAGACGA AATATTAAAAAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTGGCAG AGTTAGTCGGCAAGATAAGTCAAAAGCAAAATGAATCTGTATACAGGAGA TCGGATACACCTCCTAAGCTGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCCGACAGGTTTCGTGTTCGAGGGAACCACTTTACTCACAAC CTCTGATTGGAGCCGAGAAAACAATAAGTGTGCATATGCCTTTTAGAAAA TACCATACCTCTGAATTTGGAGTTGCTGATACTGAAATAAACAGAAAATC AACTTTGGATAATCCAGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAGAAGGGTCTTTTGGGAGTACCAGCTAAA CCAACACAATCTTTCAACAGCTTTTCAGAGCCACTTTCAAAGACTTTAAG CAAAAGCTTAATATATTGTAATTTAGATTCTGTACACAAAAGTGAAAATA GATCAGAACTATTAACAGAGGAAACTCCGATTGCTGCAAATACATATGCA AATGTTCATGAAGCCGACAACGAAATAGATGACTTACCGCCACCTCCTAG TCCAGAGAGCGCTGTGAGCTCTTCATACAGCGAGCTTCGGCGCGCCACTT CGGAATTTAACAAACCAATTGATTATTTGCAAAATGACCAGACATCGAAT CCTTCTTTGCAAATATATGCAAACCAATATTCGTTGCAGCATGATCCCAT TAGCAAGAGCTCTTCAACATATGATTCAATATATGAACCTATAAACCCAC GACCCTCT---GCAGATATGTTTCCTCGTGAAAGTTGTAATATGTATAAT TCATACGTCAATGATAATACTCCAAGCATTTCCAACAAATTAAATATTTT AAATTCGATCGAAGCGAACCAAACACTATACATACATGGTAACGCTAGAA CTAAATTTTATAAAGGGAGCACTGATCATAGAAATGATAAGGAAGGTCTA AAAAACTACATTTCAATAACCACCGATCCAGTTCAAGAATTAGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTGCTTGGAGAAAGTAGTGGAT GTACAGCAATGGATCAAATATACCATATATCTTGCTTCACATGTACGGAT TGCCAAATTAACTTACAGGGAAAACCATTCTATGCACTAGACGGCAAACC TTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGAAACCTATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTCGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCTCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCATTT CCAGGACAAGAAGAAACGATCAGGGTAGTGGCCCTAGATCGAAGTTTTCA CCTAGAATGTTATAAGTGCGAGGACTGCGGGCTTTTACTGTCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGTTCTATGTAAAAGC TGCAATGCACAACGAGTTCAGGCTTTAACGAAGCGCATGACATCAGAACA T--------- >C5 ATGGAGTCAGTGGCCCAGCAACTTAAAGAGCTGTCGCTTTCAAAAGACGA AACATTAAATAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTTGCAG AGTTAGTCGGCAAGATAAGTCAAAGGCAAAATGATTCCGTATATAAGAGA TTGGATACACCTCCTAAGCCGCCGATAAAATATAAGGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTATGTTCGCGGGAACCACTTTATTCACAAC CGCTGATTGGAGTCGAGAAAACAATAAGTGGGCATATGCCTTTTAGAAAA TACCTTAGCTCTGAATTCGGAGCTGCTGATACTGAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGTCTACAAGCTAAA CCAACACAATCTGTAAACAGCTTTTCAGAGCCTCTTTCAAAGACTTTGAG CAAAAGCTTAATATATTGCAATTTAGATTCTGTACACAAAAGTGCAGAAA GATCAGAACTATTTACAGAGACAACTAAGATTACTGCAAGTACATACGCA AATGTTCATGAAGCTGACAACGAAATAGATGACTTACCGCCACCACCTAG TCCAGAAAGCGCTGTGAGTTCTTCATACAGCGAGCTTCGGCGTGCCACTT CGGAATTTAACAAGCCAATTGATTATTTGCAAAATGACGAGACATCGAAT CCTTCTTTACAAATATATGCAAACCAATATGCGTTGCAGCATGATGCCAT AAGCAAGAGCACTTCTACATATGATTCAATATATGAGCCTATAAACCCGC GACCGTCT---GCAGATATGTTGCCTCGTGAAACTTGTAATCTGTATAAT TCATACGTCAGTGATAGTATTCCAAGCATTTCCAATGAATTAAATATTTT AAATTCGATTGAAGCAAACCAAACAGCATACATACATGGTAATGCTAAAA CAAAATTTTATAACTTGAACACTGTCCATAGAAATGATAATGAAGGTCTA AAAAACTTCGTTTCAATACCCACCGATCCAGTTCAAGAATTAGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGTGGAT GTACAGCAATGGATCAAATATACCATATAACTTGCTTCACATGTGCAGAT TGTCAAATTAATTTGCAGGGAAAACCATTCTATGCATTAGACGGCAAACC GTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGTA TGGAACCTATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAGATCGAAGTTTTCA CCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGTTCTATGTAAAAGC TGTAATGCACAACGAGTTCAGGCTTTAACGAAGCGCATGACGTCAGAACA T--------- >C1 MESVAQQLRELSLPKGDTGooSPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTN PoLQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEH >C2 MESVAQQLRGLSLPKGDTGooSPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKoMRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN PoLQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEH >C3 MESVAQQLRGLSLPKGDTGooSPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEKoMRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN PoLQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEH >C4 MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPSoADMFPRESCNMYN SYVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGL KNYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPF PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH >C5 MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPSoADMLPRETCNLYN SYVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGL KNFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCAD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1710 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481287003 Setting output file names to "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1876822392 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0913485815 Seed = 584836269 Swapseed = 1481287003 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 45 unique site patterns Division 2 has 51 unique site patterns Division 3 has 70 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4685.639664 -- -25.624409 Chain 2 -- -4427.571414 -- -25.624409 Chain 3 -- -4426.089585 -- -25.624409 Chain 4 -- -4642.514749 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4426.089585 -- -25.624409 Chain 2 -- -4664.386086 -- -25.624409 Chain 3 -- -4542.159314 -- -25.624409 Chain 4 -- -4642.917792 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4685.640] (-4427.571) (-4426.090) (-4642.515) * [-4426.090] (-4664.386) (-4542.159) (-4642.918) 500 -- (-3750.842) (-3752.463) [-3733.174] (-3755.132) * (-3755.327) [-3742.500] (-3749.919) (-3762.816) -- 0:00:00 1000 -- (-3742.868) [-3736.760] (-3732.226) (-3741.116) * (-3740.566) [-3727.992] (-3729.088) (-3730.871) -- 0:00:00 1500 -- (-3736.586) (-3730.310) (-3724.025) [-3730.835] * (-3736.328) (-3723.763) [-3720.181] (-3726.486) -- 0:00:00 2000 -- (-3730.976) (-3728.006) (-3724.400) [-3731.907] * (-3727.484) [-3721.413] (-3724.710) (-3725.724) -- 0:00:00 2500 -- (-3724.189) (-3727.846) (-3722.173) [-3727.854] * (-3724.685) [-3719.797] (-3723.361) (-3725.255) -- 0:00:00 3000 -- (-3721.084) (-3723.233) [-3718.552] (-3728.889) * (-3725.374) [-3722.309] (-3719.420) (-3721.358) -- 0:05:32 3500 -- [-3719.879] (-3722.992) (-3718.810) (-3724.325) * (-3719.050) [-3722.896] (-3721.467) (-3725.860) -- 0:04:44 4000 -- [-3728.232] (-3723.800) (-3723.599) (-3728.817) * [-3719.692] (-3718.533) (-3719.054) (-3721.968) -- 0:04:09 4500 -- (-3731.265) (-3724.793) (-3726.087) [-3720.693] * [-3724.785] (-3726.254) (-3730.278) (-3726.027) -- 0:03:41 5000 -- (-3725.374) (-3728.622) (-3724.904) [-3722.943] * (-3726.914) (-3720.871) (-3733.253) [-3717.324] -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-3721.858) [-3725.260] (-3722.003) (-3720.708) * [-3720.205] (-3731.668) (-3720.442) (-3725.765) -- 0:03:00 6000 -- [-3722.540] (-3723.927) (-3720.514) (-3720.479) * [-3720.970] (-3720.683) (-3723.189) (-3721.821) -- 0:02:45 6500 -- (-3722.449) [-3726.814] (-3724.389) (-3719.759) * (-3720.996) [-3721.589] (-3728.327) (-3724.117) -- 0:05:05 7000 -- (-3720.604) (-3719.896) (-3726.143) [-3717.071] * (-3724.256) [-3721.190] (-3722.753) (-3729.903) -- 0:04:43 7500 -- (-3724.937) [-3720.426] (-3720.611) (-3719.564) * (-3725.097) (-3726.088) (-3727.266) [-3722.978] -- 0:04:24 8000 -- (-3725.793) [-3724.476] (-3723.709) (-3720.086) * (-3721.274) [-3727.096] (-3732.211) (-3720.582) -- 0:04:08 8500 -- (-3726.261) [-3719.532] (-3722.751) (-3724.341) * (-3718.955) (-3726.552) (-3737.454) [-3722.404] -- 0:03:53 9000 -- [-3720.296] (-3722.587) (-3720.200) (-3722.232) * (-3723.982) [-3724.116] (-3725.040) (-3724.638) -- 0:05:30 9500 -- (-3728.781) [-3720.571] (-3717.991) (-3722.465) * (-3724.210) [-3720.207] (-3722.290) (-3723.110) -- 0:05:12 10000 -- (-3724.451) (-3720.349) (-3718.228) [-3720.145] * (-3722.623) (-3720.208) (-3722.081) [-3728.785] -- 0:04:57 Average standard deviation of split frequencies: 0.000000 10500 -- [-3722.186] (-3725.882) (-3720.856) (-3729.102) * (-3722.751) (-3724.163) (-3729.411) [-3722.543] -- 0:04:42 11000 -- (-3724.457) (-3723.615) (-3725.897) [-3723.486] * (-3717.679) (-3728.704) (-3726.966) [-3729.174] -- 0:04:29 11500 -- (-3723.357) (-3727.777) [-3722.718] (-3719.694) * (-3728.554) (-3725.707) [-3722.611] (-3724.966) -- 0:05:43 12000 -- (-3718.671) (-3725.936) [-3728.071] (-3724.007) * (-3723.979) (-3729.772) [-3719.902] (-3725.207) -- 0:05:29 12500 -- [-3719.889] (-3721.785) (-3721.979) (-3724.580) * [-3721.335] (-3733.831) (-3719.010) (-3724.185) -- 0:05:16 13000 -- (-3722.026) [-3720.189] (-3723.666) (-3728.669) * [-3723.852] (-3726.971) (-3721.467) (-3721.590) -- 0:05:03 13500 -- (-3723.702) [-3720.618] (-3721.677) (-3723.804) * [-3722.145] (-3729.111) (-3721.108) (-3721.295) -- 0:04:52 14000 -- (-3722.741) [-3719.888] (-3726.099) (-3719.976) * (-3724.773) [-3721.896] (-3736.028) (-3718.383) -- 0:04:41 14500 -- [-3731.154] (-3726.607) (-3722.968) (-3719.873) * [-3722.583] (-3721.621) (-3730.167) (-3723.562) -- 0:05:39 15000 -- (-3717.006) [-3720.065] (-3728.237) (-3723.851) * (-3719.625) [-3720.900] (-3721.513) (-3727.769) -- 0:05:28 Average standard deviation of split frequencies: 0.000000 15500 -- (-3721.030) [-3719.155] (-3735.668) (-3720.681) * [-3731.066] (-3727.127) (-3723.109) (-3734.824) -- 0:05:17 16000 -- (-3722.254) (-3723.823) (-3727.092) [-3729.378] * (-3724.794) [-3724.967] (-3722.839) (-3722.699) -- 0:05:07 16500 -- (-3719.395) [-3732.206] (-3723.009) (-3721.861) * (-3727.315) (-3718.590) (-3719.825) [-3723.368] -- 0:04:58 17000 -- (-3721.079) (-3734.886) (-3724.714) [-3720.213] * (-3726.554) (-3724.579) [-3723.582] (-3722.410) -- 0:04:49 17500 -- (-3728.051) (-3725.855) [-3721.542] (-3722.816) * (-3725.655) [-3723.555] (-3727.987) (-3719.644) -- 0:05:36 18000 -- (-3727.899) (-3720.239) [-3724.424] (-3723.503) * (-3723.505) [-3719.237] (-3734.357) (-3726.493) -- 0:05:27 18500 -- (-3720.762) (-3721.927) [-3719.247] (-3732.233) * (-3718.903) [-3722.835] (-3720.118) (-3728.876) -- 0:05:18 19000 -- (-3721.541) (-3720.108) [-3720.562] (-3728.240) * (-3723.898) (-3730.969) [-3720.982] (-3726.000) -- 0:05:09 19500 -- (-3723.042) (-3728.838) (-3718.955) [-3719.085] * (-3724.525) (-3721.850) [-3724.535] (-3723.256) -- 0:05:01 20000 -- (-3724.584) (-3725.008) [-3721.837] (-3720.390) * (-3716.635) (-3724.017) (-3729.877) [-3721.869] -- 0:04:54 Average standard deviation of split frequencies: 0.000000 20500 -- (-3723.646) (-3726.238) (-3722.972) [-3723.629] * (-3725.371) (-3719.656) [-3721.963] (-3727.272) -- 0:04:46 21000 -- [-3720.760] (-3730.065) (-3726.671) (-3725.536) * (-3718.924) [-3721.793] (-3724.081) (-3729.163) -- 0:05:26 21500 -- (-3723.194) (-3722.026) (-3727.548) [-3724.987] * [-3722.482] (-3723.555) (-3730.125) (-3722.007) -- 0:05:18 22000 -- (-3727.869) [-3720.921] (-3722.820) (-3728.340) * [-3719.009] (-3721.582) (-3725.465) (-3722.428) -- 0:05:11 22500 -- (-3725.977) (-3723.007) (-3728.845) [-3728.078] * [-3718.328] (-3721.794) (-3728.838) (-3724.412) -- 0:05:04 23000 -- (-3722.980) (-3719.109) (-3730.783) [-3726.880] * [-3722.759] (-3725.416) (-3719.651) (-3718.341) -- 0:04:57 23500 -- (-3734.208) (-3721.125) (-3727.978) [-3722.998] * [-3723.695] (-3725.137) (-3720.769) (-3722.035) -- 0:04:50 24000 -- [-3724.210] (-3718.802) (-3724.869) (-3719.306) * (-3720.354) [-3721.771] (-3721.286) (-3721.365) -- 0:05:25 24500 -- (-3725.342) (-3723.146) [-3720.846] (-3723.147) * [-3721.490] (-3724.891) (-3722.256) (-3722.619) -- 0:05:18 25000 -- (-3725.626) (-3719.395) [-3718.544] (-3722.954) * (-3719.130) [-3726.617] (-3718.993) (-3727.820) -- 0:05:12 Average standard deviation of split frequencies: 0.000000 25500 -- [-3719.164] (-3724.764) (-3721.176) (-3722.965) * [-3718.886] (-3725.465) (-3719.227) (-3724.082) -- 0:05:05 26000 -- (-3721.366) (-3722.572) (-3735.153) [-3724.355] * [-3718.251] (-3720.604) (-3723.498) (-3722.143) -- 0:04:59 26500 -- (-3723.090) (-3721.801) [-3723.321] (-3723.562) * [-3720.658] (-3720.417) (-3721.258) (-3720.591) -- 0:04:53 27000 -- (-3722.861) (-3722.190) [-3725.957] (-3719.978) * (-3723.262) (-3724.377) [-3720.762] (-3720.875) -- 0:04:48 27500 -- (-3721.511) (-3724.920) [-3719.905] (-3721.942) * (-3719.681) (-3722.623) [-3725.697] (-3720.037) -- 0:05:18 28000 -- (-3723.530) (-3724.517) [-3722.091] (-3721.191) * [-3723.165] (-3724.478) (-3727.532) (-3719.405) -- 0:05:12 28500 -- (-3725.122) (-3722.713) [-3726.956] (-3732.191) * (-3716.980) (-3722.856) (-3727.016) [-3719.559] -- 0:05:06 29000 -- (-3717.856) (-3721.323) (-3727.243) [-3721.884] * [-3719.493] (-3729.457) (-3723.311) (-3724.322) -- 0:05:01 29500 -- (-3723.412) (-3720.288) [-3724.083] (-3720.978) * (-3720.149) (-3720.978) [-3724.122] (-3725.623) -- 0:04:56 30000 -- [-3724.764] (-3724.861) (-3723.556) (-3721.450) * (-3722.909) [-3721.478] (-3724.240) (-3726.088) -- 0:04:51 Average standard deviation of split frequencies: 0.000000 30500 -- (-3726.114) [-3721.424] (-3720.853) (-3723.732) * (-3724.085) [-3722.134] (-3725.701) (-3734.652) -- 0:04:46 31000 -- (-3728.931) (-3721.251) (-3725.155) [-3723.069] * [-3723.372] (-3720.415) (-3718.297) (-3723.222) -- 0:05:12 31500 -- (-3725.705) (-3722.496) (-3725.599) [-3726.073] * (-3724.703) [-3721.025] (-3720.683) (-3726.319) -- 0:05:07 32000 -- [-3725.211] (-3729.490) (-3726.134) (-3726.498) * (-3725.970) [-3718.615] (-3725.229) (-3720.234) -- 0:05:02 32500 -- (-3724.544) [-3724.538] (-3736.149) (-3718.172) * (-3721.860) (-3722.781) (-3725.387) [-3726.751] -- 0:04:57 33000 -- [-3725.769] (-3722.478) (-3724.118) (-3725.196) * (-3722.490) (-3717.360) (-3720.094) [-3722.062] -- 0:04:53 33500 -- [-3717.567] (-3724.038) (-3721.606) (-3730.724) * (-3726.148) (-3720.843) (-3723.635) [-3724.159] -- 0:04:48 34000 -- (-3724.965) [-3724.611] (-3722.698) (-3724.061) * [-3718.879] (-3724.701) (-3726.319) (-3724.218) -- 0:05:12 34500 -- [-3723.689] (-3721.297) (-3722.048) (-3722.947) * (-3725.393) [-3719.082] (-3730.100) (-3725.732) -- 0:05:07 35000 -- (-3722.594) (-3720.605) [-3721.525] (-3718.486) * (-3721.656) [-3718.817] (-3722.260) (-3722.081) -- 0:05:03 Average standard deviation of split frequencies: 0.000000 35500 -- (-3719.690) [-3722.352] (-3720.499) (-3725.169) * (-3717.960) (-3720.489) [-3722.854] (-3736.719) -- 0:04:58 36000 -- (-3718.680) [-3720.501] (-3722.873) (-3731.912) * (-3723.819) (-3721.558) [-3721.275] (-3729.512) -- 0:04:54 36500 -- [-3718.708] (-3727.041) (-3724.414) (-3738.668) * (-3723.149) (-3718.975) (-3725.416) [-3724.834] -- 0:04:50 37000 -- [-3720.994] (-3722.233) (-3722.008) (-3731.005) * (-3726.558) (-3721.598) (-3725.302) [-3720.947] -- 0:04:46 37500 -- (-3726.463) (-3723.740) (-3726.889) [-3722.491] * (-3721.012) [-3721.521] (-3727.322) (-3717.173) -- 0:05:08 38000 -- (-3725.347) (-3731.933) (-3728.813) [-3719.911] * [-3720.769] (-3719.391) (-3728.672) (-3716.221) -- 0:05:03 38500 -- (-3727.384) [-3722.725] (-3721.678) (-3721.935) * [-3725.130] (-3719.239) (-3724.467) (-3727.289) -- 0:04:59 39000 -- (-3730.156) [-3723.528] (-3719.958) (-3721.349) * (-3724.204) (-3722.531) (-3725.498) [-3721.509] -- 0:04:55 39500 -- (-3722.211) (-3723.856) (-3724.528) [-3723.883] * (-3723.430) (-3729.348) (-3726.373) [-3719.478] -- 0:04:51 40000 -- (-3721.449) (-3726.630) (-3720.796) [-3724.733] * (-3720.289) (-3731.492) (-3730.921) [-3721.949] -- 0:04:48 Average standard deviation of split frequencies: 0.000000 40500 -- (-3723.565) (-3722.961) [-3721.142] (-3727.953) * [-3721.036] (-3726.598) (-3733.046) (-3720.783) -- 0:04:44 41000 -- (-3728.077) (-3719.508) (-3721.621) [-3725.223] * (-3725.047) [-3724.385] (-3722.723) (-3719.536) -- 0:05:04 41500 -- (-3724.277) (-3725.377) (-3721.501) [-3722.113] * (-3723.948) (-3725.264) (-3719.608) [-3718.509] -- 0:05:00 42000 -- [-3717.844] (-3728.536) (-3724.777) (-3721.431) * [-3723.073] (-3728.894) (-3725.692) (-3726.513) -- 0:04:56 42500 -- [-3719.039] (-3721.640) (-3720.438) (-3720.159) * (-3723.536) (-3722.251) [-3717.951] (-3721.111) -- 0:04:52 43000 -- (-3721.234) (-3719.228) [-3725.079] (-3722.267) * [-3724.962] (-3732.045) (-3727.541) (-3725.014) -- 0:04:49 43500 -- (-3725.329) (-3722.737) (-3729.168) [-3723.040] * [-3719.603] (-3727.597) (-3725.432) (-3719.671) -- 0:04:45 44000 -- (-3722.638) (-3730.305) (-3729.206) [-3720.604] * (-3726.417) (-3721.050) (-3719.475) [-3721.944] -- 0:04:42 44500 -- (-3723.423) (-3727.286) (-3729.758) [-3723.364] * (-3717.986) (-3717.799) [-3721.375] (-3720.329) -- 0:05:00 45000 -- (-3720.428) (-3720.722) (-3725.640) [-3722.213] * (-3721.896) (-3722.362) [-3721.989] (-3722.164) -- 0:04:57 Average standard deviation of split frequencies: 0.000000 45500 -- (-3724.769) [-3727.432] (-3728.423) (-3722.912) * (-3723.462) [-3720.318] (-3719.351) (-3728.507) -- 0:04:53 46000 -- (-3726.167) [-3727.044] (-3722.640) (-3722.072) * (-3720.208) (-3720.950) [-3721.502] (-3728.352) -- 0:04:50 46500 -- (-3724.350) (-3723.124) (-3718.272) [-3725.030] * (-3717.969) [-3721.607] (-3722.854) (-3727.193) -- 0:04:47 47000 -- (-3722.718) (-3717.994) [-3723.933] (-3726.733) * (-3720.662) [-3720.400] (-3724.236) (-3720.467) -- 0:04:43 47500 -- (-3725.176) [-3724.005] (-3720.740) (-3721.890) * [-3719.663] (-3725.237) (-3720.748) (-3720.292) -- 0:05:00 48000 -- [-3722.020] (-3722.116) (-3724.320) (-3722.183) * (-3721.725) [-3721.258] (-3718.747) (-3729.360) -- 0:04:57 48500 -- (-3718.137) [-3719.828] (-3729.263) (-3726.044) * (-3724.007) (-3719.542) (-3725.032) [-3726.536] -- 0:04:54 49000 -- [-3719.362] (-3728.565) (-3726.677) (-3724.629) * (-3720.110) (-3720.997) [-3728.299] (-3721.651) -- 0:04:51 49500 -- (-3720.426) (-3726.676) (-3721.441) [-3719.277] * [-3722.351] (-3727.295) (-3724.295) (-3727.785) -- 0:04:48 50000 -- [-3720.938] (-3728.979) (-3727.425) (-3725.267) * (-3725.641) [-3720.472] (-3723.702) (-3728.322) -- 0:04:45 Average standard deviation of split frequencies: 0.000000 50500 -- (-3726.174) (-3721.324) (-3723.276) [-3724.519] * (-3725.531) [-3721.138] (-3724.084) (-3722.539) -- 0:04:42 51000 -- [-3722.738] (-3723.719) (-3725.589) (-3724.337) * (-3725.892) [-3721.531] (-3722.848) (-3716.462) -- 0:04:57 51500 -- (-3723.076) (-3727.385) [-3720.420] (-3734.565) * (-3719.224) (-3728.865) (-3723.052) [-3716.727] -- 0:04:54 52000 -- [-3721.621] (-3724.870) (-3721.314) (-3724.618) * (-3721.400) [-3730.206] (-3724.831) (-3723.355) -- 0:04:51 52500 -- [-3717.525] (-3733.074) (-3720.101) (-3723.549) * (-3729.585) (-3728.635) (-3722.427) [-3722.331] -- 0:04:48 53000 -- (-3722.621) (-3731.150) [-3722.308] (-3727.775) * (-3729.133) (-3726.328) [-3720.200] (-3729.374) -- 0:04:45 53500 -- (-3722.072) [-3725.083] (-3727.389) (-3726.617) * (-3733.532) (-3722.195) (-3726.139) [-3721.516] -- 0:04:43 54000 -- (-3725.537) [-3726.699] (-3724.834) (-3719.797) * (-3721.739) (-3720.032) [-3724.212] (-3723.907) -- 0:04:40 54500 -- (-3723.120) (-3723.624) [-3720.983] (-3718.647) * (-3726.300) (-3722.727) [-3725.969] (-3723.865) -- 0:04:54 55000 -- (-3721.218) (-3723.639) [-3718.086] (-3725.194) * (-3721.409) [-3726.191] (-3723.345) (-3723.770) -- 0:04:52 Average standard deviation of split frequencies: 0.000000 55500 -- [-3720.494] (-3717.253) (-3725.314) (-3720.235) * [-3723.791] (-3722.644) (-3720.749) (-3722.996) -- 0:04:49 56000 -- (-3718.482) [-3720.408] (-3731.419) (-3723.180) * (-3720.821) [-3715.509] (-3723.235) (-3720.925) -- 0:04:46 56500 -- (-3720.571) (-3723.906) (-3724.781) [-3724.485] * (-3722.633) [-3721.281] (-3724.540) (-3723.515) -- 0:04:43 57000 -- [-3725.766] (-3727.003) (-3718.519) (-3719.256) * (-3721.029) (-3723.358) (-3718.973) [-3721.821] -- 0:04:41 57500 -- (-3726.502) (-3721.075) (-3719.658) [-3719.944] * (-3725.535) (-3722.545) [-3721.527] (-3717.836) -- 0:04:38 58000 -- (-3721.068) [-3722.847] (-3722.805) (-3723.769) * (-3723.426) (-3719.059) (-3725.993) [-3719.074] -- 0:04:52 58500 -- (-3718.997) [-3726.166] (-3720.768) (-3722.027) * (-3726.679) (-3725.452) (-3724.940) [-3721.281] -- 0:04:49 59000 -- (-3717.707) [-3721.909] (-3723.894) (-3718.212) * (-3721.412) (-3726.604) [-3722.320] (-3721.140) -- 0:04:47 59500 -- (-3720.994) [-3718.199] (-3722.116) (-3716.763) * (-3720.935) [-3725.888] (-3725.200) (-3721.457) -- 0:04:44 60000 -- (-3723.314) (-3720.152) (-3724.802) [-3720.667] * (-3726.687) (-3730.921) (-3724.808) [-3720.169] -- 0:04:42 Average standard deviation of split frequencies: 0.000000 60500 -- (-3721.355) (-3731.446) [-3725.623] (-3722.944) * (-3723.901) (-3719.784) (-3720.074) [-3721.632] -- 0:04:39 61000 -- (-3722.333) (-3722.122) [-3720.509] (-3722.683) * (-3729.255) (-3722.119) [-3722.295] (-3730.012) -- 0:04:37 61500 -- (-3718.917) [-3724.467] (-3724.737) (-3725.046) * (-3720.598) [-3725.253] (-3724.901) (-3719.293) -- 0:04:49 62000 -- (-3720.583) (-3731.260) (-3721.024) [-3723.080] * [-3723.531] (-3727.481) (-3726.659) (-3720.934) -- 0:04:47 62500 -- (-3723.644) (-3725.541) (-3719.427) [-3720.774] * (-3723.484) (-3726.516) (-3732.369) [-3724.726] -- 0:04:45 63000 -- (-3719.631) [-3730.280] (-3717.080) (-3725.307) * [-3724.353] (-3731.883) (-3720.459) (-3725.421) -- 0:04:42 63500 -- (-3724.149) (-3729.075) (-3727.974) [-3720.884] * (-3723.947) [-3720.938] (-3724.297) (-3724.189) -- 0:04:40 64000 -- (-3720.754) [-3723.627] (-3726.822) (-3726.289) * [-3720.525] (-3723.457) (-3724.388) (-3722.890) -- 0:04:37 64500 -- (-3728.421) (-3722.928) (-3726.576) [-3723.442] * (-3724.528) (-3721.982) (-3720.831) [-3722.279] -- 0:04:35 65000 -- (-3723.234) [-3723.199] (-3725.918) (-3732.031) * (-3721.437) (-3722.585) (-3720.970) [-3725.839] -- 0:04:47 Average standard deviation of split frequencies: 0.000000 65500 -- (-3724.922) (-3731.777) [-3723.477] (-3723.501) * (-3728.581) (-3720.002) (-3720.540) [-3722.404] -- 0:04:45 66000 -- (-3720.661) (-3722.848) [-3718.678] (-3723.083) * (-3724.729) [-3728.168] (-3725.867) (-3720.830) -- 0:04:43 66500 -- [-3719.158] (-3724.117) (-3722.412) (-3722.045) * (-3723.150) [-3723.793] (-3723.496) (-3728.116) -- 0:04:40 67000 -- [-3722.555] (-3717.634) (-3721.942) (-3729.751) * [-3717.666] (-3725.399) (-3723.039) (-3728.621) -- 0:04:38 67500 -- (-3727.682) [-3722.396] (-3728.955) (-3721.432) * (-3723.054) (-3723.569) [-3726.786] (-3726.638) -- 0:04:36 68000 -- (-3727.266) [-3717.928] (-3725.326) (-3723.588) * (-3723.644) (-3725.008) (-3723.159) [-3719.688] -- 0:04:34 68500 -- (-3730.222) [-3720.461] (-3725.408) (-3718.742) * [-3719.664] (-3727.630) (-3725.259) (-3723.671) -- 0:04:45 69000 -- (-3724.757) (-3718.768) (-3727.234) [-3719.979] * (-3719.973) (-3727.660) [-3721.093] (-3718.870) -- 0:04:43 69500 -- (-3719.316) (-3724.133) (-3719.776) [-3721.968] * (-3719.091) (-3720.600) [-3721.609] (-3726.896) -- 0:04:41 70000 -- (-3720.597) [-3724.548] (-3728.354) (-3728.384) * (-3728.025) (-3717.826) [-3720.356] (-3730.285) -- 0:04:39 Average standard deviation of split frequencies: 0.000000 70500 -- (-3721.437) (-3734.272) (-3721.068) [-3722.639] * (-3723.398) (-3720.313) (-3720.643) [-3722.964] -- 0:04:36 71000 -- (-3722.266) (-3725.104) [-3725.690] (-3725.370) * (-3720.627) (-3719.443) [-3722.118] (-3725.577) -- 0:04:34 71500 -- [-3721.470] (-3721.673) (-3723.238) (-3721.078) * (-3727.598) [-3720.579] (-3722.290) (-3719.415) -- 0:04:32 72000 -- (-3720.671) (-3725.657) (-3727.880) [-3727.514] * (-3715.945) [-3731.484] (-3723.254) (-3720.496) -- 0:04:30 72500 -- (-3721.456) (-3726.379) (-3730.692) [-3726.349] * [-3719.004] (-3721.534) (-3723.555) (-3724.722) -- 0:04:41 73000 -- [-3718.304] (-3722.615) (-3727.269) (-3720.804) * (-3721.167) (-3730.142) [-3719.561] (-3733.932) -- 0:04:39 73500 -- [-3726.408] (-3727.531) (-3727.590) (-3717.288) * (-3721.294) [-3721.911] (-3719.906) (-3723.723) -- 0:04:37 74000 -- (-3725.117) [-3721.408] (-3730.551) (-3727.344) * [-3721.157] (-3721.156) (-3722.914) (-3732.800) -- 0:04:35 74500 -- (-3722.188) (-3719.795) (-3723.691) [-3727.309] * (-3721.707) (-3726.813) [-3727.216] (-3733.714) -- 0:04:33 75000 -- (-3721.452) [-3722.678] (-3719.260) (-3724.799) * (-3718.975) [-3727.415] (-3724.631) (-3721.153) -- 0:04:31 Average standard deviation of split frequencies: 0.000000 75500 -- [-3723.352] (-3718.718) (-3726.843) (-3719.454) * (-3724.493) (-3725.067) [-3719.099] (-3721.317) -- 0:04:29 76000 -- (-3724.301) (-3720.992) (-3721.159) [-3717.266] * [-3726.365] (-3727.362) (-3721.722) (-3718.445) -- 0:04:39 76500 -- [-3720.208] (-3720.928) (-3727.503) (-3717.368) * (-3721.900) [-3720.838] (-3717.634) (-3728.359) -- 0:04:37 77000 -- (-3727.046) (-3722.352) (-3721.724) [-3718.220] * [-3720.544] (-3716.880) (-3724.813) (-3721.351) -- 0:04:35 77500 -- (-3724.066) (-3720.351) (-3722.500) [-3720.274] * (-3718.460) (-3723.255) (-3724.786) [-3722.000] -- 0:04:33 78000 -- (-3727.519) (-3725.610) [-3718.155] (-3721.661) * [-3719.339] (-3724.253) (-3725.631) (-3723.651) -- 0:04:31 78500 -- (-3719.690) (-3726.551) [-3719.501] (-3725.177) * (-3722.273) (-3718.773) [-3723.385] (-3720.309) -- 0:04:29 79000 -- (-3721.174) [-3724.687] (-3720.376) (-3722.470) * (-3730.104) [-3721.714] (-3721.197) (-3721.398) -- 0:04:28 79500 -- (-3728.829) [-3721.728] (-3724.284) (-3723.433) * (-3724.751) (-3722.930) (-3731.043) [-3723.920] -- 0:04:37 80000 -- (-3722.916) (-3727.014) [-3720.472] (-3721.839) * (-3723.490) (-3721.229) [-3726.427] (-3724.727) -- 0:04:36 Average standard deviation of split frequencies: 0.000000 80500 -- [-3719.582] (-3724.674) (-3724.648) (-3720.409) * [-3721.640] (-3725.536) (-3719.108) (-3728.050) -- 0:04:34 81000 -- [-3720.281] (-3722.676) (-3721.366) (-3725.290) * (-3719.601) (-3723.555) (-3725.319) [-3724.552] -- 0:04:32 81500 -- [-3718.027] (-3725.184) (-3725.160) (-3722.173) * (-3718.555) [-3718.184] (-3721.418) (-3728.652) -- 0:04:30 82000 -- (-3725.974) (-3725.200) [-3723.214] (-3727.289) * (-3720.551) (-3726.406) (-3724.280) [-3724.339] -- 0:04:28 82500 -- (-3724.327) (-3721.616) (-3719.932) [-3722.368] * (-3724.651) [-3716.820] (-3731.646) (-3725.090) -- 0:04:26 83000 -- (-3719.805) (-3720.468) [-3722.051] (-3728.845) * (-3719.394) [-3722.731] (-3726.016) (-3731.174) -- 0:04:36 83500 -- (-3722.762) (-3719.349) [-3725.263] (-3723.251) * (-3720.705) (-3725.728) (-3727.620) [-3724.385] -- 0:04:34 84000 -- (-3725.601) (-3724.619) (-3722.583) [-3721.529] * (-3728.347) [-3728.383] (-3727.331) (-3721.265) -- 0:04:32 84500 -- (-3733.180) (-3724.853) (-3719.732) [-3721.470] * (-3736.088) (-3731.127) [-3725.326] (-3725.361) -- 0:04:30 85000 -- (-3720.683) (-3724.354) [-3717.365] (-3724.278) * (-3720.354) (-3722.025) (-3722.359) [-3726.209] -- 0:04:29 Average standard deviation of split frequencies: 0.000000 85500 -- [-3720.853] (-3724.168) (-3719.955) (-3724.255) * (-3726.438) (-3721.264) [-3727.710] (-3722.468) -- 0:04:27 86000 -- (-3718.571) [-3721.172] (-3724.234) (-3724.923) * (-3719.916) (-3728.109) (-3722.833) [-3719.390] -- 0:04:25 86500 -- [-3717.936] (-3725.725) (-3725.751) (-3719.733) * (-3726.684) (-3721.159) [-3718.496] (-3718.117) -- 0:04:34 87000 -- (-3723.013) (-3723.950) (-3718.626) [-3719.058] * (-3723.315) (-3719.624) (-3723.483) [-3721.050] -- 0:04:32 87500 -- (-3726.941) (-3724.626) (-3728.725) [-3727.249] * (-3737.646) (-3723.916) (-3719.530) [-3719.409] -- 0:04:31 88000 -- [-3721.225] (-3719.787) (-3720.686) (-3727.311) * (-3729.259) [-3720.958] (-3721.691) (-3720.530) -- 0:04:29 88500 -- [-3723.775] (-3727.801) (-3721.746) (-3732.088) * [-3726.202] (-3719.567) (-3718.523) (-3719.441) -- 0:04:27 89000 -- (-3719.902) [-3726.217] (-3726.118) (-3726.417) * (-3727.071) [-3722.866] (-3721.104) (-3718.171) -- 0:04:26 89500 -- (-3722.000) (-3722.139) [-3719.353] (-3725.625) * (-3732.139) (-3721.231) (-3718.110) [-3720.079] -- 0:04:24 90000 -- (-3720.635) (-3728.684) [-3722.840] (-3722.730) * (-3721.200) (-3718.953) (-3726.558) [-3720.697] -- 0:04:33 Average standard deviation of split frequencies: 0.000000 90500 -- [-3722.347] (-3725.636) (-3723.006) (-3717.590) * (-3728.785) [-3718.034] (-3721.790) (-3722.667) -- 0:04:31 91000 -- (-3727.306) (-3725.241) [-3724.188] (-3719.906) * (-3725.435) [-3722.247] (-3725.695) (-3719.853) -- 0:04:29 91500 -- (-3718.538) (-3724.583) (-3726.259) [-3719.852] * [-3723.852] (-3720.534) (-3729.750) (-3721.390) -- 0:04:28 92000 -- [-3720.298] (-3723.562) (-3724.579) (-3722.843) * (-3735.393) [-3723.131] (-3725.869) (-3725.449) -- 0:04:26 92500 -- (-3722.901) [-3723.403] (-3719.481) (-3721.751) * (-3722.990) (-3722.751) [-3727.661] (-3723.443) -- 0:04:24 93000 -- (-3728.454) (-3720.507) (-3719.266) [-3721.007] * (-3721.552) (-3722.316) [-3719.587] (-3725.983) -- 0:04:23 93500 -- [-3728.498] (-3721.899) (-3720.379) (-3720.666) * [-3725.272] (-3723.301) (-3722.032) (-3723.384) -- 0:04:21 94000 -- (-3727.786) (-3721.813) (-3728.225) [-3725.003] * (-3719.361) (-3725.860) (-3725.219) [-3718.913] -- 0:04:29 94500 -- (-3726.628) (-3720.328) (-3719.727) [-3722.563] * [-3720.937] (-3723.170) (-3720.511) (-3722.630) -- 0:04:28 95000 -- (-3727.442) (-3720.441) [-3718.910] (-3724.878) * (-3725.050) [-3717.556] (-3729.616) (-3724.764) -- 0:04:26 Average standard deviation of split frequencies: 0.000000 95500 -- (-3725.292) (-3724.805) [-3721.863] (-3729.767) * (-3718.437) (-3719.642) (-3725.833) [-3722.372] -- 0:04:25 96000 -- (-3719.003) (-3720.405) [-3719.561] (-3727.816) * (-3721.497) [-3720.972] (-3724.594) (-3728.099) -- 0:04:23 96500 -- [-3720.466] (-3725.231) (-3722.945) (-3723.415) * [-3721.934] (-3728.233) (-3718.217) (-3723.460) -- 0:04:22 97000 -- (-3719.233) [-3727.061] (-3722.715) (-3731.515) * (-3735.499) (-3729.466) [-3720.084] (-3722.311) -- 0:04:20 97500 -- (-3721.188) (-3726.895) (-3727.346) [-3723.827] * (-3722.568) (-3726.846) [-3723.508] (-3721.791) -- 0:04:28 98000 -- (-3724.331) (-3723.454) [-3728.593] (-3725.440) * (-3724.622) (-3725.677) [-3721.589] (-3717.707) -- 0:04:26 98500 -- [-3718.893] (-3723.079) (-3723.850) (-3728.153) * (-3726.580) (-3724.598) (-3716.414) [-3718.215] -- 0:04:25 99000 -- (-3721.508) [-3723.282] (-3730.991) (-3728.158) * (-3724.347) (-3726.008) [-3722.596] (-3721.181) -- 0:04:23 99500 -- [-3721.063] (-3725.191) (-3729.727) (-3720.299) * (-3722.173) (-3726.824) [-3723.778] (-3721.902) -- 0:04:22 100000 -- [-3721.540] (-3725.973) (-3728.358) (-3720.525) * [-3723.564] (-3721.589) (-3721.972) (-3718.818) -- 0:04:21 Average standard deviation of split frequencies: 0.000000 100500 -- (-3726.508) (-3722.783) (-3722.872) [-3718.970] * (-3724.284) (-3720.981) (-3721.757) [-3719.086] -- 0:04:19 101000 -- [-3724.427] (-3725.512) (-3728.846) (-3718.443) * (-3721.144) [-3719.076] (-3722.380) (-3715.905) -- 0:04:27 101500 -- (-3726.236) (-3725.527) (-3732.765) [-3718.562] * (-3726.674) (-3725.356) [-3721.629] (-3718.804) -- 0:04:25 102000 -- (-3724.019) (-3726.845) [-3719.955] (-3717.330) * (-3726.373) (-3730.098) [-3724.556] (-3723.438) -- 0:04:24 102500 -- [-3724.053] (-3728.100) (-3719.559) (-3718.016) * [-3726.177] (-3723.475) (-3731.006) (-3720.257) -- 0:04:22 103000 -- (-3722.206) (-3722.456) [-3718.075] (-3720.602) * [-3728.877] (-3724.561) (-3725.668) (-3719.215) -- 0:04:21 103500 -- (-3725.536) (-3723.374) (-3724.894) [-3722.311] * (-3724.322) (-3724.249) (-3730.177) [-3720.449] -- 0:04:19 104000 -- (-3725.589) (-3719.541) (-3719.495) [-3722.785] * [-3731.837] (-3721.712) (-3723.175) (-3732.445) -- 0:04:18 104500 -- (-3725.484) (-3724.216) (-3725.579) [-3720.331] * (-3731.448) [-3726.836] (-3721.820) (-3726.029) -- 0:04:25 105000 -- (-3723.894) [-3727.423] (-3720.878) (-3720.283) * (-3724.326) (-3721.064) [-3723.334] (-3726.900) -- 0:04:24 Average standard deviation of split frequencies: 0.000000 105500 -- (-3724.037) (-3726.646) (-3719.725) [-3724.683] * (-3724.786) (-3723.047) (-3724.978) [-3726.106] -- 0:04:22 106000 -- (-3730.567) (-3726.310) [-3724.378] (-3728.044) * (-3719.618) (-3723.976) (-3726.470) [-3724.710] -- 0:04:21 106500 -- (-3726.151) (-3731.764) (-3724.334) [-3722.832] * [-3720.185] (-3726.230) (-3731.786) (-3723.757) -- 0:04:20 107000 -- [-3722.465] (-3737.338) (-3734.617) (-3726.051) * (-3719.759) (-3724.629) [-3720.768] (-3729.098) -- 0:04:18 107500 -- (-3719.750) (-3732.240) (-3727.260) [-3722.574] * (-3728.472) (-3724.727) (-3718.529) [-3719.251] -- 0:04:17 108000 -- [-3720.311] (-3730.165) (-3731.567) (-3721.148) * (-3729.986) (-3722.441) [-3716.684] (-3729.211) -- 0:04:24 108500 -- (-3722.371) [-3719.323] (-3721.913) (-3732.154) * (-3733.795) [-3720.132] (-3720.226) (-3721.320) -- 0:04:22 109000 -- (-3723.607) (-3721.069) [-3721.336] (-3723.191) * (-3734.776) [-3719.869] (-3725.361) (-3718.393) -- 0:04:21 109500 -- [-3720.928] (-3722.486) (-3721.838) (-3728.269) * [-3721.215] (-3726.981) (-3727.064) (-3732.352) -- 0:04:20 110000 -- (-3720.206) (-3728.749) (-3727.811) [-3724.784] * (-3721.165) [-3719.996] (-3723.268) (-3726.338) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 110500 -- (-3720.020) [-3725.881] (-3727.567) (-3726.797) * [-3720.069] (-3722.152) (-3726.086) (-3719.594) -- 0:04:17 111000 -- [-3718.666] (-3727.814) (-3724.010) (-3722.256) * (-3718.378) (-3719.359) [-3725.406] (-3717.961) -- 0:04:16 111500 -- (-3719.362) [-3724.428] (-3721.121) (-3722.946) * (-3723.010) [-3729.069] (-3723.909) (-3721.354) -- 0:04:22 112000 -- [-3724.058] (-3722.926) (-3720.740) (-3729.547) * [-3718.516] (-3719.859) (-3723.922) (-3721.174) -- 0:04:21 112500 -- (-3718.492) [-3722.255] (-3728.006) (-3723.619) * [-3720.802] (-3724.328) (-3718.952) (-3721.567) -- 0:04:20 113000 -- (-3719.609) (-3721.905) [-3721.112] (-3721.614) * (-3721.068) [-3723.139] (-3728.832) (-3716.949) -- 0:04:19 113500 -- [-3724.075] (-3729.159) (-3726.915) (-3721.756) * (-3718.993) (-3720.914) [-3725.143] (-3724.678) -- 0:04:17 114000 -- [-3717.763] (-3728.924) (-3728.909) (-3725.018) * (-3716.227) [-3718.783] (-3727.011) (-3720.728) -- 0:04:16 114500 -- (-3722.592) (-3731.106) (-3724.627) [-3731.888] * (-3723.494) (-3722.422) [-3718.228] (-3722.610) -- 0:04:15 115000 -- [-3718.391] (-3718.940) (-3723.641) (-3725.542) * [-3721.072] (-3727.793) (-3727.705) (-3722.707) -- 0:04:13 Average standard deviation of split frequencies: 0.000000 115500 -- (-3723.359) (-3720.216) [-3726.878] (-3738.442) * (-3730.037) [-3724.255] (-3730.581) (-3723.892) -- 0:04:20 116000 -- [-3718.813] (-3721.318) (-3723.011) (-3731.220) * (-3722.148) (-3721.807) [-3723.895] (-3722.996) -- 0:04:19 116500 -- [-3717.110] (-3722.697) (-3716.943) (-3735.583) * (-3728.482) [-3724.888] (-3723.224) (-3722.116) -- 0:04:17 117000 -- (-3721.838) [-3721.862] (-3720.576) (-3731.280) * (-3727.575) (-3725.072) (-3731.377) [-3722.708] -- 0:04:16 117500 -- (-3720.059) (-3717.814) (-3720.498) [-3721.266] * [-3719.993] (-3727.600) (-3727.490) (-3721.701) -- 0:04:15 118000 -- (-3723.682) [-3723.852] (-3722.623) (-3719.664) * (-3720.013) (-3730.482) (-3725.404) [-3725.337] -- 0:04:14 118500 -- [-3722.770] (-3725.323) (-3722.947) (-3723.209) * (-3720.235) (-3733.240) (-3728.344) [-3724.205] -- 0:04:12 119000 -- (-3720.271) (-3727.337) (-3729.099) [-3722.365] * [-3723.959] (-3730.794) (-3724.105) (-3720.230) -- 0:04:19 119500 -- (-3718.466) (-3720.894) [-3722.950] (-3724.746) * (-3723.049) (-3722.263) [-3724.163] (-3730.358) -- 0:04:17 120000 -- (-3723.859) (-3722.749) (-3724.530) [-3724.677] * [-3718.937] (-3723.420) (-3724.175) (-3722.220) -- 0:04:16 Average standard deviation of split frequencies: 0.000000 120500 -- (-3723.973) [-3724.204] (-3723.629) (-3728.107) * (-3726.855) (-3727.843) (-3723.698) [-3723.583] -- 0:04:15 121000 -- (-3721.152) [-3721.923] (-3726.597) (-3726.618) * (-3720.509) (-3728.745) (-3723.195) [-3717.690] -- 0:04:14 121500 -- (-3727.399) (-3721.524) (-3721.522) [-3719.917] * [-3726.535] (-3722.380) (-3722.985) (-3721.880) -- 0:04:13 122000 -- [-3719.060] (-3723.688) (-3723.728) (-3723.688) * (-3724.593) (-3725.811) [-3720.399] (-3722.178) -- 0:04:11 122500 -- (-3723.600) (-3723.428) [-3718.216] (-3720.727) * (-3721.804) (-3721.722) [-3727.085] (-3721.089) -- 0:04:17 123000 -- [-3718.436] (-3729.169) (-3722.854) (-3720.531) * (-3722.538) [-3728.146] (-3723.105) (-3719.944) -- 0:04:16 123500 -- [-3720.377] (-3724.361) (-3720.611) (-3723.766) * (-3716.824) [-3723.712] (-3728.897) (-3723.838) -- 0:04:15 124000 -- (-3721.651) (-3724.212) [-3721.980] (-3729.072) * [-3722.191] (-3720.272) (-3723.815) (-3720.815) -- 0:04:14 124500 -- (-3728.372) (-3724.829) (-3725.362) [-3727.060] * [-3719.064] (-3722.744) (-3726.402) (-3732.396) -- 0:04:13 125000 -- (-3722.549) [-3721.344] (-3721.475) (-3727.202) * (-3723.556) [-3724.327] (-3729.859) (-3721.487) -- 0:04:12 Average standard deviation of split frequencies: 0.000000 125500 -- (-3727.261) (-3721.693) [-3723.521] (-3722.788) * (-3721.039) (-3720.221) [-3725.584] (-3719.955) -- 0:04:10 126000 -- (-3728.703) [-3720.927] (-3728.529) (-3722.795) * (-3726.119) (-3721.413) (-3724.077) [-3720.225] -- 0:04:16 126500 -- [-3724.163] (-3717.600) (-3719.310) (-3717.671) * (-3723.227) [-3724.258] (-3729.782) (-3719.512) -- 0:04:15 127000 -- (-3727.944) [-3716.527] (-3720.479) (-3719.842) * (-3722.294) (-3720.213) [-3721.938] (-3727.376) -- 0:04:14 127500 -- (-3724.879) (-3721.101) [-3725.093] (-3723.831) * (-3724.042) (-3721.884) (-3727.679) [-3722.635] -- 0:04:13 128000 -- (-3729.556) [-3718.150] (-3726.201) (-3720.843) * (-3724.722) [-3724.831] (-3724.407) (-3726.043) -- 0:04:12 128500 -- [-3724.400] (-3725.334) (-3720.679) (-3720.786) * [-3721.966] (-3718.548) (-3728.638) (-3726.332) -- 0:04:10 129000 -- (-3718.888) (-3721.090) [-3729.975] (-3720.005) * (-3721.370) [-3721.902] (-3718.964) (-3729.300) -- 0:04:09 129500 -- [-3717.765] (-3723.556) (-3725.292) (-3726.513) * (-3721.187) [-3723.672] (-3717.468) (-3720.930) -- 0:04:15 130000 -- (-3723.164) [-3726.339] (-3719.497) (-3720.981) * [-3718.988] (-3725.656) (-3726.196) (-3722.251) -- 0:04:14 Average standard deviation of split frequencies: 0.000000 130500 -- [-3722.399] (-3722.572) (-3723.401) (-3721.797) * (-3720.943) [-3719.777] (-3724.863) (-3726.134) -- 0:04:13 131000 -- (-3726.092) (-3722.029) (-3722.159) [-3719.043] * (-3726.094) [-3724.999] (-3720.183) (-3726.452) -- 0:04:12 131500 -- (-3722.511) (-3723.374) (-3720.040) [-3721.741] * (-3720.596) (-3724.158) [-3721.523] (-3722.646) -- 0:04:10 132000 -- (-3723.558) [-3718.514] (-3726.913) (-3717.474) * (-3731.958) (-3725.351) [-3722.282] (-3722.040) -- 0:04:09 132500 -- [-3718.992] (-3720.251) (-3727.988) (-3724.670) * (-3723.696) (-3722.345) (-3727.153) [-3722.698] -- 0:04:08 133000 -- [-3718.978] (-3722.501) (-3726.372) (-3719.411) * [-3723.860] (-3721.084) (-3723.654) (-3720.851) -- 0:04:07 133500 -- [-3720.411] (-3727.768) (-3721.435) (-3720.026) * (-3724.859) (-3728.196) (-3718.980) [-3720.782] -- 0:04:13 134000 -- [-3724.042] (-3725.652) (-3722.335) (-3727.020) * (-3722.019) (-3729.186) (-3723.320) [-3719.661] -- 0:04:12 134500 -- [-3719.576] (-3725.377) (-3718.980) (-3718.461) * (-3723.995) (-3725.625) (-3720.730) [-3721.486] -- 0:04:10 135000 -- (-3722.608) (-3720.282) [-3719.280] (-3724.274) * (-3724.055) (-3722.466) [-3716.531] (-3724.587) -- 0:04:09 Average standard deviation of split frequencies: 0.000000 135500 -- (-3726.324) (-3720.723) [-3727.215] (-3720.181) * (-3721.339) (-3725.335) (-3718.564) [-3725.929] -- 0:04:08 136000 -- (-3723.060) [-3727.107] (-3723.861) (-3720.541) * (-3725.315) (-3722.066) (-3719.311) [-3731.111] -- 0:04:07 136500 -- (-3725.016) [-3721.313] (-3719.623) (-3723.927) * (-3726.394) (-3726.017) (-3720.124) [-3722.251] -- 0:04:06 137000 -- [-3722.261] (-3727.748) (-3723.138) (-3720.960) * (-3723.799) [-3719.844] (-3724.791) (-3719.988) -- 0:04:11 137500 -- (-3721.065) [-3721.317] (-3719.052) (-3718.811) * [-3721.956] (-3723.283) (-3722.214) (-3721.690) -- 0:04:10 138000 -- (-3720.728) (-3724.574) (-3725.689) [-3725.994] * (-3728.823) (-3723.515) (-3726.405) [-3722.389] -- 0:04:09 138500 -- (-3722.609) [-3722.978] (-3723.072) (-3722.062) * [-3719.891] (-3725.842) (-3722.772) (-3723.852) -- 0:04:08 139000 -- (-3728.656) (-3724.968) (-3723.649) [-3722.424] * (-3725.027) (-3724.937) (-3723.472) [-3723.871] -- 0:04:07 139500 -- (-3734.371) (-3724.612) [-3722.840] (-3728.579) * (-3722.708) [-3725.876] (-3725.299) (-3719.157) -- 0:04:06 140000 -- (-3727.642) [-3720.073] (-3722.679) (-3722.443) * (-3719.368) [-3717.554] (-3724.411) (-3725.004) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 140500 -- (-3728.243) (-3720.894) (-3724.184) [-3719.805] * [-3719.805] (-3722.976) (-3729.910) (-3719.246) -- 0:04:10 141000 -- (-3722.489) (-3721.801) [-3719.873] (-3726.654) * [-3719.291] (-3722.463) (-3732.590) (-3718.268) -- 0:04:09 141500 -- (-3725.994) (-3731.093) (-3722.232) [-3722.623] * [-3723.826] (-3722.599) (-3722.185) (-3720.064) -- 0:04:08 142000 -- (-3724.207) [-3720.337] (-3720.504) (-3724.770) * [-3720.738] (-3718.259) (-3722.423) (-3726.877) -- 0:04:07 142500 -- (-3722.625) (-3724.470) [-3723.695] (-3725.595) * (-3719.294) [-3720.023] (-3723.427) (-3727.572) -- 0:04:06 143000 -- (-3723.825) (-3721.497) [-3720.635] (-3721.712) * (-3722.362) [-3721.254] (-3721.298) (-3722.069) -- 0:04:05 143500 -- (-3726.237) (-3728.238) [-3719.588] (-3722.345) * [-3722.429] (-3725.745) (-3722.953) (-3721.226) -- 0:04:04 144000 -- [-3718.548] (-3724.120) (-3724.228) (-3721.318) * (-3721.685) [-3725.642] (-3723.137) (-3722.660) -- 0:04:09 144500 -- (-3719.600) (-3724.749) [-3724.352] (-3722.968) * (-3726.580) (-3725.700) (-3723.126) [-3727.501] -- 0:04:08 145000 -- (-3721.634) (-3732.105) (-3719.287) [-3721.009] * [-3721.404] (-3719.488) (-3723.075) (-3723.082) -- 0:04:07 Average standard deviation of split frequencies: 0.000000 145500 -- [-3725.200] (-3725.336) (-3720.497) (-3719.116) * (-3723.322) (-3720.584) [-3719.962] (-3716.552) -- 0:04:06 146000 -- (-3725.749) (-3726.715) [-3726.269] (-3721.499) * (-3722.515) (-3723.574) [-3720.116] (-3721.337) -- 0:04:05 146500 -- [-3723.073] (-3725.568) (-3724.089) (-3718.545) * [-3719.839] (-3719.804) (-3719.760) (-3723.912) -- 0:04:04 147000 -- (-3725.108) (-3729.479) [-3723.089] (-3723.754) * (-3719.425) [-3721.918] (-3725.094) (-3724.803) -- 0:04:03 147500 -- (-3731.726) (-3728.877) [-3726.665] (-3726.850) * (-3724.769) (-3721.142) (-3719.618) [-3724.187] -- 0:04:08 148000 -- (-3729.953) [-3722.169] (-3723.817) (-3727.287) * (-3723.058) [-3721.284] (-3725.190) (-3727.891) -- 0:04:07 148500 -- (-3723.629) (-3720.538) [-3721.778] (-3725.574) * (-3722.003) [-3719.841] (-3726.463) (-3723.342) -- 0:04:06 149000 -- (-3720.493) [-3726.621] (-3723.702) (-3720.173) * (-3722.731) (-3723.491) [-3726.389] (-3720.073) -- 0:04:05 149500 -- (-3722.814) (-3728.040) (-3722.552) [-3722.892] * (-3727.566) (-3720.754) (-3726.565) [-3722.296] -- 0:04:04 150000 -- [-3718.545] (-3719.716) (-3727.408) (-3717.651) * (-3726.445) (-3722.916) (-3727.731) [-3723.128] -- 0:04:03 Average standard deviation of split frequencies: 0.000000 150500 -- [-3719.120] (-3718.537) (-3718.060) (-3724.910) * (-3720.697) [-3718.136] (-3727.795) (-3726.301) -- 0:04:02 151000 -- (-3719.810) (-3717.811) [-3724.404] (-3722.609) * [-3724.051] (-3726.491) (-3726.411) (-3724.062) -- 0:04:07 151500 -- [-3716.237] (-3722.650) (-3720.657) (-3729.120) * (-3724.881) (-3721.598) (-3722.052) [-3721.171] -- 0:04:06 152000 -- [-3721.713] (-3725.043) (-3722.578) (-3721.433) * (-3731.327) (-3724.785) (-3725.238) [-3721.748] -- 0:04:05 152500 -- (-3718.657) [-3719.704] (-3722.679) (-3721.912) * (-3728.839) (-3724.533) (-3720.172) [-3718.898] -- 0:04:04 153000 -- [-3726.213] (-3722.486) (-3728.004) (-3727.047) * (-3724.015) [-3726.817] (-3721.161) (-3721.344) -- 0:04:03 153500 -- (-3723.075) [-3721.045] (-3725.349) (-3722.508) * [-3724.205] (-3732.821) (-3719.048) (-3730.576) -- 0:04:02 154000 -- (-3724.955) (-3724.010) (-3723.182) [-3719.312] * [-3719.867] (-3727.775) (-3719.291) (-3723.966) -- 0:04:01 154500 -- (-3722.728) (-3719.704) (-3720.062) [-3718.711] * (-3723.582) (-3727.596) [-3716.888] (-3726.049) -- 0:04:00 155000 -- [-3721.747] (-3724.514) (-3723.863) (-3721.365) * (-3722.411) (-3730.864) [-3719.593] (-3725.068) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 155500 -- (-3718.947) (-3719.069) (-3719.536) [-3718.531] * (-3727.682) (-3719.637) (-3725.668) [-3725.796] -- 0:04:04 156000 -- [-3719.011] (-3726.567) (-3720.274) (-3723.760) * (-3725.719) (-3720.938) (-3721.460) [-3724.341] -- 0:04:03 156500 -- (-3718.683) (-3727.614) (-3718.379) [-3725.747] * (-3723.785) (-3723.930) [-3724.773] (-3724.050) -- 0:04:02 157000 -- [-3719.630] (-3726.557) (-3724.380) (-3726.699) * (-3722.865) (-3718.561) (-3724.833) [-3721.898] -- 0:04:01 157500 -- (-3722.477) [-3727.730] (-3724.789) (-3716.189) * (-3722.544) [-3726.064] (-3723.801) (-3724.770) -- 0:04:00 158000 -- (-3719.132) [-3722.409] (-3723.165) (-3723.489) * (-3725.515) [-3726.155] (-3724.235) (-3723.537) -- 0:03:59 158500 -- (-3723.171) (-3723.975) [-3716.698] (-3730.443) * [-3722.761] (-3730.043) (-3729.312) (-3722.167) -- 0:04:04 159000 -- (-3719.115) (-3719.202) [-3716.041] (-3727.108) * (-3725.560) (-3723.027) (-3723.642) [-3728.647] -- 0:04:03 159500 -- (-3722.728) [-3720.189] (-3722.454) (-3720.294) * (-3731.519) (-3724.725) [-3724.857] (-3721.156) -- 0:04:02 160000 -- (-3724.238) (-3729.025) [-3723.072] (-3725.917) * (-3725.856) (-3724.333) [-3724.612] (-3728.399) -- 0:04:01 Average standard deviation of split frequencies: 0.000000 160500 -- (-3729.062) (-3720.993) (-3723.003) [-3725.558] * (-3722.842) (-3729.064) [-3721.900] (-3722.700) -- 0:04:00 161000 -- (-3726.592) (-3724.781) [-3722.113] (-3718.848) * (-3720.197) (-3725.494) (-3725.288) [-3726.346] -- 0:03:59 161500 -- (-3720.050) (-3723.798) (-3717.895) [-3721.402] * [-3721.049] (-3723.475) (-3723.716) (-3723.569) -- 0:03:58 162000 -- (-3720.872) [-3721.448] (-3721.769) (-3721.267) * (-3721.334) [-3720.313] (-3721.301) (-3722.800) -- 0:04:03 162500 -- [-3718.555] (-3722.006) (-3720.216) (-3724.259) * [-3721.153] (-3722.661) (-3726.227) (-3721.879) -- 0:04:02 163000 -- (-3729.571) [-3727.745] (-3719.263) (-3721.153) * (-3716.670) (-3723.064) (-3723.308) [-3721.648] -- 0:04:01 163500 -- [-3729.870] (-3724.237) (-3718.392) (-3717.552) * (-3725.476) (-3720.506) (-3726.112) [-3722.505] -- 0:04:00 164000 -- (-3728.798) (-3721.325) (-3719.815) [-3717.431] * [-3726.223] (-3722.719) (-3723.856) (-3723.205) -- 0:03:59 164500 -- (-3732.669) (-3719.863) (-3719.174) [-3722.165] * (-3731.162) (-3717.705) (-3727.849) [-3725.588] -- 0:03:58 165000 -- (-3726.324) [-3723.605] (-3723.494) (-3720.549) * (-3721.845) (-3717.775) [-3721.659] (-3724.554) -- 0:03:57 Average standard deviation of split frequencies: 0.000000 165500 -- [-3721.675] (-3723.519) (-3729.502) (-3720.341) * (-3721.791) [-3721.715] (-3723.377) (-3727.751) -- 0:04:02 166000 -- (-3721.835) (-3724.081) (-3732.384) [-3724.531] * [-3720.981] (-3721.047) (-3723.867) (-3719.040) -- 0:04:01 166500 -- (-3722.165) [-3722.772] (-3733.305) (-3721.519) * (-3715.481) (-3722.979) (-3717.374) [-3718.493] -- 0:04:00 167000 -- (-3720.707) (-3724.265) (-3718.375) [-3720.458] * [-3718.214] (-3724.901) (-3724.078) (-3718.077) -- 0:03:59 167500 -- (-3725.751) (-3721.802) (-3717.864) [-3724.735] * [-3723.119] (-3720.989) (-3729.382) (-3723.020) -- 0:03:58 168000 -- (-3720.471) (-3721.210) [-3724.626] (-3721.567) * (-3726.600) [-3719.153] (-3720.666) (-3728.103) -- 0:03:57 168500 -- (-3721.328) (-3726.639) [-3718.109] (-3721.685) * (-3723.294) (-3719.257) (-3717.889) [-3726.709] -- 0:03:56 169000 -- (-3730.219) (-3731.722) (-3725.238) [-3722.615] * [-3724.148] (-3721.044) (-3721.835) (-3720.333) -- 0:04:00 169500 -- (-3723.602) (-3728.957) [-3720.550] (-3722.550) * [-3721.020] (-3722.151) (-3719.582) (-3723.145) -- 0:04:00 170000 -- (-3723.524) (-3726.620) [-3719.467] (-3725.995) * [-3728.667] (-3722.884) (-3722.083) (-3723.168) -- 0:03:59 Average standard deviation of split frequencies: 0.000000 170500 -- (-3726.533) (-3720.559) [-3717.230] (-3729.618) * (-3724.203) (-3722.322) [-3725.311] (-3723.610) -- 0:03:58 171000 -- (-3721.908) (-3723.585) [-3725.432] (-3721.792) * [-3724.594] (-3722.955) (-3724.864) (-3725.884) -- 0:03:57 171500 -- (-3726.319) [-3720.380] (-3723.986) (-3723.705) * (-3723.108) [-3723.223] (-3728.155) (-3726.771) -- 0:03:56 172000 -- (-3725.836) (-3722.207) [-3718.989] (-3726.573) * (-3724.110) [-3723.947] (-3723.118) (-3725.428) -- 0:03:55 172500 -- (-3719.257) [-3718.157] (-3719.347) (-3718.741) * [-3720.033] (-3722.637) (-3722.010) (-3727.874) -- 0:03:59 173000 -- (-3723.455) (-3728.475) (-3734.565) [-3719.795] * (-3719.314) (-3726.076) (-3724.267) [-3720.004] -- 0:03:59 173500 -- [-3719.356] (-3730.025) (-3725.069) (-3727.448) * (-3723.327) (-3720.329) (-3722.527) [-3716.749] -- 0:03:58 174000 -- (-3728.874) [-3723.466] (-3726.499) (-3726.157) * (-3726.686) (-3724.930) (-3733.634) [-3719.708] -- 0:03:57 174500 -- [-3721.664] (-3724.169) (-3717.951) (-3725.825) * (-3722.053) (-3720.178) (-3724.214) [-3721.099] -- 0:03:56 175000 -- (-3721.851) [-3726.478] (-3722.978) (-3735.500) * (-3721.702) (-3723.482) [-3724.411] (-3718.501) -- 0:03:55 Average standard deviation of split frequencies: 0.000000 175500 -- (-3719.347) (-3726.575) [-3727.061] (-3734.250) * (-3725.227) (-3717.820) [-3719.293] (-3720.010) -- 0:03:54 176000 -- (-3723.625) (-3732.806) [-3724.295] (-3716.966) * (-3718.370) (-3723.368) (-3724.664) [-3729.144] -- 0:03:58 176500 -- [-3721.172] (-3720.264) (-3721.217) (-3720.165) * [-3726.473] (-3720.910) (-3723.760) (-3722.738) -- 0:03:57 177000 -- (-3720.280) [-3724.321] (-3724.845) (-3722.965) * (-3723.945) [-3717.346] (-3721.731) (-3725.105) -- 0:03:57 177500 -- [-3726.514] (-3728.725) (-3721.202) (-3720.307) * (-3725.555) (-3722.381) [-3726.228] (-3722.147) -- 0:03:56 178000 -- (-3719.233) (-3727.779) [-3722.560] (-3720.743) * (-3721.031) (-3717.930) (-3723.591) [-3722.061] -- 0:03:55 178500 -- (-3721.192) (-3725.783) (-3722.659) [-3727.186] * (-3721.656) [-3722.713] (-3733.144) (-3721.965) -- 0:03:54 179000 -- [-3723.093] (-3724.096) (-3722.033) (-3730.595) * (-3728.687) (-3723.825) (-3727.048) [-3721.895] -- 0:03:53 179500 -- (-3721.964) (-3719.268) (-3719.730) [-3724.376] * [-3723.297] (-3725.620) (-3726.757) (-3720.924) -- 0:03:53 180000 -- (-3728.179) (-3724.985) (-3725.428) [-3720.073] * (-3722.357) (-3722.575) (-3719.612) [-3722.523] -- 0:03:56 Average standard deviation of split frequencies: 0.000000 180500 -- (-3718.017) (-3720.746) (-3725.012) [-3721.632] * [-3718.916] (-3720.172) (-3732.875) (-3723.329) -- 0:03:56 181000 -- (-3731.601) [-3717.464] (-3721.644) (-3725.478) * (-3722.843) (-3717.956) [-3729.936] (-3720.570) -- 0:03:55 181500 -- [-3722.601] (-3720.011) (-3726.033) (-3722.050) * [-3725.094] (-3727.104) (-3724.359) (-3721.958) -- 0:03:54 182000 -- (-3721.840) [-3719.541] (-3724.901) (-3726.637) * (-3725.718) (-3726.624) [-3721.621] (-3725.100) -- 0:03:53 182500 -- (-3724.649) (-3719.971) [-3717.995] (-3720.154) * (-3722.450) [-3721.394] (-3727.156) (-3723.918) -- 0:03:52 183000 -- [-3723.110] (-3727.839) (-3723.190) (-3724.335) * (-3725.820) (-3725.311) (-3724.800) [-3728.364] -- 0:03:52 183500 -- (-3721.604) (-3722.861) (-3723.934) [-3723.132] * (-3722.090) (-3724.044) [-3720.679] (-3729.304) -- 0:03:55 184000 -- (-3725.466) [-3717.894] (-3720.740) (-3724.792) * (-3720.973) [-3719.691] (-3720.996) (-3727.502) -- 0:03:55 184500 -- (-3722.096) (-3717.983) [-3718.191] (-3722.954) * (-3718.831) (-3722.029) [-3720.697] (-3721.782) -- 0:03:54 185000 -- (-3728.315) (-3725.065) [-3723.599] (-3730.461) * [-3721.793] (-3720.505) (-3723.078) (-3723.699) -- 0:03:53 Average standard deviation of split frequencies: 0.000000 185500 -- (-3726.445) (-3721.274) [-3724.161] (-3722.025) * [-3718.705] (-3720.570) (-3724.985) (-3719.732) -- 0:03:52 186000 -- (-3726.247) (-3722.063) (-3724.321) [-3727.380] * (-3718.776) [-3720.216] (-3718.999) (-3721.807) -- 0:03:51 186500 -- (-3721.728) [-3718.326] (-3724.363) (-3720.054) * [-3725.342] (-3727.909) (-3722.980) (-3719.764) -- 0:03:51 187000 -- (-3723.568) (-3721.151) [-3721.740] (-3722.291) * [-3725.208] (-3721.107) (-3721.070) (-3720.442) -- 0:03:54 187500 -- (-3724.152) (-3720.113) (-3726.279) [-3720.664] * (-3732.575) (-3719.466) [-3724.244] (-3717.900) -- 0:03:54 188000 -- [-3718.517] (-3727.864) (-3724.338) (-3722.722) * [-3723.476] (-3721.500) (-3719.867) (-3724.029) -- 0:03:53 188500 -- (-3721.833) (-3720.385) [-3724.989] (-3723.372) * [-3721.750] (-3717.573) (-3723.832) (-3726.872) -- 0:03:52 189000 -- (-3719.167) (-3720.402) (-3728.484) [-3722.862] * (-3720.366) (-3719.914) [-3724.806] (-3724.664) -- 0:03:51 189500 -- (-3721.520) (-3728.340) (-3729.411) [-3720.632] * [-3721.036] (-3719.374) (-3727.981) (-3721.045) -- 0:03:50 190000 -- (-3721.724) (-3719.425) [-3721.650] (-3725.758) * (-3722.467) [-3723.601] (-3723.640) (-3721.592) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 190500 -- (-3722.512) [-3723.816] (-3718.767) (-3730.344) * (-3734.969) [-3717.295] (-3725.214) (-3721.832) -- 0:03:53 191000 -- (-3724.967) [-3718.971] (-3720.833) (-3727.880) * (-3721.896) [-3717.345] (-3723.738) (-3717.801) -- 0:03:52 191500 -- (-3725.773) (-3722.712) (-3718.159) [-3725.075] * (-3722.522) [-3721.656] (-3721.037) (-3727.264) -- 0:03:52 192000 -- (-3722.137) [-3723.687] (-3718.836) (-3731.685) * (-3724.260) (-3723.625) [-3719.592] (-3724.068) -- 0:03:51 192500 -- (-3727.458) [-3721.217] (-3725.920) (-3727.379) * (-3725.529) (-3724.944) [-3724.462] (-3725.036) -- 0:03:50 193000 -- [-3724.458] (-3721.363) (-3726.458) (-3720.443) * (-3725.109) (-3723.778) [-3727.651] (-3721.520) -- 0:03:49 193500 -- (-3722.584) (-3723.625) (-3731.783) [-3720.501] * (-3728.259) [-3724.927] (-3724.852) (-3728.679) -- 0:03:49 194000 -- [-3719.975] (-3721.189) (-3728.076) (-3723.533) * (-3727.771) (-3721.422) [-3722.848] (-3726.196) -- 0:03:52 194500 -- (-3720.662) (-3720.652) (-3728.896) [-3718.203] * (-3721.695) (-3728.794) [-3719.214] (-3723.493) -- 0:03:51 195000 -- (-3721.904) [-3724.487] (-3724.338) (-3722.255) * (-3722.941) [-3724.707] (-3722.186) (-3728.206) -- 0:03:51 Average standard deviation of split frequencies: 0.000000 195500 -- (-3722.345) (-3725.473) (-3733.588) [-3720.533] * (-3724.933) (-3723.659) (-3722.383) [-3718.457] -- 0:03:50 196000 -- (-3725.536) [-3731.056] (-3725.677) (-3728.787) * (-3717.451) [-3718.487] (-3720.533) (-3724.522) -- 0:03:49 196500 -- (-3718.372) (-3724.522) (-3719.809) [-3722.392] * (-3722.770) (-3720.668) [-3721.582] (-3724.247) -- 0:03:48 197000 -- (-3724.904) [-3719.680] (-3726.529) (-3723.817) * (-3722.120) (-3721.012) (-3719.958) [-3726.313] -- 0:03:48 197500 -- (-3726.077) [-3721.308] (-3724.795) (-3721.910) * (-3719.222) [-3723.182] (-3724.274) (-3726.518) -- 0:03:51 198000 -- (-3720.814) [-3718.185] (-3722.988) (-3724.747) * (-3721.165) (-3724.474) [-3722.082] (-3720.311) -- 0:03:50 198500 -- [-3719.588] (-3723.519) (-3721.001) (-3721.968) * [-3724.403] (-3721.356) (-3719.035) (-3725.320) -- 0:03:50 199000 -- (-3725.891) [-3718.521] (-3724.603) (-3722.677) * (-3726.999) (-3723.027) [-3720.990] (-3727.733) -- 0:03:49 199500 -- (-3723.566) (-3725.549) [-3720.923] (-3722.087) * (-3725.574) [-3721.817] (-3720.442) (-3724.516) -- 0:03:48 200000 -- (-3730.330) (-3724.325) (-3721.315) [-3723.312] * [-3726.940] (-3721.411) (-3724.084) (-3724.432) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 200500 -- (-3726.962) [-3720.340] (-3722.599) (-3722.491) * (-3727.001) [-3720.160] (-3717.891) (-3722.615) -- 0:03:47 201000 -- (-3724.725) [-3726.880] (-3718.155) (-3722.948) * (-3724.098) (-3729.445) (-3722.295) [-3717.844] -- 0:03:50 201500 -- [-3721.786] (-3728.249) (-3720.722) (-3736.244) * (-3724.339) (-3723.964) (-3727.976) [-3726.655] -- 0:03:49 202000 -- (-3720.317) (-3727.653) (-3722.741) [-3725.801] * [-3722.598] (-3719.918) (-3725.058) (-3731.461) -- 0:03:49 202500 -- (-3721.389) (-3720.338) (-3721.558) [-3726.076] * (-3719.616) (-3720.003) [-3719.259] (-3726.783) -- 0:03:48 203000 -- (-3721.846) [-3719.277] (-3724.544) (-3732.031) * (-3717.137) (-3720.806) (-3717.575) [-3722.173] -- 0:03:47 203500 -- (-3720.611) (-3723.294) [-3719.884] (-3726.514) * (-3724.346) [-3719.376] (-3725.798) (-3720.922) -- 0:03:47 204000 -- (-3723.354) (-3719.153) [-3721.084] (-3733.478) * (-3723.240) (-3720.954) [-3719.334] (-3719.323) -- 0:03:46 204500 -- (-3720.414) (-3720.154) (-3727.531) [-3722.885] * [-3719.504] (-3726.898) (-3722.366) (-3719.155) -- 0:03:49 205000 -- (-3722.744) [-3719.234] (-3725.196) (-3723.750) * (-3729.868) [-3722.380] (-3723.625) (-3721.374) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 205500 -- (-3725.378) (-3719.406) [-3723.470] (-3721.003) * (-3725.166) (-3725.502) (-3718.756) [-3719.228] -- 0:03:48 206000 -- (-3725.941) (-3728.199) (-3719.413) [-3723.093] * [-3717.868] (-3726.981) (-3724.981) (-3723.408) -- 0:03:47 206500 -- [-3724.249] (-3726.266) (-3719.982) (-3722.899) * (-3720.535) (-3723.791) (-3725.494) [-3720.235] -- 0:03:46 207000 -- [-3718.993] (-3722.274) (-3719.561) (-3729.460) * (-3725.952) (-3726.163) [-3723.773] (-3721.207) -- 0:03:46 207500 -- (-3724.965) (-3724.810) [-3722.230] (-3723.493) * (-3727.478) (-3725.111) (-3724.330) [-3720.660] -- 0:03:45 208000 -- (-3719.752) [-3723.611] (-3723.923) (-3724.300) * [-3723.992] (-3720.266) (-3723.376) (-3726.328) -- 0:03:44 208500 -- [-3718.476] (-3716.653) (-3729.564) (-3728.084) * (-3721.056) (-3716.257) (-3724.190) [-3720.780] -- 0:03:47 209000 -- (-3725.044) (-3719.940) [-3720.939] (-3719.062) * (-3723.147) (-3726.545) [-3722.971] (-3719.420) -- 0:03:47 209500 -- (-3722.086) [-3722.660] (-3721.607) (-3726.364) * [-3719.163] (-3722.123) (-3724.745) (-3722.470) -- 0:03:46 210000 -- (-3724.840) (-3724.854) (-3727.201) [-3722.444] * (-3720.683) [-3721.451] (-3728.328) (-3723.954) -- 0:03:45 Average standard deviation of split frequencies: 0.000000 210500 -- (-3720.466) [-3718.873] (-3724.250) (-3722.347) * (-3721.266) [-3724.095] (-3731.435) (-3722.125) -- 0:03:45 211000 -- [-3723.224] (-3723.730) (-3717.743) (-3721.074) * [-3725.557] (-3724.663) (-3729.534) (-3729.796) -- 0:03:44 211500 -- (-3728.170) (-3718.786) [-3724.266] (-3725.939) * [-3718.157] (-3722.676) (-3725.372) (-3725.999) -- 0:03:43 212000 -- [-3721.469] (-3718.670) (-3720.682) (-3729.759) * (-3724.960) (-3722.415) (-3724.973) [-3721.436] -- 0:03:46 212500 -- (-3721.177) (-3721.299) [-3721.100] (-3720.975) * [-3724.469] (-3726.153) (-3729.470) (-3719.704) -- 0:03:46 213000 -- (-3723.527) (-3723.655) (-3723.209) [-3721.673] * [-3719.133] (-3721.176) (-3734.503) (-3720.876) -- 0:03:45 213500 -- (-3720.114) (-3723.865) (-3725.910) [-3724.009] * [-3718.130] (-3727.801) (-3721.575) (-3721.512) -- 0:03:44 214000 -- (-3722.800) [-3722.137] (-3725.094) (-3723.457) * (-3724.014) [-3723.139] (-3724.788) (-3722.618) -- 0:03:44 214500 -- (-3719.658) (-3725.033) (-3727.565) [-3723.390] * (-3726.655) (-3722.765) (-3733.430) [-3720.146] -- 0:03:43 215000 -- (-3722.259) [-3724.441] (-3720.944) (-3726.996) * (-3728.383) (-3722.665) (-3723.547) [-3724.021] -- 0:03:42 Average standard deviation of split frequencies: 0.000000 215500 -- (-3731.767) (-3732.485) (-3726.093) [-3721.865] * (-3725.404) (-3726.219) [-3719.557] (-3721.438) -- 0:03:45 216000 -- (-3718.605) (-3721.154) [-3722.727] (-3724.724) * (-3724.009) (-3728.903) (-3722.341) [-3721.969] -- 0:03:45 216500 -- (-3720.699) [-3721.362] (-3722.951) (-3725.137) * (-3722.786) (-3726.418) [-3723.201] (-3722.994) -- 0:03:44 217000 -- [-3720.936] (-3721.242) (-3721.824) (-3729.344) * (-3727.065) [-3720.825] (-3722.023) (-3721.803) -- 0:03:43 217500 -- [-3716.742] (-3726.875) (-3719.624) (-3724.362) * [-3725.495] (-3729.145) (-3723.769) (-3719.582) -- 0:03:43 218000 -- (-3727.582) (-3725.537) [-3727.609] (-3723.165) * (-3737.926) [-3718.091] (-3723.562) (-3725.378) -- 0:03:42 218500 -- (-3725.661) (-3723.476) [-3721.542] (-3728.695) * (-3721.582) [-3720.096] (-3721.255) (-3721.281) -- 0:03:41 219000 -- [-3719.673] (-3720.912) (-3722.251) (-3729.730) * (-3726.655) [-3722.093] (-3732.850) (-3726.916) -- 0:03:44 219500 -- [-3724.356] (-3722.260) (-3721.167) (-3722.258) * [-3723.736] (-3726.792) (-3724.727) (-3724.073) -- 0:03:44 220000 -- (-3721.995) (-3725.289) [-3717.058] (-3720.728) * (-3727.993) (-3724.123) [-3724.661] (-3726.441) -- 0:03:43 Average standard deviation of split frequencies: 0.000000 220500 -- (-3720.288) (-3722.358) [-3717.345] (-3724.689) * (-3723.392) (-3721.349) (-3726.399) [-3718.452] -- 0:03:42 221000 -- [-3720.842] (-3726.413) (-3719.390) (-3721.049) * (-3722.745) [-3732.709] (-3726.558) (-3719.181) -- 0:03:42 221500 -- (-3718.691) [-3719.733] (-3717.720) (-3722.340) * [-3722.399] (-3726.848) (-3721.809) (-3720.448) -- 0:03:41 222000 -- [-3720.487] (-3720.988) (-3723.785) (-3722.973) * (-3722.588) (-3732.151) [-3719.005] (-3723.923) -- 0:03:40 222500 -- (-3725.041) [-3723.784] (-3722.090) (-3724.378) * (-3719.991) (-3721.854) [-3720.331] (-3721.392) -- 0:03:43 223000 -- (-3725.430) [-3719.206] (-3722.932) (-3715.824) * (-3720.297) (-3721.401) (-3719.150) [-3722.949] -- 0:03:42 223500 -- (-3717.542) (-3720.164) (-3720.500) [-3724.403] * [-3725.613] (-3724.529) (-3720.276) (-3726.492) -- 0:03:42 224000 -- (-3722.191) (-3721.568) (-3724.068) [-3721.782] * (-3728.052) (-3725.042) [-3720.935] (-3728.772) -- 0:03:41 224500 -- (-3723.333) (-3720.905) [-3720.463] (-3726.715) * (-3720.132) (-3720.832) [-3719.135] (-3723.084) -- 0:03:41 225000 -- (-3721.545) (-3723.334) (-3724.638) [-3719.686] * [-3720.015] (-3727.986) (-3719.503) (-3727.635) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 225500 -- (-3721.485) (-3722.042) (-3724.622) [-3720.245] * (-3723.945) (-3723.183) (-3730.303) [-3720.481] -- 0:03:39 226000 -- (-3718.216) [-3723.011] (-3719.453) (-3723.561) * (-3725.225) [-3724.162] (-3723.333) (-3721.937) -- 0:03:42 226500 -- [-3722.288] (-3727.670) (-3719.321) (-3723.299) * (-3722.746) [-3724.346] (-3724.855) (-3721.033) -- 0:03:41 227000 -- (-3727.461) [-3721.433] (-3724.112) (-3720.327) * [-3723.448] (-3725.195) (-3725.865) (-3724.540) -- 0:03:41 227500 -- (-3720.116) (-3721.160) [-3725.796] (-3717.211) * (-3724.454) [-3730.029] (-3720.974) (-3725.243) -- 0:03:40 228000 -- (-3717.946) (-3734.974) [-3722.598] (-3726.310) * (-3727.194) (-3721.110) (-3720.213) [-3725.078] -- 0:03:40 228500 -- [-3721.809] (-3721.932) (-3721.225) (-3727.789) * (-3720.025) (-3723.708) [-3723.638] (-3721.861) -- 0:03:39 229000 -- (-3730.545) (-3723.160) [-3719.804] (-3727.309) * (-3724.332) [-3719.997] (-3720.355) (-3720.338) -- 0:03:38 229500 -- (-3722.924) (-3725.123) [-3721.214] (-3723.616) * (-3725.569) [-3721.184] (-3722.534) (-3720.416) -- 0:03:41 230000 -- (-3723.630) [-3718.993] (-3721.961) (-3719.895) * (-3732.477) (-3725.321) (-3720.159) [-3720.736] -- 0:03:40 Average standard deviation of split frequencies: 0.000000 230500 -- [-3720.382] (-3720.493) (-3723.783) (-3723.692) * (-3727.637) [-3725.755] (-3721.673) (-3720.025) -- 0:03:40 231000 -- (-3721.219) [-3718.888] (-3727.295) (-3722.715) * [-3722.103] (-3720.941) (-3720.982) (-3721.918) -- 0:03:39 231500 -- (-3722.832) (-3727.490) [-3717.695] (-3728.222) * (-3723.532) [-3720.837] (-3723.774) (-3727.812) -- 0:03:39 232000 -- (-3722.573) (-3723.920) [-3718.105] (-3727.202) * (-3725.983) (-3718.287) (-3721.885) [-3720.811] -- 0:03:38 232500 -- (-3717.695) (-3722.617) [-3721.324] (-3722.137) * (-3727.604) (-3723.086) [-3723.730] (-3722.262) -- 0:03:37 233000 -- (-3720.430) (-3725.242) (-3720.799) [-3720.147] * (-3730.548) (-3725.902) (-3721.591) [-3721.946] -- 0:03:37 233500 -- (-3721.463) [-3717.848] (-3726.904) (-3719.918) * (-3724.069) (-3728.858) (-3733.385) [-3720.805] -- 0:03:39 234000 -- [-3719.166] (-3721.470) (-3726.678) (-3724.470) * [-3721.976] (-3724.198) (-3729.745) (-3720.663) -- 0:03:39 234500 -- (-3723.817) (-3727.301) [-3721.032] (-3721.057) * (-3721.363) (-3721.467) (-3731.059) [-3723.541] -- 0:03:38 235000 -- (-3723.548) (-3718.625) (-3720.408) [-3722.312] * [-3724.134] (-3720.645) (-3726.289) (-3723.539) -- 0:03:38 Average standard deviation of split frequencies: 0.000000 235500 -- (-3720.891) (-3720.668) (-3722.580) [-3722.970] * [-3725.232] (-3722.050) (-3718.867) (-3720.131) -- 0:03:37 236000 -- [-3718.016] (-3723.044) (-3723.223) (-3722.934) * [-3720.536] (-3721.485) (-3723.294) (-3722.163) -- 0:03:36 236500 -- [-3724.418] (-3726.242) (-3722.875) (-3722.000) * [-3721.081] (-3721.058) (-3723.143) (-3721.834) -- 0:03:36 237000 -- (-3723.833) (-3725.342) [-3723.874] (-3720.776) * (-3719.675) (-3719.983) (-3726.588) [-3720.398] -- 0:03:38 237500 -- (-3720.904) [-3724.169] (-3723.025) (-3719.042) * (-3724.155) [-3720.183] (-3730.511) (-3717.029) -- 0:03:38 238000 -- (-3734.424) (-3727.062) [-3718.231] (-3724.968) * (-3721.191) (-3718.242) (-3725.227) [-3720.290] -- 0:03:37 238500 -- (-3718.541) (-3725.961) [-3720.566] (-3724.145) * (-3724.381) (-3729.125) (-3730.726) [-3721.948] -- 0:03:37 239000 -- (-3718.843) [-3724.152] (-3725.347) (-3729.971) * (-3727.644) (-3722.746) (-3720.331) [-3722.937] -- 0:03:36 239500 -- [-3720.387] (-3723.613) (-3720.951) (-3727.189) * (-3725.795) (-3720.560) (-3721.455) [-3729.808] -- 0:03:35 240000 -- [-3717.364] (-3723.059) (-3721.150) (-3723.568) * (-3720.272) [-3722.337] (-3726.904) (-3724.178) -- 0:03:35 Average standard deviation of split frequencies: 0.000000 240500 -- (-3718.494) (-3719.628) (-3718.326) [-3721.313] * (-3726.234) (-3721.308) [-3720.789] (-3721.439) -- 0:03:37 241000 -- (-3718.493) (-3719.507) [-3720.293] (-3720.851) * (-3725.577) (-3720.688) [-3718.389] (-3722.740) -- 0:03:37 241500 -- (-3725.098) (-3720.033) [-3720.958] (-3722.874) * (-3724.042) [-3721.555] (-3718.514) (-3721.835) -- 0:03:36 242000 -- (-3723.578) (-3719.458) [-3722.573] (-3727.172) * (-3723.428) (-3724.861) [-3719.691] (-3722.495) -- 0:03:36 242500 -- (-3722.314) (-3717.809) (-3723.551) [-3718.124] * (-3725.220) (-3725.259) (-3719.418) [-3718.366] -- 0:03:35 243000 -- [-3723.529] (-3718.684) (-3726.290) (-3722.565) * (-3725.823) (-3722.534) (-3724.273) [-3721.719] -- 0:03:34 243500 -- (-3722.085) (-3717.270) [-3723.958] (-3727.764) * (-3725.130) (-3723.040) (-3723.136) [-3719.807] -- 0:03:34 244000 -- [-3724.473] (-3719.984) (-3725.272) (-3719.679) * (-3722.884) (-3720.127) [-3717.297] (-3724.018) -- 0:03:36 244500 -- (-3723.645) [-3722.822] (-3726.715) (-3722.453) * (-3723.956) (-3720.399) [-3718.809] (-3723.536) -- 0:03:36 245000 -- (-3721.311) (-3722.031) (-3728.447) [-3719.772] * (-3719.804) (-3725.617) (-3719.557) [-3722.114] -- 0:03:35 Average standard deviation of split frequencies: 0.000000 245500 -- (-3719.239) (-3721.262) [-3722.194] (-3720.635) * (-3724.769) (-3730.254) [-3723.455] (-3720.979) -- 0:03:35 246000 -- [-3720.612] (-3717.549) (-3721.009) (-3721.403) * [-3722.829] (-3727.578) (-3730.961) (-3719.794) -- 0:03:34 246500 -- (-3724.117) [-3723.550] (-3720.510) (-3726.136) * [-3719.912] (-3725.533) (-3720.397) (-3728.054) -- 0:03:33 247000 -- (-3727.972) [-3722.119] (-3729.686) (-3725.265) * (-3719.843) (-3721.919) (-3726.023) [-3719.164] -- 0:03:33 247500 -- (-3727.467) (-3724.956) [-3720.765] (-3725.194) * (-3723.942) (-3723.951) (-3717.206) [-3722.162] -- 0:03:35 248000 -- [-3721.876] (-3725.092) (-3722.912) (-3721.789) * (-3721.221) [-3722.345] (-3729.372) (-3725.787) -- 0:03:35 248500 -- (-3729.253) (-3720.426) (-3721.341) [-3725.056] * (-3720.136) [-3720.948] (-3725.422) (-3724.350) -- 0:03:34 249000 -- (-3726.162) (-3720.378) [-3719.570] (-3726.937) * [-3717.878] (-3726.012) (-3721.013) (-3720.885) -- 0:03:34 249500 -- (-3724.378) (-3721.359) [-3721.498] (-3719.838) * (-3720.770) (-3723.691) [-3718.870] (-3725.985) -- 0:03:33 250000 -- (-3723.169) [-3725.768] (-3721.529) (-3720.475) * [-3716.905] (-3732.784) (-3721.635) (-3724.612) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 250500 -- (-3723.786) (-3728.148) (-3722.382) [-3719.483] * (-3722.518) (-3729.461) (-3721.860) [-3718.961] -- 0:03:32 251000 -- (-3722.414) [-3726.970] (-3722.984) (-3720.308) * (-3718.508) (-3728.801) (-3722.447) [-3719.050] -- 0:03:34 251500 -- (-3723.499) (-3725.974) (-3725.566) [-3721.211] * (-3722.263) (-3724.756) (-3724.173) [-3721.578] -- 0:03:34 252000 -- (-3719.430) (-3719.137) (-3730.749) [-3718.137] * (-3723.750) (-3726.498) (-3721.880) [-3718.734] -- 0:03:33 252500 -- (-3724.352) [-3722.289] (-3725.267) (-3718.979) * (-3725.871) [-3722.033] (-3722.766) (-3719.519) -- 0:03:33 253000 -- (-3722.366) [-3721.820] (-3725.005) (-3724.907) * (-3729.661) (-3724.536) (-3724.190) [-3728.434] -- 0:03:32 253500 -- [-3726.100] (-3722.399) (-3722.360) (-3726.441) * (-3721.245) (-3727.986) (-3725.560) [-3726.367] -- 0:03:32 254000 -- [-3717.620] (-3724.921) (-3721.993) (-3728.321) * (-3721.710) (-3726.415) [-3723.404] (-3725.856) -- 0:03:31 254500 -- [-3722.535] (-3729.600) (-3726.741) (-3728.893) * (-3722.177) (-3722.278) [-3721.943] (-3726.885) -- 0:03:30 255000 -- (-3729.338) [-3723.851] (-3727.057) (-3724.312) * (-3727.926) (-3720.780) [-3723.527] (-3722.992) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 255500 -- (-3721.738) (-3724.404) (-3728.610) [-3727.911] * [-3721.445] (-3724.201) (-3719.371) (-3718.268) -- 0:03:32 256000 -- (-3729.692) (-3727.236) [-3719.807] (-3730.300) * (-3723.737) (-3724.483) (-3718.791) [-3719.986] -- 0:03:32 256500 -- [-3721.356] (-3723.217) (-3720.984) (-3728.867) * (-3722.450) [-3722.513] (-3727.015) (-3723.823) -- 0:03:31 257000 -- [-3722.451] (-3719.437) (-3722.906) (-3727.495) * [-3719.269] (-3728.514) (-3726.384) (-3719.197) -- 0:03:31 257500 -- (-3723.193) (-3718.635) [-3723.048] (-3726.310) * (-3729.778) (-3722.180) (-3722.469) [-3722.999] -- 0:03:30 258000 -- (-3727.721) (-3725.078) [-3724.364] (-3725.159) * [-3724.195] (-3724.979) (-3725.090) (-3717.486) -- 0:03:29 258500 -- [-3725.200] (-3719.892) (-3727.133) (-3721.786) * (-3722.291) [-3719.877] (-3723.128) (-3724.643) -- 0:03:32 259000 -- (-3724.858) [-3720.853] (-3726.899) (-3728.899) * (-3721.309) (-3719.538) (-3728.750) [-3718.028] -- 0:03:31 259500 -- (-3724.102) (-3721.309) (-3719.651) [-3721.443] * [-3718.016] (-3718.669) (-3730.795) (-3717.444) -- 0:03:31 260000 -- (-3726.891) [-3727.267] (-3721.332) (-3725.532) * [-3721.284] (-3723.955) (-3725.676) (-3720.249) -- 0:03:30 Average standard deviation of split frequencies: 0.000000 260500 -- (-3723.107) (-3730.703) [-3724.275] (-3720.267) * (-3722.176) (-3725.278) [-3724.406] (-3721.849) -- 0:03:30 261000 -- (-3726.590) (-3720.799) [-3718.555] (-3727.031) * (-3719.688) [-3722.449] (-3720.787) (-3724.366) -- 0:03:29 261500 -- [-3720.091] (-3725.087) (-3721.216) (-3725.477) * (-3726.350) (-3721.812) (-3729.614) [-3720.653] -- 0:03:28 262000 -- (-3726.114) [-3730.160] (-3720.446) (-3723.251) * (-3727.028) (-3719.848) [-3721.856] (-3721.774) -- 0:03:31 262500 -- [-3719.916] (-3729.676) (-3722.806) (-3729.294) * [-3725.427] (-3722.955) (-3728.155) (-3727.159) -- 0:03:30 263000 -- (-3721.652) (-3733.526) (-3719.632) [-3718.820] * (-3724.782) (-3721.879) (-3724.425) [-3721.092] -- 0:03:30 263500 -- (-3723.561) (-3723.734) [-3719.131] (-3722.356) * (-3722.113) (-3718.598) [-3718.179] (-3724.557) -- 0:03:29 264000 -- (-3727.793) (-3726.813) (-3722.027) [-3720.539] * (-3723.846) (-3725.219) [-3720.918] (-3722.498) -- 0:03:29 264500 -- (-3725.675) [-3720.156] (-3727.294) (-3722.471) * [-3724.829] (-3720.967) (-3721.912) (-3723.438) -- 0:03:28 265000 -- [-3725.183] (-3724.124) (-3724.182) (-3719.799) * (-3724.610) [-3724.516] (-3717.684) (-3723.993) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 265500 -- (-3725.198) [-3721.387] (-3720.846) (-3735.066) * (-3725.456) (-3724.962) [-3719.129] (-3729.597) -- 0:03:30 266000 -- (-3725.094) (-3721.275) [-3724.142] (-3727.708) * (-3719.995) [-3725.299] (-3718.850) (-3725.351) -- 0:03:29 266500 -- (-3719.768) [-3720.724] (-3724.408) (-3729.252) * (-3722.735) (-3724.810) (-3722.809) [-3725.595] -- 0:03:29 267000 -- (-3721.024) (-3721.829) [-3722.246] (-3729.233) * [-3720.251] (-3727.985) (-3728.113) (-3720.609) -- 0:03:28 267500 -- (-3724.807) [-3716.759] (-3728.837) (-3718.496) * (-3722.820) (-3727.668) [-3719.910] (-3720.957) -- 0:03:28 268000 -- (-3726.858) [-3719.472] (-3724.428) (-3725.520) * (-3730.965) [-3725.246] (-3720.777) (-3722.774) -- 0:03:27 268500 -- (-3729.239) (-3727.432) [-3723.485] (-3721.009) * (-3727.335) [-3722.314] (-3732.354) (-3717.756) -- 0:03:27 269000 -- (-3724.611) (-3723.206) (-3719.668) [-3724.865] * (-3723.084) [-3724.409] (-3719.656) (-3719.399) -- 0:03:29 269500 -- [-3724.742] (-3721.459) (-3721.761) (-3724.405) * (-3724.508) [-3721.346] (-3723.008) (-3718.121) -- 0:03:28 270000 -- [-3723.146] (-3724.464) (-3728.486) (-3720.585) * (-3725.744) (-3723.545) (-3720.611) [-3718.798] -- 0:03:28 Average standard deviation of split frequencies: 0.000000 270500 -- [-3718.521] (-3723.214) (-3723.509) (-3723.663) * [-3719.169] (-3724.798) (-3728.435) (-3731.914) -- 0:03:27 271000 -- (-3723.655) [-3724.401] (-3718.942) (-3728.890) * (-3718.541) (-3724.436) [-3721.344] (-3725.017) -- 0:03:27 271500 -- (-3721.602) (-3728.577) (-3719.459) [-3727.999] * (-3716.939) (-3725.018) [-3719.246] (-3725.048) -- 0:03:26 272000 -- (-3722.693) (-3727.387) [-3723.607] (-3722.727) * (-3716.487) (-3722.877) (-3726.595) [-3723.988] -- 0:03:26 272500 -- (-3724.100) (-3728.062) [-3729.398] (-3720.927) * (-3726.939) (-3729.759) (-3722.528) [-3721.890] -- 0:03:28 273000 -- [-3722.298] (-3727.086) (-3720.185) (-3719.946) * (-3726.817) (-3722.054) [-3723.677] (-3721.179) -- 0:03:27 273500 -- (-3727.704) (-3721.589) [-3719.971] (-3721.061) * (-3727.703) [-3727.359] (-3728.898) (-3721.513) -- 0:03:27 274000 -- [-3719.779] (-3719.816) (-3717.195) (-3724.628) * (-3719.956) (-3724.291) [-3721.258] (-3723.197) -- 0:03:26 274500 -- (-3726.627) (-3716.194) [-3723.844] (-3722.988) * (-3721.001) [-3719.539] (-3723.961) (-3733.355) -- 0:03:26 275000 -- (-3731.563) [-3720.311] (-3730.160) (-3732.075) * [-3720.185] (-3723.021) (-3721.349) (-3720.150) -- 0:03:25 Average standard deviation of split frequencies: 0.000000 275500 -- (-3728.468) [-3719.534] (-3719.994) (-3721.489) * (-3722.481) (-3728.019) (-3728.282) [-3720.446] -- 0:03:25 276000 -- (-3729.249) (-3719.482) [-3727.229] (-3722.003) * (-3723.878) (-3721.192) (-3725.742) [-3719.500] -- 0:03:27 276500 -- (-3731.386) (-3720.702) [-3721.686] (-3720.407) * (-3721.529) (-3720.947) (-3726.085) [-3718.914] -- 0:03:26 277000 -- (-3725.530) [-3722.889] (-3721.859) (-3721.932) * (-3722.054) (-3727.668) [-3723.877] (-3725.670) -- 0:03:26 277500 -- (-3721.792) [-3722.424] (-3725.749) (-3718.907) * [-3722.547] (-3723.151) (-3725.751) (-3730.483) -- 0:03:25 278000 -- (-3722.820) (-3725.933) (-3721.296) [-3720.340] * (-3727.790) (-3721.455) [-3721.087] (-3723.610) -- 0:03:25 278500 -- [-3723.322] (-3725.306) (-3724.963) (-3724.870) * (-3721.886) [-3725.881] (-3723.123) (-3727.950) -- 0:03:24 279000 -- (-3725.300) (-3723.841) [-3717.821] (-3725.816) * (-3726.711) (-3719.100) [-3723.163] (-3721.120) -- 0:03:24 279500 -- (-3720.266) (-3720.610) [-3719.579] (-3720.601) * (-3723.417) [-3718.596] (-3725.452) (-3720.300) -- 0:03:26 280000 -- [-3723.172] (-3717.132) (-3720.374) (-3718.591) * [-3719.174] (-3722.822) (-3721.205) (-3724.592) -- 0:03:25 Average standard deviation of split frequencies: 0.000000 280500 -- (-3717.592) (-3717.985) (-3722.754) [-3719.754] * (-3721.333) (-3721.940) [-3723.396] (-3729.995) -- 0:03:25 281000 -- [-3723.138] (-3723.228) (-3718.656) (-3720.399) * (-3721.050) (-3717.587) [-3725.097] (-3720.740) -- 0:03:24 281500 -- (-3723.013) (-3720.771) (-3722.074) [-3720.705] * (-3724.045) [-3720.669] (-3717.217) (-3726.992) -- 0:03:24 282000 -- (-3721.897) (-3725.401) [-3721.062] (-3727.945) * (-3726.147) [-3721.568] (-3725.717) (-3720.649) -- 0:03:23 282500 -- (-3722.580) [-3721.335] (-3723.505) (-3722.613) * [-3718.754] (-3726.357) (-3720.303) (-3717.363) -- 0:03:23 283000 -- [-3723.490] (-3729.673) (-3721.090) (-3723.320) * [-3725.379] (-3725.490) (-3722.340) (-3720.049) -- 0:03:22 283500 -- (-3724.335) [-3724.480] (-3721.249) (-3722.392) * [-3723.362] (-3720.504) (-3722.462) (-3722.583) -- 0:03:24 284000 -- (-3717.777) (-3723.651) [-3725.570] (-3723.177) * (-3722.354) [-3723.081] (-3727.318) (-3734.966) -- 0:03:24 284500 -- [-3720.788] (-3726.444) (-3725.478) (-3723.954) * [-3720.198] (-3725.170) (-3723.599) (-3721.914) -- 0:03:23 285000 -- (-3725.638) [-3717.220] (-3724.725) (-3730.842) * (-3722.155) (-3733.405) [-3725.729] (-3722.290) -- 0:03:23 Average standard deviation of split frequencies: 0.000000 285500 -- (-3717.429) (-3720.355) [-3722.249] (-3721.997) * [-3720.019] (-3724.806) (-3725.908) (-3726.347) -- 0:03:22 286000 -- (-3719.218) [-3720.711] (-3723.999) (-3722.410) * [-3722.440] (-3724.130) (-3720.018) (-3725.320) -- 0:03:22 286500 -- (-3721.834) (-3729.377) (-3721.915) [-3717.972] * (-3722.253) (-3720.174) (-3718.383) [-3721.269] -- 0:03:21 287000 -- [-3720.759] (-3722.558) (-3726.069) (-3725.550) * [-3721.010] (-3723.141) (-3724.953) (-3720.391) -- 0:03:23 287500 -- [-3721.314] (-3720.426) (-3722.170) (-3736.376) * (-3719.556) [-3720.539] (-3722.239) (-3719.414) -- 0:03:23 288000 -- [-3721.660] (-3726.164) (-3721.704) (-3723.726) * (-3716.159) (-3720.779) (-3725.440) [-3720.389] -- 0:03:22 288500 -- (-3726.705) (-3727.834) (-3728.744) [-3720.147] * (-3722.921) (-3721.381) (-3722.490) [-3723.632] -- 0:03:22 289000 -- (-3723.620) [-3722.254] (-3721.697) (-3723.717) * (-3720.318) (-3719.568) (-3724.849) [-3727.934] -- 0:03:21 289500 -- (-3720.988) [-3717.694] (-3724.081) (-3728.224) * [-3724.504] (-3720.237) (-3728.506) (-3727.640) -- 0:03:21 290000 -- (-3724.971) [-3718.778] (-3731.007) (-3730.044) * [-3720.011] (-3721.684) (-3727.874) (-3721.422) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 290500 -- [-3719.234] (-3720.208) (-3723.077) (-3727.016) * (-3718.582) (-3731.593) [-3723.134] (-3721.884) -- 0:03:22 291000 -- (-3725.615) (-3722.226) [-3721.140] (-3723.325) * (-3719.657) (-3724.338) [-3718.826] (-3722.869) -- 0:03:22 291500 -- (-3720.879) (-3719.780) [-3721.282] (-3719.463) * (-3721.844) [-3727.076] (-3722.228) (-3723.383) -- 0:03:21 292000 -- (-3724.211) [-3721.277] (-3719.898) (-3720.811) * (-3720.132) (-3724.841) [-3723.506] (-3727.719) -- 0:03:21 292500 -- (-3721.730) [-3723.477] (-3726.070) (-3725.623) * (-3722.424) [-3721.053] (-3724.358) (-3725.131) -- 0:03:20 293000 -- (-3720.591) [-3721.503] (-3723.751) (-3729.173) * (-3720.927) (-3731.357) [-3721.939] (-3721.735) -- 0:03:20 293500 -- (-3721.705) [-3718.317] (-3721.290) (-3724.512) * (-3727.697) (-3721.848) (-3719.177) [-3723.428] -- 0:03:19 294000 -- [-3722.577] (-3719.877) (-3724.275) (-3720.514) * [-3725.350] (-3722.181) (-3731.290) (-3722.862) -- 0:03:21 294500 -- (-3722.105) (-3717.402) (-3718.342) [-3726.843] * [-3724.856] (-3724.711) (-3721.406) (-3721.865) -- 0:03:21 295000 -- [-3723.148] (-3721.068) (-3723.433) (-3716.447) * (-3725.808) (-3724.307) (-3721.572) [-3718.812] -- 0:03:20 Average standard deviation of split frequencies: 0.000000 295500 -- [-3718.821] (-3724.391) (-3722.371) (-3720.961) * (-3723.872) [-3722.976] (-3722.061) (-3726.722) -- 0:03:20 296000 -- (-3720.699) (-3728.854) [-3720.201] (-3724.319) * (-3728.789) (-3728.373) (-3720.260) [-3721.772] -- 0:03:19 296500 -- (-3722.695) (-3722.126) (-3722.565) [-3727.107] * (-3728.286) [-3721.502] (-3721.238) (-3723.679) -- 0:03:19 297000 -- (-3731.313) (-3719.968) (-3728.289) [-3724.710] * (-3722.303) (-3719.660) [-3723.705] (-3723.924) -- 0:03:18 297500 -- (-3723.893) [-3723.734] (-3722.035) (-3722.328) * (-3725.408) (-3726.470) (-3727.356) [-3720.699] -- 0:03:20 298000 -- (-3720.808) [-3722.809] (-3728.260) (-3721.620) * [-3727.769] (-3723.858) (-3724.805) (-3722.537) -- 0:03:20 298500 -- (-3722.673) [-3719.200] (-3724.161) (-3721.894) * (-3730.399) [-3726.429] (-3719.004) (-3719.366) -- 0:03:19 299000 -- (-3720.750) (-3722.617) (-3722.389) [-3722.488] * [-3721.434] (-3723.876) (-3720.643) (-3726.113) -- 0:03:19 299500 -- [-3727.951] (-3718.956) (-3728.396) (-3722.081) * (-3718.443) (-3720.011) (-3721.403) [-3723.529] -- 0:03:18 300000 -- (-3727.926) [-3723.826] (-3727.166) (-3727.091) * (-3724.156) [-3719.393] (-3722.251) (-3727.716) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 300500 -- [-3721.945] (-3732.626) (-3722.015) (-3722.189) * [-3726.140] (-3721.827) (-3727.844) (-3719.433) -- 0:03:17 301000 -- (-3717.307) (-3726.355) [-3723.255] (-3720.292) * (-3720.398) (-3724.964) [-3723.966] (-3726.945) -- 0:03:19 301500 -- (-3718.866) [-3724.498] (-3724.466) (-3725.970) * (-3722.600) (-3719.626) [-3724.833] (-3729.741) -- 0:03:19 302000 -- (-3718.377) (-3735.327) (-3728.638) [-3724.830] * (-3727.716) (-3721.221) (-3727.722) [-3721.716] -- 0:03:18 302500 -- (-3731.162) (-3720.540) (-3724.811) [-3719.788] * [-3721.255] (-3721.828) (-3724.599) (-3722.277) -- 0:03:18 303000 -- [-3720.260] (-3718.406) (-3722.617) (-3726.427) * (-3721.851) (-3725.652) (-3724.722) [-3722.793] -- 0:03:17 303500 -- (-3721.067) [-3720.717] (-3724.723) (-3722.918) * [-3719.364] (-3725.048) (-3723.512) (-3717.840) -- 0:03:17 304000 -- (-3725.145) (-3721.145) (-3721.116) [-3723.151] * (-3718.659) [-3717.458] (-3721.925) (-3724.436) -- 0:03:16 304500 -- (-3719.625) (-3723.159) [-3720.431] (-3724.567) * (-3721.287) (-3722.404) [-3722.515] (-3728.785) -- 0:03:18 305000 -- [-3726.744] (-3728.204) (-3719.772) (-3721.245) * (-3721.682) [-3723.016] (-3725.324) (-3726.861) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 305500 -- (-3727.778) (-3723.317) [-3719.952] (-3721.096) * (-3721.280) [-3724.869] (-3726.902) (-3722.313) -- 0:03:17 306000 -- (-3721.182) (-3722.340) [-3721.895] (-3718.933) * [-3724.046] (-3726.007) (-3725.326) (-3723.436) -- 0:03:17 306500 -- (-3719.387) (-3721.890) (-3720.653) [-3720.556] * (-3719.715) (-3720.325) (-3720.096) [-3722.120] -- 0:03:16 307000 -- (-3717.178) [-3720.299] (-3730.750) (-3722.827) * [-3721.596] (-3722.884) (-3721.976) (-3718.120) -- 0:03:16 307500 -- (-3718.111) [-3721.227] (-3733.779) (-3721.528) * [-3720.232] (-3736.743) (-3725.407) (-3720.840) -- 0:03:15 308000 -- [-3718.623] (-3728.148) (-3743.827) (-3720.776) * (-3723.120) [-3721.953] (-3721.687) (-3724.205) -- 0:03:17 308500 -- [-3719.188] (-3726.650) (-3732.722) (-3724.590) * (-3720.992) [-3725.893] (-3721.913) (-3719.609) -- 0:03:17 309000 -- (-3721.948) [-3720.083] (-3724.872) (-3726.501) * (-3731.343) (-3728.108) [-3725.475] (-3719.558) -- 0:03:16 309500 -- (-3721.541) (-3722.725) (-3723.723) [-3720.496] * (-3724.618) (-3731.889) (-3723.435) [-3722.039] -- 0:03:16 310000 -- (-3721.706) (-3724.723) [-3723.177] (-3719.162) * [-3721.424] (-3726.102) (-3723.959) (-3721.372) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 310500 -- (-3723.482) [-3722.524] (-3723.794) (-3723.168) * (-3717.674) [-3726.702] (-3723.905) (-3718.555) -- 0:03:15 311000 -- [-3720.427] (-3723.807) (-3730.037) (-3720.690) * (-3722.791) (-3724.256) (-3723.282) [-3720.724] -- 0:03:14 311500 -- (-3719.061) [-3724.741] (-3724.864) (-3725.658) * (-3723.303) (-3718.632) [-3718.776] (-3719.859) -- 0:03:14 312000 -- [-3725.184] (-3726.406) (-3727.678) (-3720.612) * (-3723.283) (-3727.406) (-3723.737) [-3725.491] -- 0:03:16 312500 -- (-3723.889) (-3724.800) [-3720.833] (-3733.220) * (-3720.660) (-3732.170) [-3719.508] (-3720.396) -- 0:03:15 313000 -- (-3723.466) (-3723.613) [-3722.027] (-3725.169) * [-3721.624] (-3722.090) (-3722.396) (-3729.239) -- 0:03:15 313500 -- [-3726.427] (-3720.953) (-3718.225) (-3724.790) * (-3727.470) (-3729.720) (-3727.224) [-3726.668] -- 0:03:14 314000 -- (-3730.176) (-3728.637) (-3719.254) [-3723.899] * (-3723.702) [-3722.780] (-3723.239) (-3719.316) -- 0:03:14 314500 -- (-3725.637) (-3720.001) (-3720.439) [-3722.641] * (-3723.768) (-3721.582) [-3725.824] (-3723.077) -- 0:03:13 315000 -- (-3727.173) [-3719.072] (-3733.052) (-3724.346) * (-3719.605) (-3722.436) [-3722.510] (-3728.239) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 315500 -- (-3721.221) [-3721.623] (-3723.651) (-3728.171) * (-3720.150) (-3723.458) (-3720.036) [-3719.787] -- 0:03:15 316000 -- (-3717.667) (-3720.824) [-3721.724] (-3729.713) * (-3720.532) (-3717.303) [-3734.084] (-3718.599) -- 0:03:14 316500 -- (-3721.281) (-3726.945) [-3723.926] (-3730.579) * [-3721.092] (-3721.929) (-3730.317) (-3719.899) -- 0:03:14 317000 -- (-3724.358) [-3725.842] (-3719.788) (-3731.116) * [-3722.253] (-3732.790) (-3735.407) (-3733.840) -- 0:03:13 317500 -- [-3717.307] (-3718.421) (-3720.675) (-3727.983) * (-3722.473) [-3723.058] (-3731.538) (-3727.265) -- 0:03:13 318000 -- (-3723.152) (-3730.192) [-3722.356] (-3722.509) * (-3719.667) (-3723.022) (-3720.336) [-3726.766] -- 0:03:13 318500 -- (-3725.126) (-3734.629) (-3725.548) [-3718.453] * [-3719.314] (-3721.171) (-3726.029) (-3725.967) -- 0:03:12 319000 -- (-3725.595) (-3729.312) (-3726.030) [-3719.033] * (-3726.059) [-3719.785] (-3729.678) (-3722.561) -- 0:03:14 319500 -- (-3724.243) (-3723.231) (-3730.357) [-3724.377] * (-3720.657) (-3725.117) [-3719.198] (-3729.510) -- 0:03:13 320000 -- [-3732.367] (-3723.371) (-3718.832) (-3725.124) * [-3720.021] (-3723.968) (-3727.913) (-3726.183) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 320500 -- (-3719.092) [-3725.740] (-3726.166) (-3731.212) * (-3721.294) (-3720.218) (-3725.608) [-3722.576] -- 0:03:12 321000 -- (-3720.866) [-3717.613] (-3723.488) (-3717.528) * (-3727.627) [-3722.236] (-3719.117) (-3720.944) -- 0:03:12 321500 -- (-3724.015) (-3719.181) [-3724.109] (-3719.645) * (-3719.000) (-3724.351) [-3723.695] (-3721.764) -- 0:03:12 322000 -- (-3725.451) (-3721.606) (-3727.831) [-3720.393] * (-3722.194) (-3718.826) (-3719.373) [-3718.004] -- 0:03:11 322500 -- [-3720.297] (-3721.445) (-3726.079) (-3720.796) * (-3721.504) (-3722.675) [-3726.031] (-3726.510) -- 0:03:13 323000 -- (-3727.316) (-3724.672) [-3724.624] (-3721.066) * (-3727.391) [-3727.272] (-3724.267) (-3722.922) -- 0:03:12 323500 -- (-3732.765) [-3720.549] (-3725.984) (-3724.962) * (-3719.763) (-3725.686) (-3723.765) [-3720.327] -- 0:03:12 324000 -- (-3733.801) (-3722.640) (-3718.766) [-3722.202] * (-3729.361) [-3724.417] (-3720.935) (-3719.472) -- 0:03:11 324500 -- [-3728.393] (-3720.245) (-3724.175) (-3721.020) * (-3723.017) (-3723.479) [-3721.997] (-3718.333) -- 0:03:11 325000 -- (-3724.325) [-3726.863] (-3730.414) (-3723.477) * (-3727.251) (-3727.608) (-3721.704) [-3719.335] -- 0:03:11 Average standard deviation of split frequencies: 0.000000 325500 -- (-3718.467) [-3729.082] (-3721.017) (-3718.939) * (-3725.979) (-3721.511) (-3723.023) [-3719.520] -- 0:03:10 326000 -- [-3724.918] (-3719.905) (-3725.569) (-3718.263) * (-3721.907) (-3725.643) (-3718.036) [-3719.882] -- 0:03:12 326500 -- [-3722.475] (-3724.369) (-3719.900) (-3719.375) * [-3720.555] (-3719.881) (-3718.749) (-3726.172) -- 0:03:11 327000 -- (-3723.827) (-3727.361) (-3724.144) [-3728.715] * (-3726.686) (-3723.982) (-3723.502) [-3723.041] -- 0:03:11 327500 -- (-3721.586) (-3723.851) [-3723.814] (-3723.667) * (-3723.819) (-3720.484) [-3726.475] (-3726.001) -- 0:03:10 328000 -- (-3724.074) (-3725.609) [-3720.699] (-3729.294) * (-3723.719) [-3720.279] (-3721.488) (-3724.898) -- 0:03:10 328500 -- (-3723.170) [-3724.716] (-3725.961) (-3720.256) * (-3724.344) (-3721.426) [-3722.013] (-3723.460) -- 0:03:10 329000 -- [-3718.408] (-3731.766) (-3725.448) (-3725.691) * (-3721.560) (-3723.296) [-3720.054] (-3721.199) -- 0:03:09 329500 -- (-3726.992) (-3733.059) [-3719.154] (-3726.473) * [-3721.451] (-3723.105) (-3724.529) (-3721.683) -- 0:03:11 330000 -- (-3722.677) (-3729.330) (-3725.250) [-3722.410] * (-3723.232) [-3723.280] (-3721.752) (-3720.602) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 330500 -- (-3722.432) [-3722.075] (-3724.183) (-3729.819) * [-3721.422] (-3720.161) (-3725.407) (-3720.547) -- 0:03:10 331000 -- [-3722.395] (-3725.598) (-3729.143) (-3719.609) * (-3730.987) (-3723.692) (-3727.226) [-3722.943] -- 0:03:09 331500 -- (-3723.159) (-3726.256) [-3720.933] (-3720.681) * (-3719.963) (-3720.987) (-3723.420) [-3720.167] -- 0:03:09 332000 -- (-3723.921) [-3727.712] (-3721.060) (-3724.326) * (-3723.240) [-3722.106] (-3726.536) (-3727.733) -- 0:03:09 332500 -- (-3721.911) (-3728.050) [-3721.964] (-3723.484) * (-3726.202) [-3718.994] (-3719.254) (-3719.604) -- 0:03:08 333000 -- (-3718.921) (-3727.854) (-3716.461) [-3724.512] * (-3720.114) (-3723.179) [-3722.072] (-3717.562) -- 0:03:10 333500 -- (-3720.800) (-3721.625) (-3722.868) [-3717.940] * (-3723.465) [-3718.231] (-3718.108) (-3726.212) -- 0:03:09 334000 -- (-3721.941) (-3723.136) [-3716.978] (-3724.674) * (-3723.641) [-3721.347] (-3719.175) (-3726.092) -- 0:03:09 334500 -- (-3723.077) (-3721.309) [-3719.904] (-3722.418) * (-3723.338) (-3721.365) [-3717.453] (-3725.027) -- 0:03:09 335000 -- (-3719.077) (-3722.563) (-3722.120) [-3719.613] * [-3721.914] (-3721.680) (-3717.712) (-3720.983) -- 0:03:08 Average standard deviation of split frequencies: 0.000000 335500 -- (-3724.688) [-3721.152] (-3721.434) (-3726.756) * (-3720.458) (-3722.750) (-3721.109) [-3723.805] -- 0:03:08 336000 -- (-3727.777) [-3720.060] (-3723.668) (-3729.590) * (-3720.462) (-3728.824) [-3724.724] (-3720.396) -- 0:03:07 336500 -- (-3727.962) (-3721.613) (-3721.461) [-3724.897] * (-3720.276) (-3721.450) (-3726.334) [-3722.659] -- 0:03:07 337000 -- (-3721.447) [-3722.332] (-3717.833) (-3723.424) * (-3719.603) [-3726.506] (-3724.826) (-3719.885) -- 0:03:08 337500 -- (-3723.054) [-3721.257] (-3724.871) (-3725.997) * (-3725.196) (-3724.783) [-3724.475] (-3723.320) -- 0:03:08 338000 -- (-3723.660) [-3721.365] (-3721.406) (-3724.305) * (-3720.061) [-3726.576] (-3723.329) (-3723.234) -- 0:03:08 338500 -- (-3721.277) [-3722.736] (-3723.000) (-3720.814) * (-3722.013) [-3726.179] (-3723.818) (-3725.055) -- 0:03:07 339000 -- [-3722.569] (-3723.842) (-3725.542) (-3724.064) * (-3719.299) (-3726.793) [-3720.769] (-3724.552) -- 0:03:07 339500 -- (-3719.869) (-3721.559) [-3720.414] (-3724.402) * (-3719.619) (-3719.312) [-3724.800] (-3723.362) -- 0:03:06 340000 -- (-3720.163) [-3723.539] (-3720.148) (-3725.884) * (-3722.131) [-3720.226] (-3725.284) (-3723.991) -- 0:03:06 Average standard deviation of split frequencies: 0.000000 340500 -- (-3726.339) (-3724.160) (-3723.294) [-3719.460] * [-3721.179] (-3722.365) (-3720.715) (-3727.081) -- 0:03:07 341000 -- (-3726.844) (-3721.598) [-3722.628] (-3722.847) * [-3720.244] (-3728.225) (-3724.538) (-3719.114) -- 0:03:07 341500 -- (-3725.129) (-3724.363) (-3722.749) [-3718.970] * [-3723.441] (-3720.022) (-3727.315) (-3721.833) -- 0:03:07 342000 -- [-3721.497] (-3728.126) (-3724.756) (-3726.739) * (-3725.365) [-3721.161] (-3723.406) (-3723.813) -- 0:03:06 342500 -- (-3720.453) (-3725.218) (-3724.208) [-3723.869] * (-3723.290) (-3723.840) (-3718.004) [-3726.011] -- 0:03:06 343000 -- (-3720.970) (-3724.553) (-3721.614) [-3723.153] * (-3725.283) [-3721.964] (-3721.733) (-3723.733) -- 0:03:05 343500 -- (-3722.458) (-3724.276) (-3729.001) [-3722.332] * [-3722.420] (-3727.573) (-3725.462) (-3731.062) -- 0:03:05 344000 -- (-3731.477) [-3723.234] (-3725.354) (-3730.735) * (-3721.391) (-3726.191) (-3726.392) [-3722.159] -- 0:03:06 344500 -- (-3720.200) (-3724.403) (-3722.883) [-3729.307] * (-3722.152) (-3725.195) (-3725.240) [-3722.575] -- 0:03:06 345000 -- (-3722.679) [-3720.568] (-3729.072) (-3722.149) * (-3722.695) (-3729.652) (-3719.677) [-3729.732] -- 0:03:06 Average standard deviation of split frequencies: 0.000000 345500 -- [-3724.073] (-3723.361) (-3721.533) (-3722.675) * (-3720.787) [-3723.582] (-3723.450) (-3727.530) -- 0:03:05 346000 -- (-3718.946) (-3724.021) [-3725.230] (-3726.753) * (-3722.435) [-3721.004] (-3726.462) (-3721.153) -- 0:03:05 346500 -- [-3719.350] (-3717.608) (-3724.597) (-3729.282) * (-3724.344) (-3721.414) [-3727.964] (-3729.021) -- 0:03:04 347000 -- (-3720.286) (-3722.597) [-3721.612] (-3729.977) * (-3727.868) (-3728.243) (-3721.476) [-3719.391] -- 0:03:04 347500 -- [-3723.089] (-3721.331) (-3725.020) (-3722.098) * (-3729.279) [-3725.604] (-3723.141) (-3723.880) -- 0:03:05 348000 -- (-3721.120) (-3718.971) (-3719.734) [-3720.218] * (-3722.196) (-3719.805) (-3722.620) [-3726.718] -- 0:03:05 348500 -- (-3722.698) [-3720.558] (-3723.868) (-3720.498) * [-3720.018] (-3718.639) (-3719.008) (-3721.919) -- 0:03:05 349000 -- (-3732.164) (-3721.145) [-3722.264] (-3725.853) * (-3732.670) [-3719.998] (-3723.835) (-3718.706) -- 0:03:04 349500 -- (-3723.633) [-3728.266] (-3728.199) (-3729.953) * (-3726.405) (-3724.549) (-3722.860) [-3721.122] -- 0:03:04 350000 -- (-3720.930) (-3727.329) [-3721.946] (-3724.232) * (-3727.884) (-3725.981) [-3720.581] (-3725.458) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 350500 -- (-3722.671) (-3721.964) [-3721.951] (-3723.789) * (-3720.446) (-3720.708) (-3728.690) [-3723.118] -- 0:03:03 351000 -- (-3727.125) (-3722.614) [-3720.981] (-3726.171) * (-3719.760) [-3724.668] (-3724.720) (-3729.595) -- 0:03:04 351500 -- (-3720.524) (-3721.190) (-3726.655) [-3727.229] * (-3719.145) (-3722.026) [-3724.376] (-3736.024) -- 0:03:04 352000 -- [-3721.803] (-3727.622) (-3721.188) (-3733.097) * (-3724.642) (-3720.779) [-3717.475] (-3725.567) -- 0:03:04 352500 -- (-3722.835) (-3727.908) (-3727.440) [-3723.760] * (-3722.513) (-3719.016) (-3719.757) [-3722.351] -- 0:03:03 353000 -- (-3725.001) (-3732.207) (-3721.151) [-3720.140] * (-3719.614) (-3716.349) (-3724.376) [-3721.363] -- 0:03:03 353500 -- (-3725.764) [-3721.850] (-3719.543) (-3722.116) * (-3719.963) [-3718.775] (-3725.744) (-3723.890) -- 0:03:02 354000 -- (-3722.899) (-3723.546) [-3725.396] (-3718.572) * [-3726.054] (-3720.601) (-3722.938) (-3729.621) -- 0:03:02 354500 -- (-3726.185) (-3722.157) (-3726.551) [-3719.460] * (-3719.656) (-3720.406) (-3724.879) [-3730.466] -- 0:03:03 355000 -- (-3731.669) [-3720.270] (-3721.463) (-3721.244) * (-3723.999) (-3719.061) (-3722.741) [-3728.361] -- 0:03:03 Average standard deviation of split frequencies: 0.000000 355500 -- (-3726.369) (-3719.460) (-3726.434) [-3731.713] * (-3726.792) [-3717.537] (-3724.186) (-3727.935) -- 0:03:03 356000 -- (-3725.166) [-3719.150] (-3724.318) (-3723.652) * (-3727.131) [-3722.880] (-3719.173) (-3728.252) -- 0:03:02 356500 -- (-3723.948) (-3721.526) (-3726.142) [-3725.010] * [-3719.954] (-3720.766) (-3719.866) (-3724.705) -- 0:03:02 357000 -- (-3721.147) (-3730.471) (-3730.294) [-3721.208] * (-3725.042) (-3727.934) (-3737.353) [-3720.046] -- 0:03:01 357500 -- (-3721.673) [-3727.206] (-3725.084) (-3730.191) * [-3717.161] (-3726.280) (-3725.422) (-3721.904) -- 0:03:01 358000 -- [-3730.500] (-3719.294) (-3727.375) (-3724.426) * (-3720.576) [-3721.325] (-3721.186) (-3727.050) -- 0:03:02 358500 -- (-3723.317) (-3723.610) (-3725.227) [-3717.649] * (-3723.315) (-3728.442) [-3725.961] (-3728.812) -- 0:03:02 359000 -- (-3721.804) (-3732.325) (-3724.114) [-3718.632] * [-3726.798] (-3719.558) (-3725.704) (-3728.312) -- 0:03:02 359500 -- (-3731.737) (-3720.283) (-3727.674) [-3721.843] * (-3720.781) [-3721.775] (-3727.777) (-3720.986) -- 0:03:01 360000 -- (-3725.504) [-3720.925] (-3723.156) (-3722.531) * (-3719.766) [-3718.482] (-3722.880) (-3723.635) -- 0:03:01 Average standard deviation of split frequencies: 0.000000 360500 -- (-3727.756) [-3724.314] (-3723.076) (-3720.580) * [-3716.894] (-3720.031) (-3724.450) (-3727.071) -- 0:03:00 361000 -- (-3722.718) [-3723.560] (-3728.198) (-3723.811) * (-3718.365) [-3721.459] (-3723.907) (-3724.169) -- 0:03:00 361500 -- (-3725.584) [-3728.395] (-3721.907) (-3729.143) * (-3721.954) [-3721.965] (-3724.677) (-3721.369) -- 0:03:01 362000 -- (-3721.459) (-3723.910) [-3731.584] (-3726.906) * (-3721.620) (-3722.989) (-3718.645) [-3718.698] -- 0:03:01 362500 -- [-3722.726] (-3730.216) (-3723.305) (-3722.938) * (-3720.309) [-3723.289] (-3725.143) (-3727.164) -- 0:03:01 363000 -- (-3726.988) (-3724.456) (-3729.727) [-3721.742] * (-3721.602) (-3731.753) [-3725.441] (-3721.748) -- 0:03:00 363500 -- (-3726.517) (-3720.212) [-3718.748] (-3719.462) * (-3722.054) [-3719.079] (-3725.417) (-3719.276) -- 0:03:00 364000 -- (-3724.127) (-3723.674) (-3720.198) [-3722.115] * (-3725.870) [-3723.140] (-3720.863) (-3717.978) -- 0:02:59 364500 -- (-3726.382) (-3726.868) [-3718.979] (-3723.790) * (-3723.602) [-3719.766] (-3718.301) (-3719.393) -- 0:02:59 365000 -- (-3723.253) [-3722.553] (-3722.404) (-3731.124) * (-3719.360) (-3723.789) (-3722.466) [-3721.221] -- 0:02:59 Average standard deviation of split frequencies: 0.000000 365500 -- (-3720.156) (-3716.498) (-3721.668) [-3719.507] * (-3717.005) (-3722.909) [-3721.530] (-3720.359) -- 0:03:00 366000 -- (-3723.044) (-3720.634) [-3720.147] (-3717.140) * (-3725.096) (-3725.633) (-3728.450) [-3721.698] -- 0:03:00 366500 -- (-3723.698) (-3728.171) [-3718.634] (-3717.316) * (-3725.703) (-3726.962) (-3723.929) [-3722.718] -- 0:02:59 367000 -- [-3725.675] (-3725.166) (-3725.830) (-3723.478) * (-3721.387) (-3730.604) (-3721.398) [-3718.082] -- 0:02:59 367500 -- (-3722.288) [-3725.238] (-3721.002) (-3720.711) * [-3720.982] (-3722.969) (-3722.217) (-3719.186) -- 0:02:58 368000 -- (-3725.037) [-3722.211] (-3725.922) (-3725.914) * (-3722.012) [-3721.325] (-3726.316) (-3717.493) -- 0:02:58 368500 -- (-3721.541) (-3720.658) (-3722.685) [-3721.242] * (-3725.849) [-3722.386] (-3726.873) (-3718.571) -- 0:02:58 369000 -- [-3720.456] (-3718.905) (-3721.140) (-3719.119) * (-3722.140) [-3728.577] (-3723.594) (-3727.153) -- 0:02:59 369500 -- (-3721.262) (-3718.818) (-3724.745) [-3718.092] * (-3720.361) (-3720.238) [-3724.510] (-3720.603) -- 0:02:59 370000 -- [-3720.297] (-3724.920) (-3725.752) (-3724.871) * [-3724.196] (-3721.528) (-3723.294) (-3725.337) -- 0:02:58 Average standard deviation of split frequencies: 0.000000 370500 -- [-3723.706] (-3731.926) (-3721.056) (-3720.507) * (-3728.684) (-3728.037) [-3718.365] (-3719.604) -- 0:02:58 371000 -- (-3732.027) [-3721.201] (-3728.642) (-3725.049) * (-3721.352) (-3722.775) (-3721.111) [-3718.649] -- 0:02:58 371500 -- (-3727.980) [-3724.649] (-3718.790) (-3722.677) * (-3728.213) (-3724.784) [-3726.377] (-3723.491) -- 0:02:57 372000 -- (-3722.590) (-3722.622) (-3720.971) [-3731.695] * [-3722.969] (-3723.028) (-3732.094) (-3720.233) -- 0:02:57 372500 -- (-3725.676) (-3723.021) [-3717.087] (-3731.365) * [-3719.276] (-3717.620) (-3724.213) (-3724.628) -- 0:02:58 373000 -- (-3726.975) (-3722.030) (-3724.646) [-3726.054] * [-3720.225] (-3718.890) (-3723.734) (-3725.676) -- 0:02:58 373500 -- (-3744.074) (-3728.652) (-3720.016) [-3721.614] * [-3717.456] (-3719.312) (-3725.321) (-3722.900) -- 0:02:57 374000 -- (-3724.143) [-3723.752] (-3729.721) (-3721.181) * (-3721.416) [-3723.768] (-3724.938) (-3729.064) -- 0:02:57 374500 -- (-3727.013) [-3721.572] (-3724.652) (-3718.695) * (-3728.870) (-3721.566) [-3721.486] (-3722.224) -- 0:02:57 375000 -- (-3724.927) [-3719.761] (-3727.868) (-3720.086) * (-3731.528) (-3723.501) [-3722.184] (-3721.147) -- 0:02:56 Average standard deviation of split frequencies: 0.000000 375500 -- (-3722.542) (-3717.603) (-3723.807) [-3721.640] * [-3722.317] (-3724.199) (-3720.360) (-3729.724) -- 0:02:56 376000 -- (-3727.921) (-3718.238) (-3724.892) [-3726.487] * (-3723.945) [-3720.968] (-3718.876) (-3727.842) -- 0:02:57 376500 -- (-3727.909) [-3720.509] (-3718.477) (-3725.571) * (-3728.572) [-3724.291] (-3726.843) (-3721.478) -- 0:02:57 377000 -- (-3724.726) (-3720.875) (-3719.159) [-3726.193] * (-3725.092) (-3721.942) (-3730.105) [-3720.372] -- 0:02:56 377500 -- (-3720.716) (-3721.006) [-3720.509] (-3720.985) * (-3722.331) (-3732.024) [-3717.385] (-3724.957) -- 0:02:56 378000 -- (-3724.031) (-3737.230) [-3720.274] (-3725.197) * (-3719.747) [-3722.113] (-3722.593) (-3727.598) -- 0:02:56 378500 -- (-3717.461) [-3722.979] (-3721.327) (-3721.566) * (-3725.130) (-3725.549) (-3725.424) [-3724.707] -- 0:02:55 379000 -- (-3718.187) (-3726.971) [-3721.107] (-3733.173) * (-3717.684) (-3722.818) (-3723.155) [-3722.215] -- 0:02:55 379500 -- (-3729.285) (-3724.175) (-3727.076) [-3721.149] * (-3721.921) [-3728.311] (-3717.679) (-3732.510) -- 0:02:56 380000 -- (-3722.269) [-3724.008] (-3724.098) (-3730.294) * [-3719.724] (-3724.123) (-3722.267) (-3722.240) -- 0:02:56 Average standard deviation of split frequencies: 0.000000 380500 -- (-3724.358) (-3727.204) [-3727.625] (-3729.233) * (-3724.971) [-3720.503] (-3723.714) (-3721.985) -- 0:02:55 381000 -- [-3723.215] (-3720.831) (-3732.982) (-3727.817) * (-3725.953) (-3724.666) [-3719.119] (-3724.695) -- 0:02:57 381500 -- (-3726.053) [-3721.042] (-3721.011) (-3723.896) * (-3717.552) (-3720.725) (-3730.231) [-3724.172] -- 0:02:56 382000 -- (-3726.105) [-3720.274] (-3721.584) (-3723.593) * (-3724.878) (-3724.179) (-3723.187) [-3721.114] -- 0:02:56 382500 -- (-3726.034) [-3720.067] (-3718.741) (-3726.469) * (-3726.247) (-3721.973) (-3723.635) [-3720.078] -- 0:02:55 383000 -- (-3722.302) (-3725.069) [-3719.140] (-3723.063) * (-3725.449) [-3727.056] (-3727.649) (-3721.889) -- 0:02:55 383500 -- (-3731.164) (-3720.438) (-3727.417) [-3722.367] * (-3722.365) (-3725.750) (-3732.354) [-3718.590] -- 0:02:55 384000 -- (-3723.215) (-3728.757) [-3721.464] (-3724.453) * [-3735.135] (-3722.523) (-3722.772) (-3719.229) -- 0:02:54 384500 -- (-3717.290) (-3727.780) (-3724.361) [-3720.848] * (-3726.592) (-3722.818) [-3722.389] (-3723.168) -- 0:02:56 385000 -- (-3722.518) (-3737.330) (-3724.852) [-3724.628] * (-3723.923) (-3720.552) (-3726.681) [-3718.913] -- 0:02:55 Average standard deviation of split frequencies: 0.000000 385500 -- (-3723.798) (-3728.750) (-3719.303) [-3726.896] * [-3724.365] (-3722.757) (-3723.066) (-3722.519) -- 0:02:55 386000 -- (-3723.385) [-3718.750] (-3723.529) (-3723.332) * (-3719.110) (-3730.930) [-3728.832] (-3724.959) -- 0:02:54 386500 -- (-3725.617) (-3730.533) [-3721.745] (-3721.620) * (-3723.167) [-3722.353] (-3719.277) (-3720.914) -- 0:02:54 387000 -- (-3718.592) (-3724.807) [-3725.143] (-3723.916) * (-3721.376) (-3724.936) [-3725.427] (-3723.386) -- 0:02:54 387500 -- (-3720.545) (-3718.837) [-3720.387] (-3717.410) * (-3728.078) (-3720.031) (-3725.066) [-3722.435] -- 0:02:53 388000 -- (-3720.719) [-3724.362] (-3722.338) (-3728.827) * (-3732.635) (-3724.359) [-3722.735] (-3729.146) -- 0:02:55 388500 -- (-3721.236) (-3727.304) [-3719.822] (-3719.455) * (-3722.172) (-3721.656) (-3719.167) [-3727.116] -- 0:02:54 389000 -- (-3728.869) (-3721.934) (-3724.505) [-3727.512] * (-3729.276) (-3720.275) (-3723.960) [-3724.622] -- 0:02:54 389500 -- (-3722.759) [-3722.859] (-3724.342) (-3725.333) * (-3725.298) (-3731.366) [-3717.657] (-3721.470) -- 0:02:53 390000 -- (-3722.617) [-3721.352] (-3719.686) (-3726.815) * (-3720.204) (-3731.679) (-3722.149) [-3721.101] -- 0:02:53 Average standard deviation of split frequencies: 0.000000 390500 -- [-3722.150] (-3722.649) (-3719.812) (-3720.708) * (-3724.126) [-3725.730] (-3729.395) (-3723.729) -- 0:02:53 391000 -- (-3725.847) [-3724.232] (-3727.237) (-3720.869) * (-3722.290) [-3721.935] (-3730.627) (-3719.995) -- 0:02:52 391500 -- (-3722.165) [-3718.716] (-3724.719) (-3721.370) * [-3719.912] (-3721.571) (-3730.821) (-3727.202) -- 0:02:54 392000 -- (-3724.195) [-3719.394] (-3722.970) (-3724.951) * (-3720.562) [-3716.413] (-3731.696) (-3725.717) -- 0:02:53 392500 -- (-3726.549) (-3721.086) (-3726.106) [-3722.975] * (-3724.583) [-3725.942] (-3725.648) (-3727.099) -- 0:02:53 393000 -- [-3720.993] (-3719.391) (-3729.403) (-3721.345) * (-3720.868) (-3721.108) [-3727.384] (-3725.342) -- 0:02:52 393500 -- [-3719.430] (-3724.354) (-3724.861) (-3728.477) * [-3725.214] (-3728.704) (-3721.555) (-3721.704) -- 0:02:52 394000 -- (-3718.647) [-3720.714] (-3726.611) (-3722.661) * (-3723.887) [-3732.348] (-3727.910) (-3721.169) -- 0:02:52 394500 -- (-3725.222) (-3723.118) [-3721.129] (-3727.846) * (-3718.897) (-3731.915) [-3724.806] (-3723.113) -- 0:02:51 395000 -- (-3716.112) (-3727.105) [-3720.267] (-3721.817) * (-3721.163) (-3731.052) (-3725.544) [-3723.688] -- 0:02:53 Average standard deviation of split frequencies: 0.000000 395500 -- (-3722.093) [-3724.875] (-3721.934) (-3724.467) * (-3725.253) [-3725.523] (-3725.864) (-3723.240) -- 0:02:52 396000 -- [-3717.605] (-3726.168) (-3722.578) (-3722.105) * (-3725.129) [-3718.956] (-3720.769) (-3727.600) -- 0:02:52 396500 -- (-3716.612) (-3724.956) [-3719.629] (-3720.119) * [-3719.763] (-3721.380) (-3723.956) (-3718.458) -- 0:02:51 397000 -- (-3727.938) [-3723.547] (-3721.330) (-3730.878) * (-3722.125) (-3724.633) [-3720.374] (-3721.843) -- 0:02:51 397500 -- (-3722.607) (-3721.296) (-3723.384) [-3724.050] * (-3729.031) (-3723.631) (-3725.001) [-3719.372] -- 0:02:51 398000 -- (-3720.845) [-3723.571] (-3721.964) (-3725.864) * (-3730.257) (-3718.716) (-3719.660) [-3720.493] -- 0:02:50 398500 -- (-3719.450) (-3720.775) [-3722.275] (-3725.544) * (-3717.504) (-3721.906) (-3730.457) [-3719.461] -- 0:02:50 399000 -- [-3724.137] (-3727.752) (-3722.819) (-3722.984) * (-3719.880) [-3721.086] (-3726.302) (-3722.437) -- 0:02:51 399500 -- (-3724.061) (-3718.892) (-3732.197) [-3727.148] * (-3722.083) [-3717.327] (-3725.973) (-3721.502) -- 0:02:51 400000 -- (-3726.045) (-3730.672) [-3723.331] (-3722.426) * (-3729.023) [-3719.560] (-3727.282) (-3722.534) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 400500 -- (-3724.821) [-3729.658] (-3727.012) (-3728.238) * [-3722.930] (-3719.520) (-3725.285) (-3719.193) -- 0:02:50 401000 -- (-3726.131) (-3735.839) (-3727.178) [-3722.923] * [-3717.720] (-3726.960) (-3720.062) (-3727.027) -- 0:02:50 401500 -- [-3717.332] (-3732.227) (-3728.795) (-3724.054) * (-3730.045) (-3724.007) (-3725.466) [-3721.366] -- 0:02:49 402000 -- (-3727.648) (-3730.886) [-3721.499] (-3723.046) * [-3721.165] (-3719.613) (-3728.486) (-3726.413) -- 0:02:49 402500 -- (-3724.215) (-3722.377) [-3718.914] (-3727.843) * (-3719.776) (-3722.531) [-3718.910] (-3719.006) -- 0:02:50 403000 -- (-3726.372) (-3722.996) (-3728.922) [-3722.177] * (-3724.221) (-3720.204) [-3722.476] (-3726.577) -- 0:02:50 403500 -- [-3717.784] (-3720.713) (-3726.850) (-3729.202) * (-3725.245) (-3721.531) [-3719.939] (-3721.650) -- 0:02:50 404000 -- (-3718.401) (-3718.449) (-3724.115) [-3729.910] * (-3720.634) [-3723.419] (-3722.679) (-3723.207) -- 0:02:49 404500 -- (-3718.125) (-3724.589) [-3724.512] (-3725.690) * [-3721.052] (-3726.383) (-3720.671) (-3732.598) -- 0:02:49 405000 -- (-3723.197) [-3719.096] (-3723.066) (-3720.592) * (-3717.795) (-3722.617) (-3727.879) [-3723.544] -- 0:02:48 Average standard deviation of split frequencies: 0.000000 405500 -- [-3720.659] (-3725.661) (-3723.640) (-3717.640) * (-3719.394) [-3724.463] (-3727.798) (-3730.989) -- 0:02:48 406000 -- [-3721.571] (-3722.099) (-3727.519) (-3718.036) * (-3720.020) (-3718.311) (-3726.459) [-3726.399] -- 0:02:49 406500 -- [-3725.177] (-3720.646) (-3722.244) (-3719.025) * (-3720.790) (-3720.277) [-3723.567] (-3721.201) -- 0:02:49 407000 -- [-3721.659] (-3723.568) (-3729.322) (-3727.082) * (-3719.406) (-3723.710) (-3726.761) [-3719.258] -- 0:02:49 407500 -- [-3722.542] (-3719.133) (-3724.010) (-3721.415) * [-3719.603] (-3722.356) (-3727.304) (-3722.349) -- 0:02:48 408000 -- (-3722.933) (-3725.859) (-3719.270) [-3723.564] * (-3717.210) [-3719.826] (-3718.532) (-3720.784) -- 0:02:48 408500 -- [-3722.885] (-3726.111) (-3722.511) (-3726.999) * (-3721.910) [-3717.226] (-3723.142) (-3717.407) -- 0:02:47 409000 -- (-3720.840) [-3723.067] (-3725.170) (-3725.274) * [-3720.628] (-3720.017) (-3723.861) (-3719.327) -- 0:02:47 409500 -- (-3718.952) [-3720.971] (-3727.295) (-3726.027) * [-3720.895] (-3726.170) (-3724.669) (-3722.795) -- 0:02:48 410000 -- (-3720.732) (-3717.804) (-3722.818) [-3722.245] * (-3735.717) (-3723.600) [-3723.602] (-3724.276) -- 0:02:48 Average standard deviation of split frequencies: 0.000000 410500 -- [-3727.882] (-3721.682) (-3719.488) (-3728.296) * (-3725.499) [-3723.213] (-3728.382) (-3717.785) -- 0:02:48 411000 -- (-3730.593) (-3718.425) [-3721.387] (-3727.062) * (-3720.230) [-3722.709] (-3724.555) (-3719.943) -- 0:02:47 411500 -- (-3729.955) (-3720.899) (-3723.923) [-3722.023] * (-3723.066) [-3722.762] (-3727.751) (-3717.815) -- 0:02:47 412000 -- (-3729.072) (-3722.134) (-3726.550) [-3724.239] * (-3722.894) (-3723.130) (-3726.728) [-3717.731] -- 0:02:46 412500 -- (-3730.547) (-3725.314) [-3720.987] (-3728.106) * (-3726.188) (-3718.685) (-3718.799) [-3721.818] -- 0:02:46 413000 -- (-3725.919) (-3725.430) (-3725.908) [-3722.051] * [-3725.294] (-3725.452) (-3722.471) (-3725.013) -- 0:02:47 413500 -- [-3721.334] (-3721.895) (-3722.541) (-3733.623) * (-3725.554) (-3724.995) (-3721.332) [-3719.728] -- 0:02:47 414000 -- (-3720.727) (-3722.327) [-3720.312] (-3725.662) * (-3722.690) [-3723.898] (-3721.439) (-3722.597) -- 0:02:47 414500 -- (-3721.133) (-3720.377) [-3719.806] (-3725.947) * (-3724.961) (-3732.109) [-3719.072] (-3731.545) -- 0:02:46 415000 -- [-3724.465] (-3721.993) (-3722.909) (-3722.610) * [-3717.901] (-3731.912) (-3724.383) (-3727.538) -- 0:02:46 Average standard deviation of split frequencies: 0.000000 415500 -- (-3727.860) (-3726.929) [-3720.959] (-3721.646) * (-3724.487) (-3727.202) (-3723.040) [-3723.766] -- 0:02:45 416000 -- [-3719.748] (-3722.230) (-3722.275) (-3722.417) * [-3720.617] (-3719.537) (-3726.091) (-3719.440) -- 0:02:45 416500 -- (-3721.117) (-3726.072) [-3721.016] (-3722.744) * [-3727.213] (-3720.491) (-3726.190) (-3721.884) -- 0:02:46 417000 -- (-3724.739) [-3724.952] (-3726.171) (-3723.052) * (-3726.393) [-3722.948] (-3721.564) (-3724.403) -- 0:02:46 417500 -- [-3722.233] (-3724.485) (-3726.586) (-3725.665) * (-3725.547) [-3722.759] (-3720.459) (-3725.282) -- 0:02:46 418000 -- (-3720.899) [-3721.203] (-3725.980) (-3719.763) * (-3725.528) (-3727.115) [-3723.770] (-3724.433) -- 0:02:45 418500 -- (-3725.797) (-3726.475) (-3722.878) [-3719.706] * [-3726.720] (-3720.931) (-3725.380) (-3723.012) -- 0:02:45 419000 -- (-3723.547) (-3732.195) (-3726.902) [-3717.951] * (-3726.909) [-3720.354] (-3721.640) (-3722.201) -- 0:02:45 419500 -- (-3723.772) (-3723.952) (-3724.332) [-3715.621] * (-3719.303) [-3722.290] (-3722.553) (-3727.776) -- 0:02:44 420000 -- [-3719.742] (-3722.365) (-3727.408) (-3717.884) * (-3722.983) (-3720.120) [-3718.740] (-3725.880) -- 0:02:45 Average standard deviation of split frequencies: 0.000000 420500 -- (-3727.001) (-3721.192) (-3725.364) [-3719.004] * (-3718.982) [-3719.933] (-3723.608) (-3723.290) -- 0:02:45 421000 -- (-3724.384) (-3724.501) (-3721.080) [-3720.138] * (-3723.965) [-3719.677] (-3721.697) (-3721.760) -- 0:02:45 421500 -- [-3723.620] (-3720.616) (-3732.138) (-3720.888) * (-3723.686) (-3718.051) [-3717.724] (-3729.456) -- 0:02:44 422000 -- (-3719.274) [-3721.002] (-3719.148) (-3718.972) * [-3722.090] (-3722.912) (-3722.491) (-3728.715) -- 0:02:44 422500 -- (-3722.375) (-3726.752) (-3726.590) [-3719.597] * [-3724.762] (-3721.639) (-3721.510) (-3725.819) -- 0:02:44 423000 -- (-3720.011) (-3722.568) (-3724.928) [-3729.443] * (-3724.864) (-3718.670) (-3720.766) [-3727.279] -- 0:02:43 423500 -- (-3723.896) (-3723.983) [-3723.993] (-3727.756) * (-3724.186) [-3718.564] (-3721.445) (-3721.181) -- 0:02:44 424000 -- (-3729.294) [-3728.796] (-3725.106) (-3723.310) * (-3717.468) (-3727.667) (-3721.503) [-3719.683] -- 0:02:44 424500 -- (-3722.920) (-3727.017) (-3722.699) [-3720.218] * [-3722.717] (-3725.548) (-3722.262) (-3726.603) -- 0:02:44 425000 -- (-3720.997) (-3730.578) (-3729.221) [-3719.874] * (-3721.677) [-3723.830] (-3719.699) (-3729.916) -- 0:02:43 Average standard deviation of split frequencies: 0.000000 425500 -- (-3720.898) (-3727.787) (-3728.077) [-3721.478] * [-3719.176] (-3721.242) (-3723.985) (-3725.333) -- 0:02:43 426000 -- [-3720.622] (-3723.257) (-3723.676) (-3717.560) * (-3722.252) (-3720.192) (-3722.346) [-3723.131] -- 0:02:43 426500 -- (-3724.011) [-3717.442] (-3719.315) (-3727.038) * (-3722.856) [-3721.076] (-3725.748) (-3720.516) -- 0:02:42 427000 -- (-3723.970) (-3721.292) [-3724.069] (-3728.345) * (-3720.588) (-3725.779) [-3719.918] (-3732.062) -- 0:02:43 427500 -- (-3729.773) (-3719.694) [-3717.539] (-3728.724) * (-3719.895) [-3722.037] (-3721.345) (-3724.438) -- 0:02:43 428000 -- (-3726.675) (-3722.420) [-3721.088] (-3724.135) * [-3727.018] (-3722.378) (-3723.137) (-3719.807) -- 0:02:43 428500 -- (-3729.716) [-3721.110] (-3721.843) (-3725.405) * (-3726.014) (-3722.391) (-3726.997) [-3720.873] -- 0:02:42 429000 -- (-3729.636) [-3724.105] (-3724.180) (-3724.645) * [-3721.154] (-3729.603) (-3723.923) (-3719.092) -- 0:02:42 429500 -- [-3724.914] (-3725.095) (-3723.151) (-3720.937) * (-3723.259) [-3724.391] (-3725.156) (-3724.384) -- 0:02:42 430000 -- (-3726.468) [-3726.468] (-3726.520) (-3725.859) * (-3717.616) (-3721.259) (-3732.595) [-3724.491] -- 0:02:41 Average standard deviation of split frequencies: 0.000000 430500 -- (-3725.118) (-3719.136) (-3731.572) [-3723.449] * (-3724.351) (-3720.785) (-3727.621) [-3725.000] -- 0:02:42 431000 -- (-3721.884) [-3719.946] (-3728.534) (-3723.008) * (-3723.411) (-3731.560) [-3722.014] (-3724.896) -- 0:02:42 431500 -- (-3719.520) (-3720.170) (-3722.887) [-3718.726] * (-3729.003) [-3723.156] (-3721.145) (-3724.535) -- 0:02:42 432000 -- [-3716.934] (-3722.224) (-3722.216) (-3725.775) * (-3722.766) [-3725.912] (-3720.953) (-3719.025) -- 0:02:41 432500 -- (-3723.194) [-3722.044] (-3727.359) (-3721.433) * (-3720.169) (-3724.165) (-3724.714) [-3718.648] -- 0:02:41 433000 -- [-3720.660] (-3724.505) (-3723.081) (-3728.104) * [-3724.046] (-3723.830) (-3720.880) (-3724.882) -- 0:02:41 433500 -- (-3725.655) [-3725.103] (-3721.655) (-3719.702) * (-3723.436) [-3728.346] (-3723.299) (-3718.733) -- 0:02:40 434000 -- [-3720.771] (-3727.596) (-3726.340) (-3717.336) * (-3724.369) (-3719.782) (-3721.530) [-3716.564] -- 0:02:41 434500 -- (-3723.684) [-3719.977] (-3734.860) (-3721.983) * (-3727.154) [-3717.384] (-3725.757) (-3725.670) -- 0:02:41 435000 -- [-3724.060] (-3725.762) (-3721.993) (-3722.144) * (-3723.740) [-3722.082] (-3729.206) (-3727.451) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 435500 -- [-3716.636] (-3723.491) (-3726.805) (-3727.372) * [-3725.673] (-3726.251) (-3722.190) (-3723.278) -- 0:02:40 436000 -- (-3718.722) (-3717.842) [-3721.606] (-3722.469) * (-3725.229) (-3723.653) [-3721.290] (-3725.069) -- 0:02:40 436500 -- [-3720.417] (-3723.146) (-3722.936) (-3730.068) * (-3722.994) (-3719.471) (-3722.966) [-3722.154] -- 0:02:40 437000 -- (-3723.816) [-3724.021] (-3733.016) (-3722.163) * [-3725.351] (-3720.067) (-3728.632) (-3723.660) -- 0:02:39 437500 -- [-3725.214] (-3728.087) (-3731.259) (-3726.851) * (-3727.364) [-3718.893] (-3737.207) (-3730.800) -- 0:02:39 438000 -- (-3723.424) [-3724.098] (-3719.618) (-3724.205) * (-3725.505) (-3724.385) (-3729.511) [-3720.627] -- 0:02:40 438500 -- (-3723.868) (-3727.785) (-3728.084) [-3721.264] * (-3727.987) (-3718.550) (-3725.719) [-3718.551] -- 0:02:40 439000 -- [-3721.966] (-3723.225) (-3723.448) (-3726.941) * [-3720.419] (-3725.737) (-3721.300) (-3721.189) -- 0:02:39 439500 -- (-3720.141) (-3726.573) (-3724.736) [-3718.589] * [-3730.712] (-3715.739) (-3729.939) (-3723.131) -- 0:02:39 440000 -- (-3720.775) (-3721.933) (-3722.505) [-3719.586] * [-3719.803] (-3725.367) (-3720.511) (-3723.321) -- 0:02:39 Average standard deviation of split frequencies: 0.000000 440500 -- [-3720.884] (-3731.529) (-3721.621) (-3726.966) * (-3722.341) (-3723.555) (-3728.314) [-3724.145] -- 0:02:38 441000 -- [-3720.029] (-3724.084) (-3721.443) (-3721.768) * (-3725.532) [-3721.373] (-3724.409) (-3723.047) -- 0:02:38 441500 -- (-3723.464) (-3722.421) [-3720.585] (-3726.592) * (-3726.941) [-3722.162] (-3729.282) (-3722.330) -- 0:02:39 442000 -- (-3726.461) (-3727.549) (-3725.513) [-3717.657] * [-3721.375] (-3719.097) (-3720.322) (-3722.279) -- 0:02:39 442500 -- (-3721.640) (-3720.097) (-3723.022) [-3718.229] * (-3721.553) (-3724.687) [-3719.421] (-3721.985) -- 0:02:38 443000 -- (-3734.216) [-3722.092] (-3724.848) (-3725.217) * (-3724.848) (-3721.044) [-3717.974] (-3725.434) -- 0:02:38 443500 -- (-3721.195) [-3726.800] (-3724.227) (-3719.007) * (-3724.634) (-3719.412) [-3720.060] (-3726.079) -- 0:02:38 444000 -- (-3726.095) (-3719.466) [-3722.743] (-3725.511) * (-3724.357) (-3720.345) (-3720.883) [-3725.967] -- 0:02:37 444500 -- (-3725.923) (-3719.370) [-3717.818] (-3729.297) * (-3726.693) [-3720.665] (-3725.730) (-3725.069) -- 0:02:37 445000 -- [-3722.680] (-3720.894) (-3718.563) (-3731.306) * (-3733.223) (-3724.307) [-3723.137] (-3725.961) -- 0:02:38 Average standard deviation of split frequencies: 0.000000 445500 -- (-3721.423) [-3720.547] (-3720.607) (-3722.871) * (-3736.083) (-3724.139) (-3723.605) [-3722.974] -- 0:02:38 446000 -- (-3724.259) (-3728.170) (-3723.616) [-3724.276] * (-3728.443) (-3719.258) [-3720.303] (-3724.101) -- 0:02:37 446500 -- (-3728.127) (-3733.057) (-3722.903) [-3723.673] * (-3726.000) (-3723.774) [-3722.726] (-3720.773) -- 0:02:37 447000 -- [-3724.693] (-3733.313) (-3722.545) (-3722.116) * (-3726.444) [-3725.541] (-3722.305) (-3724.549) -- 0:02:37 447500 -- (-3722.586) (-3720.872) (-3724.037) [-3718.057] * (-3727.317) (-3723.168) [-3726.453] (-3724.033) -- 0:02:36 448000 -- (-3723.469) [-3724.133] (-3726.560) (-3720.983) * [-3723.586] (-3718.164) (-3724.339) (-3721.079) -- 0:02:36 448500 -- (-3719.108) (-3722.613) [-3717.938] (-3722.350) * (-3729.165) (-3721.284) [-3718.809] (-3721.077) -- 0:02:37 449000 -- [-3718.911] (-3723.320) (-3726.087) (-3726.003) * (-3723.972) [-3722.718] (-3720.104) (-3719.075) -- 0:02:37 449500 -- [-3721.635] (-3724.797) (-3720.483) (-3725.987) * [-3719.430] (-3725.458) (-3726.611) (-3721.637) -- 0:02:36 450000 -- (-3721.690) (-3722.404) (-3723.291) [-3727.471] * (-3723.086) (-3727.652) (-3725.583) [-3720.014] -- 0:02:36 Average standard deviation of split frequencies: 0.000000 450500 -- [-3726.238] (-3722.208) (-3721.715) (-3726.737) * [-3719.524] (-3727.115) (-3720.990) (-3725.748) -- 0:02:36 451000 -- (-3725.492) (-3729.609) [-3721.271] (-3720.919) * [-3722.495] (-3721.275) (-3723.735) (-3725.537) -- 0:02:35 451500 -- (-3722.246) [-3721.852] (-3719.212) (-3724.795) * [-3720.970] (-3728.047) (-3720.855) (-3723.282) -- 0:02:35 452000 -- (-3716.685) (-3724.437) [-3718.291] (-3719.307) * (-3719.721) [-3730.739] (-3721.042) (-3720.479) -- 0:02:36 452500 -- [-3719.936] (-3726.410) (-3723.051) (-3722.379) * (-3717.722) (-3727.159) (-3732.481) [-3722.075] -- 0:02:36 453000 -- (-3719.587) [-3724.581] (-3725.534) (-3719.985) * (-3722.721) (-3721.077) (-3728.658) [-3727.261] -- 0:02:35 453500 -- [-3719.951] (-3724.878) (-3726.345) (-3722.524) * (-3731.063) (-3730.354) [-3728.897] (-3731.507) -- 0:02:35 454000 -- (-3724.101) (-3722.655) [-3724.219] (-3724.443) * (-3720.865) [-3725.996] (-3723.046) (-3719.841) -- 0:02:35 454500 -- [-3719.093] (-3725.747) (-3720.856) (-3725.246) * (-3724.848) [-3726.951] (-3727.052) (-3721.490) -- 0:02:34 455000 -- [-3720.181] (-3729.568) (-3720.499) (-3723.754) * (-3718.551) (-3719.629) [-3728.846] (-3726.955) -- 0:02:34 Average standard deviation of split frequencies: 0.000000 455500 -- [-3719.404] (-3724.289) (-3717.758) (-3735.690) * (-3727.655) (-3718.200) (-3722.872) [-3717.170] -- 0:02:35 456000 -- (-3725.965) (-3730.867) (-3723.654) [-3718.531] * (-3717.816) [-3718.288] (-3725.141) (-3720.770) -- 0:02:35 456500 -- (-3723.348) (-3725.694) [-3725.574] (-3721.275) * (-3724.289) (-3718.919) [-3722.827] (-3720.729) -- 0:02:34 457000 -- (-3726.801) (-3720.058) (-3725.571) [-3723.768] * (-3727.196) [-3720.205] (-3721.108) (-3727.774) -- 0:02:34 457500 -- (-3725.163) (-3723.672) (-3718.500) [-3719.768] * (-3720.587) (-3723.181) (-3722.314) [-3720.653] -- 0:02:34 458000 -- [-3719.667] (-3723.055) (-3719.165) (-3719.198) * (-3718.778) (-3721.070) (-3724.087) [-3718.936] -- 0:02:33 458500 -- (-3723.036) (-3727.460) [-3724.196] (-3721.870) * (-3720.961) [-3726.419] (-3723.784) (-3724.016) -- 0:02:33 459000 -- [-3723.445] (-3725.718) (-3720.437) (-3720.992) * (-3722.328) [-3722.928] (-3732.640) (-3727.302) -- 0:02:34 459500 -- [-3724.012] (-3729.021) (-3721.156) (-3716.600) * (-3718.211) (-3727.970) [-3729.040] (-3729.501) -- 0:02:34 460000 -- (-3727.705) [-3725.400] (-3720.543) (-3722.420) * (-3722.810) (-3719.646) (-3725.394) [-3720.893] -- 0:02:33 Average standard deviation of split frequencies: 0.000000 460500 -- (-3724.673) (-3725.183) [-3723.803] (-3722.172) * (-3727.576) (-3721.282) (-3726.327) [-3716.625] -- 0:02:33 461000 -- [-3717.662] (-3722.890) (-3727.804) (-3730.955) * (-3721.501) [-3721.503] (-3722.416) (-3720.724) -- 0:02:33 461500 -- [-3723.884] (-3732.199) (-3722.797) (-3721.639) * (-3721.015) (-3723.308) (-3719.164) [-3720.707] -- 0:02:32 462000 -- (-3722.981) (-3727.882) [-3723.769] (-3725.746) * [-3721.235] (-3724.542) (-3723.360) (-3719.553) -- 0:02:32 462500 -- [-3720.605] (-3722.104) (-3723.681) (-3718.412) * (-3724.406) (-3724.030) [-3723.652] (-3721.146) -- 0:02:33 463000 -- (-3727.579) (-3723.955) (-3718.988) [-3727.564] * (-3722.301) (-3728.089) (-3723.713) [-3723.624] -- 0:02:33 463500 -- [-3721.935] (-3722.139) (-3723.933) (-3720.599) * (-3732.755) [-3727.553] (-3726.746) (-3723.210) -- 0:02:32 464000 -- [-3722.764] (-3724.503) (-3730.914) (-3723.369) * (-3720.903) (-3723.713) (-3725.686) [-3719.481] -- 0:02:32 464500 -- (-3720.449) [-3724.977] (-3725.544) (-3716.039) * [-3719.293] (-3720.319) (-3720.033) (-3718.803) -- 0:02:32 465000 -- (-3721.038) (-3719.470) (-3725.658) [-3719.767] * (-3722.292) [-3720.565] (-3723.139) (-3724.205) -- 0:02:31 Average standard deviation of split frequencies: 0.000000 465500 -- [-3725.880] (-3725.955) (-3718.334) (-3723.530) * (-3720.992) [-3724.535] (-3725.611) (-3725.353) -- 0:02:31 466000 -- (-3730.165) (-3718.245) (-3719.614) [-3724.260] * (-3720.282) [-3720.445] (-3724.842) (-3724.436) -- 0:02:32 466500 -- (-3723.507) (-3718.679) [-3721.862] (-3726.948) * (-3728.478) (-3722.068) [-3722.763] (-3720.584) -- 0:02:32 467000 -- (-3723.176) (-3721.888) (-3731.917) [-3722.427] * (-3726.459) [-3725.382] (-3720.720) (-3719.520) -- 0:02:31 467500 -- (-3720.656) [-3737.217] (-3723.500) (-3724.997) * (-3727.714) [-3718.395] (-3724.346) (-3722.292) -- 0:02:31 468000 -- (-3723.429) (-3729.953) (-3719.951) [-3724.185] * (-3727.596) (-3720.907) (-3719.404) [-3724.250] -- 0:02:31 468500 -- (-3725.815) (-3722.989) [-3728.649] (-3722.231) * [-3720.357] (-3718.506) (-3724.162) (-3717.506) -- 0:02:30 469000 -- [-3725.383] (-3726.457) (-3719.259) (-3723.227) * (-3728.294) [-3723.160] (-3723.022) (-3724.141) -- 0:02:30 469500 -- (-3716.848) [-3727.062] (-3721.636) (-3721.734) * [-3721.422] (-3721.067) (-3720.341) (-3723.816) -- 0:02:31 470000 -- [-3722.555] (-3723.229) (-3725.782) (-3720.433) * (-3723.215) [-3722.231] (-3718.937) (-3724.682) -- 0:02:31 Average standard deviation of split frequencies: 0.000000 470500 -- [-3724.759] (-3721.763) (-3724.105) (-3721.443) * [-3719.703] (-3721.455) (-3722.158) (-3718.786) -- 0:02:30 471000 -- (-3721.943) (-3723.419) (-3720.581) [-3719.945] * (-3723.618) [-3725.880] (-3727.016) (-3724.265) -- 0:02:30 471500 -- (-3727.125) (-3721.817) [-3721.340] (-3719.784) * [-3723.350] (-3725.587) (-3723.038) (-3724.193) -- 0:02:30 472000 -- (-3720.053) [-3727.826] (-3729.747) (-3727.987) * (-3736.315) [-3720.159] (-3724.178) (-3721.640) -- 0:02:29 472500 -- [-3727.268] (-3724.854) (-3724.500) (-3725.918) * (-3720.587) (-3723.395) [-3723.552] (-3722.119) -- 0:02:29 473000 -- (-3723.445) (-3722.505) (-3726.115) [-3730.769] * [-3719.178] (-3727.044) (-3720.112) (-3721.269) -- 0:02:30 473500 -- [-3720.971] (-3726.185) (-3727.253) (-3724.991) * (-3730.652) [-3723.345] (-3720.205) (-3720.362) -- 0:02:30 474000 -- (-3730.102) (-3720.102) (-3729.797) [-3722.924] * (-3723.750) (-3733.894) (-3720.224) [-3717.472] -- 0:02:29 474500 -- [-3720.218] (-3719.404) (-3726.718) (-3720.660) * (-3720.703) [-3720.687] (-3721.701) (-3724.737) -- 0:02:29 475000 -- (-3721.602) [-3720.802] (-3726.738) (-3721.283) * (-3726.053) (-3732.834) [-3717.912] (-3729.014) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 475500 -- (-3719.207) (-3722.458) [-3720.277] (-3723.786) * (-3722.466) (-3720.328) (-3719.428) [-3721.252] -- 0:02:28 476000 -- (-3723.963) [-3722.819] (-3723.610) (-3720.492) * [-3727.222] (-3732.113) (-3718.863) (-3734.052) -- 0:02:28 476500 -- (-3723.633) (-3723.972) (-3720.474) [-3717.999] * [-3725.708] (-3729.341) (-3724.750) (-3727.120) -- 0:02:28 477000 -- (-3727.496) [-3718.745] (-3724.733) (-3720.496) * (-3722.574) (-3725.544) (-3721.909) [-3725.255] -- 0:02:29 477500 -- (-3724.999) (-3721.117) [-3719.346] (-3721.029) * [-3720.592] (-3722.043) (-3729.599) (-3720.939) -- 0:02:28 478000 -- (-3720.816) (-3723.388) [-3719.158] (-3724.922) * (-3723.570) (-3722.288) [-3730.020] (-3719.619) -- 0:02:28 478500 -- (-3720.622) [-3722.543] (-3719.975) (-3722.220) * (-3717.916) (-3730.348) (-3721.091) [-3721.385] -- 0:02:28 479000 -- (-3718.256) (-3729.246) (-3721.713) [-3721.447] * [-3723.310] (-3733.396) (-3723.898) (-3727.464) -- 0:02:27 479500 -- (-3724.829) [-3722.113] (-3722.856) (-3720.535) * (-3718.522) (-3723.759) [-3722.442] (-3722.835) -- 0:02:27 480000 -- (-3727.651) (-3721.064) [-3719.738] (-3718.199) * (-3726.779) (-3724.309) (-3718.392) [-3720.833] -- 0:02:27 Average standard deviation of split frequencies: 0.000000 480500 -- (-3726.039) (-3724.804) (-3726.845) [-3726.935] * (-3723.744) (-3722.796) [-3722.629] (-3720.105) -- 0:02:28 481000 -- (-3729.272) (-3722.122) [-3727.121] (-3723.895) * [-3723.273] (-3724.767) (-3736.139) (-3718.811) -- 0:02:27 481500 -- (-3726.935) (-3728.289) (-3725.722) [-3719.865] * (-3722.548) [-3719.681] (-3726.366) (-3726.543) -- 0:02:27 482000 -- [-3720.332] (-3729.766) (-3728.133) (-3721.495) * (-3723.506) (-3729.374) (-3717.124) [-3722.485] -- 0:02:27 482500 -- (-3719.108) (-3722.115) [-3726.269] (-3721.970) * (-3727.309) [-3721.721] (-3719.993) (-3720.980) -- 0:02:26 483000 -- (-3731.033) (-3724.725) [-3720.291] (-3724.509) * (-3732.618) [-3720.121] (-3721.126) (-3723.454) -- 0:02:26 483500 -- (-3722.571) (-3729.361) (-3722.666) [-3724.654] * (-3719.788) (-3725.594) (-3722.833) [-3719.554] -- 0:02:26 484000 -- (-3724.721) [-3722.025] (-3725.593) (-3722.546) * (-3721.535) (-3725.420) (-3723.910) [-3718.959] -- 0:02:27 484500 -- (-3727.967) [-3719.270] (-3729.968) (-3732.247) * (-3719.554) (-3721.853) [-3720.350] (-3723.593) -- 0:02:26 485000 -- [-3717.846] (-3719.772) (-3726.985) (-3721.169) * (-3721.002) (-3722.346) [-3718.428] (-3721.929) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 485500 -- [-3719.742] (-3719.639) (-3725.802) (-3721.772) * (-3733.947) (-3720.217) [-3717.039] (-3720.423) -- 0:02:26 486000 -- (-3725.538) (-3722.557) [-3721.394] (-3724.351) * [-3718.931] (-3718.817) (-3721.927) (-3720.485) -- 0:02:25 486500 -- (-3724.604) (-3730.875) [-3718.796] (-3720.554) * (-3721.606) (-3720.596) (-3721.469) [-3722.980] -- 0:02:25 487000 -- [-3719.021] (-3724.719) (-3724.779) (-3728.574) * [-3719.848] (-3722.122) (-3722.051) (-3721.977) -- 0:02:25 487500 -- [-3720.637] (-3726.363) (-3721.661) (-3721.021) * [-3724.499] (-3729.554) (-3719.709) (-3722.495) -- 0:02:26 488000 -- (-3718.477) (-3720.628) [-3724.062] (-3727.021) * (-3726.561) (-3725.746) (-3726.233) [-3724.467] -- 0:02:25 488500 -- (-3718.323) (-3718.935) [-3722.442] (-3722.697) * (-3721.263) (-3723.271) [-3721.327] (-3720.306) -- 0:02:25 489000 -- (-3723.382) (-3725.888) [-3724.508] (-3729.863) * [-3724.215] (-3720.518) (-3725.465) (-3721.467) -- 0:02:25 489500 -- (-3726.097) (-3729.914) (-3721.965) [-3728.050] * (-3726.278) [-3723.498] (-3728.632) (-3725.615) -- 0:02:24 490000 -- [-3716.813] (-3725.046) (-3726.242) (-3727.480) * [-3718.493] (-3729.772) (-3726.006) (-3721.655) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 490500 -- [-3723.470] (-3729.726) (-3722.216) (-3724.316) * (-3717.209) (-3722.630) [-3720.699] (-3721.055) -- 0:02:24 491000 -- (-3731.520) (-3720.157) (-3724.852) [-3720.467] * (-3724.152) (-3726.538) [-3719.468] (-3723.469) -- 0:02:25 491500 -- (-3732.887) [-3723.923] (-3724.650) (-3733.934) * (-3720.364) (-3727.515) (-3723.562) [-3724.810] -- 0:02:24 492000 -- (-3731.224) [-3722.282] (-3717.670) (-3732.420) * (-3724.636) (-3725.868) [-3720.194] (-3724.373) -- 0:02:24 492500 -- [-3723.800] (-3722.496) (-3722.103) (-3731.762) * (-3724.302) (-3720.110) [-3722.713] (-3720.079) -- 0:02:24 493000 -- (-3725.274) [-3716.563] (-3724.345) (-3725.772) * (-3721.814) (-3722.141) [-3721.945] (-3716.621) -- 0:02:23 493500 -- (-3732.323) (-3722.069) [-3721.044] (-3720.699) * (-3719.848) (-3725.456) [-3721.162] (-3725.306) -- 0:02:23 494000 -- (-3730.430) (-3720.828) (-3718.512) [-3721.752] * (-3718.886) (-3718.914) (-3723.286) [-3720.944] -- 0:02:23 494500 -- (-3728.004) (-3720.891) (-3723.252) [-3720.577] * (-3721.246) [-3720.036] (-3725.886) (-3716.790) -- 0:02:24 495000 -- (-3723.378) (-3718.526) [-3720.725] (-3720.243) * (-3724.183) (-3717.816) (-3731.489) [-3723.896] -- 0:02:23 Average standard deviation of split frequencies: 0.000000 495500 -- (-3730.208) (-3722.637) [-3717.979] (-3724.669) * (-3724.346) [-3723.212] (-3725.658) (-3718.075) -- 0:02:23 496000 -- (-3725.230) [-3720.220] (-3725.828) (-3723.076) * (-3725.339) (-3723.998) (-3724.020) [-3724.933] -- 0:02:23 496500 -- (-3719.369) (-3723.645) (-3734.582) [-3722.148] * [-3734.750] (-3724.571) (-3721.878) (-3724.576) -- 0:02:22 497000 -- (-3723.908) [-3721.406] (-3724.315) (-3723.718) * (-3725.310) (-3722.434) [-3724.483] (-3726.052) -- 0:02:22 497500 -- [-3720.872] (-3728.253) (-3724.715) (-3726.819) * (-3722.638) [-3722.078] (-3726.624) (-3720.170) -- 0:02:22 498000 -- (-3727.442) [-3716.267] (-3721.343) (-3724.997) * [-3724.271] (-3726.276) (-3728.890) (-3726.543) -- 0:02:23 498500 -- (-3721.379) (-3721.377) [-3725.776] (-3726.946) * (-3721.350) (-3722.003) (-3726.738) [-3723.244] -- 0:02:22 499000 -- (-3722.303) (-3718.671) (-3720.548) [-3720.886] * (-3720.356) (-3726.609) (-3722.320) [-3720.341] -- 0:02:22 499500 -- (-3723.908) [-3723.290] (-3728.091) (-3725.307) * (-3724.277) (-3729.736) (-3742.271) [-3718.469] -- 0:02:22 500000 -- (-3730.886) [-3721.651] (-3721.300) (-3722.312) * (-3728.121) [-3724.070] (-3731.620) (-3720.053) -- 0:02:22 Average standard deviation of split frequencies: 0.000000 500500 -- (-3725.934) [-3721.767] (-3721.442) (-3730.107) * (-3723.706) (-3726.437) (-3733.879) [-3719.740] -- 0:02:21 501000 -- (-3725.782) (-3727.279) [-3721.329] (-3722.165) * (-3727.046) (-3725.234) (-3737.179) [-3722.116] -- 0:02:21 501500 -- (-3721.892) [-3717.498] (-3721.994) (-3725.216) * [-3719.145] (-3722.365) (-3727.490) (-3719.603) -- 0:02:22 502000 -- (-3717.080) (-3717.733) [-3723.364] (-3723.934) * (-3721.729) [-3718.554] (-3723.799) (-3722.283) -- 0:02:21 502500 -- (-3721.768) (-3730.354) [-3722.561] (-3720.891) * (-3722.472) (-3722.733) (-3727.928) [-3720.276] -- 0:02:21 503000 -- (-3721.966) (-3721.212) (-3723.342) [-3721.655] * [-3724.457] (-3721.412) (-3722.017) (-3722.837) -- 0:02:21 503500 -- (-3729.519) (-3723.758) (-3721.066) [-3720.825] * [-3715.589] (-3724.497) (-3725.102) (-3723.215) -- 0:02:21 504000 -- (-3721.932) (-3725.786) [-3720.719] (-3722.688) * [-3720.071] (-3722.003) (-3723.611) (-3726.043) -- 0:02:20 504500 -- (-3722.603) (-3720.469) [-3724.775] (-3723.267) * (-3724.885) [-3722.306] (-3722.612) (-3725.284) -- 0:02:20 505000 -- (-3724.790) [-3727.939] (-3728.739) (-3721.290) * [-3726.946] (-3723.084) (-3722.629) (-3722.668) -- 0:02:21 Average standard deviation of split frequencies: 0.000000 505500 -- (-3725.087) [-3720.323] (-3722.067) (-3719.206) * (-3724.145) (-3724.056) (-3721.934) [-3723.605] -- 0:02:20 506000 -- (-3722.176) [-3718.010] (-3724.440) (-3720.283) * (-3721.299) (-3723.359) [-3723.071] (-3720.844) -- 0:02:20 506500 -- (-3722.571) (-3724.132) (-3725.846) [-3723.418] * [-3718.106] (-3731.226) (-3719.519) (-3720.408) -- 0:02:20 507000 -- (-3728.315) (-3724.757) [-3723.003] (-3725.907) * (-3721.577) (-3725.394) (-3730.028) [-3720.878] -- 0:02:20 507500 -- [-3726.524] (-3722.656) (-3725.895) (-3721.690) * (-3718.277) (-3729.697) [-3727.922] (-3725.861) -- 0:02:20 508000 -- (-3731.213) [-3723.762] (-3723.141) (-3722.080) * [-3717.649] (-3726.066) (-3718.214) (-3726.274) -- 0:02:20 508500 -- (-3722.491) (-3719.963) (-3722.609) [-3724.666] * (-3721.944) [-3721.373] (-3721.868) (-3719.876) -- 0:02:20 509000 -- (-3720.705) (-3726.784) (-3730.499) [-3725.443] * (-3723.626) (-3720.537) (-3733.981) [-3720.551] -- 0:02:19 509500 -- [-3722.287] (-3726.386) (-3728.944) (-3723.803) * [-3718.262] (-3723.581) (-3727.141) (-3727.613) -- 0:02:19 510000 -- (-3719.520) (-3730.610) [-3730.145] (-3729.657) * (-3721.855) (-3725.616) [-3720.574] (-3722.264) -- 0:02:19 Average standard deviation of split frequencies: 0.000000 510500 -- (-3722.114) [-3720.120] (-3724.061) (-3723.418) * (-3720.587) (-3724.055) [-3719.299] (-3719.439) -- 0:02:19 511000 -- (-3722.236) (-3720.455) (-3730.607) [-3716.594] * (-3731.865) (-3733.848) [-3720.388] (-3719.793) -- 0:02:18 511500 -- [-3728.080] (-3718.582) (-3722.698) (-3724.808) * (-3727.100) [-3728.935] (-3723.941) (-3720.532) -- 0:02:19 512000 -- (-3718.941) (-3720.520) [-3721.259] (-3724.008) * (-3725.315) (-3726.415) (-3721.530) [-3721.572] -- 0:02:19 512500 -- [-3722.307] (-3721.672) (-3719.102) (-3728.670) * (-3729.607) (-3723.625) [-3723.859] (-3721.946) -- 0:02:18 513000 -- (-3720.759) [-3717.055] (-3723.735) (-3719.129) * [-3722.068] (-3724.077) (-3721.036) (-3720.646) -- 0:02:18 513500 -- (-3716.447) (-3722.462) [-3719.293] (-3722.942) * (-3729.156) (-3723.416) [-3717.621] (-3723.438) -- 0:02:18 514000 -- (-3729.086) (-3725.984) (-3721.016) [-3722.090] * (-3731.508) (-3730.023) (-3721.894) [-3722.590] -- 0:02:18 514500 -- (-3723.223) (-3724.018) [-3716.504] (-3727.576) * (-3729.621) (-3726.683) (-3716.608) [-3721.839] -- 0:02:17 515000 -- [-3726.974] (-3725.602) (-3723.160) (-3717.853) * (-3720.770) (-3721.779) (-3726.204) [-3717.690] -- 0:02:18 Average standard deviation of split frequencies: 0.000000 515500 -- (-3725.757) (-3729.766) (-3725.945) [-3720.593] * [-3726.243] (-3721.604) (-3724.348) (-3721.512) -- 0:02:18 516000 -- (-3721.551) (-3725.636) (-3732.857) [-3722.015] * [-3718.390] (-3720.148) (-3730.474) (-3718.502) -- 0:02:17 516500 -- (-3727.986) [-3725.747] (-3728.658) (-3724.448) * (-3721.033) [-3716.754] (-3724.650) (-3731.068) -- 0:02:17 517000 -- (-3723.667) (-3719.544) [-3726.175] (-3730.470) * (-3719.400) (-3722.552) [-3719.944] (-3720.690) -- 0:02:17 517500 -- (-3720.592) [-3725.126] (-3721.467) (-3724.346) * (-3720.837) (-3725.858) (-3726.872) [-3721.035] -- 0:02:17 518000 -- (-3719.606) [-3725.794] (-3726.870) (-3723.832) * (-3724.394) (-3733.800) (-3720.723) [-3717.149] -- 0:02:16 518500 -- [-3721.234] (-3719.076) (-3724.681) (-3733.702) * (-3721.988) [-3728.541] (-3726.140) (-3723.016) -- 0:02:17 519000 -- [-3724.950] (-3722.168) (-3725.855) (-3729.328) * (-3718.804) (-3724.234) [-3726.854] (-3722.460) -- 0:02:17 519500 -- (-3722.758) (-3727.471) (-3720.008) [-3727.896] * (-3720.761) [-3727.360] (-3723.563) (-3723.546) -- 0:02:16 520000 -- [-3723.076] (-3724.399) (-3722.331) (-3728.894) * (-3723.331) (-3725.755) [-3719.996] (-3724.579) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 520500 -- [-3723.104] (-3727.995) (-3720.290) (-3724.851) * (-3725.543) (-3725.043) [-3729.789] (-3724.064) -- 0:02:16 521000 -- (-3724.531) [-3730.879] (-3721.383) (-3728.526) * (-3722.757) (-3729.413) (-3723.071) [-3724.050] -- 0:02:16 521500 -- (-3723.634) (-3723.301) (-3723.368) [-3723.315] * [-3725.233] (-3731.232) (-3717.745) (-3725.846) -- 0:02:15 522000 -- (-3725.151) [-3719.242] (-3722.948) (-3718.487) * (-3725.073) (-3727.475) (-3721.471) [-3719.266] -- 0:02:16 522500 -- (-3723.166) [-3721.841] (-3725.872) (-3727.234) * (-3724.047) [-3727.531] (-3720.101) (-3719.936) -- 0:02:16 523000 -- (-3721.410) (-3719.706) (-3724.496) [-3726.109] * (-3726.533) [-3724.185] (-3717.184) (-3723.583) -- 0:02:15 523500 -- (-3720.564) [-3719.578] (-3722.480) (-3720.705) * (-3720.187) [-3717.481] (-3723.857) (-3730.808) -- 0:02:15 524000 -- (-3729.614) (-3725.289) [-3718.878] (-3723.351) * [-3718.842] (-3719.791) (-3720.488) (-3724.453) -- 0:02:15 524500 -- [-3720.597] (-3722.069) (-3721.283) (-3720.158) * (-3723.284) (-3722.386) (-3721.442) [-3723.464] -- 0:02:15 525000 -- (-3727.925) [-3722.001] (-3726.190) (-3725.829) * (-3725.425) (-3725.884) (-3719.287) [-3725.298] -- 0:02:14 Average standard deviation of split frequencies: 0.000000 525500 -- [-3721.812] (-3720.657) (-3718.668) (-3733.061) * [-3721.197] (-3719.241) (-3725.914) (-3732.363) -- 0:02:15 526000 -- (-3727.335) [-3723.034] (-3721.998) (-3725.965) * (-3728.087) [-3716.527] (-3721.575) (-3724.295) -- 0:02:15 526500 -- (-3722.177) (-3724.357) (-3725.015) [-3724.596] * (-3723.151) (-3720.113) (-3717.742) [-3725.453] -- 0:02:14 527000 -- (-3724.613) (-3719.863) [-3721.547] (-3725.467) * [-3723.276] (-3727.672) (-3721.850) (-3726.672) -- 0:02:14 527500 -- (-3720.564) (-3720.142) (-3719.404) [-3719.435] * [-3720.279] (-3722.691) (-3726.579) (-3734.024) -- 0:02:14 528000 -- (-3722.403) (-3725.310) [-3720.524] (-3718.856) * [-3720.034] (-3717.652) (-3722.164) (-3724.437) -- 0:02:14 528500 -- (-3723.050) (-3729.425) (-3722.650) [-3717.760] * [-3720.630] (-3720.057) (-3723.323) (-3724.216) -- 0:02:13 529000 -- [-3718.558] (-3725.330) (-3720.874) (-3724.447) * (-3733.663) [-3723.762] (-3725.550) (-3726.887) -- 0:02:13 529500 -- (-3720.189) (-3725.346) [-3719.170] (-3718.982) * [-3722.253] (-3724.232) (-3722.433) (-3724.042) -- 0:02:14 530000 -- (-3721.496) [-3721.642] (-3724.758) (-3726.231) * (-3727.484) [-3718.597] (-3718.919) (-3723.709) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 530500 -- (-3724.213) [-3719.993] (-3723.207) (-3721.682) * [-3722.953] (-3721.875) (-3721.996) (-3721.594) -- 0:02:13 531000 -- (-3720.526) (-3724.039) (-3720.944) [-3723.222] * (-3726.417) (-3722.084) [-3719.019] (-3720.012) -- 0:02:13 531500 -- (-3727.269) (-3724.530) (-3727.318) [-3732.340] * (-3721.077) (-3722.913) (-3720.385) [-3722.297] -- 0:02:13 532000 -- (-3725.470) (-3726.146) [-3723.343] (-3724.494) * (-3729.272) (-3719.544) [-3723.112] (-3729.154) -- 0:02:12 532500 -- [-3721.281] (-3727.317) (-3721.021) (-3729.315) * (-3731.742) (-3721.825) (-3727.421) [-3722.093] -- 0:02:12 533000 -- (-3724.092) [-3731.335] (-3722.920) (-3724.133) * (-3724.428) (-3723.778) (-3723.684) [-3725.221] -- 0:02:13 533500 -- (-3719.007) (-3721.662) (-3725.544) [-3718.891] * (-3723.937) (-3722.390) (-3718.061) [-3723.220] -- 0:02:12 534000 -- (-3721.179) [-3724.563] (-3725.610) (-3718.725) * [-3722.016] (-3727.945) (-3719.655) (-3720.481) -- 0:02:12 534500 -- (-3722.053) (-3725.082) (-3723.314) [-3722.092] * [-3721.874] (-3725.694) (-3718.202) (-3727.102) -- 0:02:12 535000 -- (-3724.164) (-3723.094) [-3723.208] (-3721.231) * (-3722.003) (-3721.869) [-3719.863] (-3730.988) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 535500 -- (-3720.384) (-3720.915) (-3724.132) [-3717.353] * [-3723.205] (-3723.966) (-3726.950) (-3733.407) -- 0:02:11 536000 -- (-3723.559) (-3725.312) [-3723.797] (-3723.716) * (-3727.420) (-3719.935) [-3726.518] (-3723.262) -- 0:02:11 536500 -- (-3721.844) (-3720.942) [-3726.714] (-3721.315) * [-3720.698] (-3722.320) (-3726.274) (-3723.390) -- 0:02:12 537000 -- (-3726.076) [-3719.881] (-3721.556) (-3722.346) * (-3722.659) [-3721.326] (-3723.688) (-3719.788) -- 0:02:11 537500 -- (-3725.801) [-3726.531] (-3721.536) (-3720.926) * (-3720.890) (-3720.912) [-3722.701] (-3721.568) -- 0:02:11 538000 -- (-3725.947) (-3729.362) [-3720.736] (-3721.221) * [-3727.038] (-3721.528) (-3725.752) (-3723.610) -- 0:02:11 538500 -- (-3724.154) (-3722.868) (-3722.615) [-3723.438] * (-3725.598) (-3727.520) [-3726.912] (-3721.666) -- 0:02:11 539000 -- [-3723.002] (-3723.682) (-3720.291) (-3720.855) * (-3725.806) (-3722.632) (-3729.180) [-3720.102] -- 0:02:10 539500 -- [-3725.238] (-3724.924) (-3719.454) (-3721.519) * (-3720.747) (-3722.186) [-3720.629] (-3722.241) -- 0:02:10 540000 -- (-3721.973) (-3725.981) [-3716.493] (-3729.026) * [-3724.538] (-3728.010) (-3724.400) (-3723.616) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 540500 -- (-3720.319) (-3720.119) (-3729.539) [-3720.629] * (-3727.311) (-3724.637) [-3722.216] (-3720.960) -- 0:02:10 541000 -- (-3722.167) (-3726.740) [-3721.174] (-3725.296) * (-3725.762) (-3722.522) [-3719.458] (-3719.559) -- 0:02:10 541500 -- (-3722.820) (-3719.574) [-3725.642] (-3729.766) * [-3730.901] (-3727.262) (-3721.916) (-3724.468) -- 0:02:10 542000 -- [-3726.123] (-3722.032) (-3724.226) (-3728.521) * (-3730.652) (-3724.003) (-3723.183) [-3725.891] -- 0:02:10 542500 -- [-3718.960] (-3718.337) (-3724.471) (-3722.704) * (-3724.823) [-3722.368] (-3723.817) (-3723.970) -- 0:02:09 543000 -- (-3726.203) (-3722.980) [-3722.363] (-3731.310) * (-3727.997) (-3726.050) [-3720.799] (-3725.200) -- 0:02:09 543500 -- (-3726.992) [-3720.627] (-3719.358) (-3727.289) * [-3724.944] (-3727.572) (-3726.752) (-3729.439) -- 0:02:10 544000 -- [-3723.829] (-3721.002) (-3719.964) (-3733.494) * (-3730.536) (-3729.574) [-3717.186] (-3722.051) -- 0:02:09 544500 -- (-3729.103) (-3721.354) (-3726.529) [-3720.762] * (-3725.195) (-3718.934) [-3724.173] (-3730.632) -- 0:02:09 545000 -- [-3722.266] (-3721.760) (-3722.485) (-3723.050) * (-3721.432) (-3726.727) [-3725.695] (-3725.342) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 545500 -- [-3721.527] (-3724.272) (-3723.483) (-3733.406) * (-3722.181) (-3725.327) [-3717.922] (-3725.744) -- 0:02:09 546000 -- [-3722.620] (-3726.492) (-3730.817) (-3725.545) * [-3720.489] (-3727.623) (-3725.651) (-3727.831) -- 0:02:08 546500 -- (-3728.566) [-3721.398] (-3724.143) (-3728.538) * (-3730.330) [-3724.238] (-3723.892) (-3723.447) -- 0:02:08 547000 -- (-3731.948) (-3721.771) [-3725.261] (-3719.370) * (-3721.457) (-3727.278) (-3724.290) [-3723.252] -- 0:02:09 547500 -- (-3723.236) (-3740.410) [-3724.426] (-3719.412) * (-3728.268) [-3722.496] (-3728.963) (-3723.849) -- 0:02:08 548000 -- [-3722.148] (-3722.883) (-3723.282) (-3726.756) * (-3731.321) (-3719.812) (-3731.696) [-3724.660] -- 0:02:08 548500 -- (-3721.256) (-3723.286) (-3729.480) [-3722.172] * (-3718.451) (-3722.627) [-3723.442] (-3721.764) -- 0:02:08 549000 -- (-3720.843) (-3727.123) (-3725.493) [-3722.498] * [-3722.774] (-3719.074) (-3723.921) (-3719.882) -- 0:02:08 549500 -- [-3725.219] (-3727.513) (-3718.962) (-3727.503) * (-3722.520) (-3718.217) [-3724.244] (-3725.125) -- 0:02:07 550000 -- (-3722.039) [-3720.357] (-3720.284) (-3725.489) * [-3723.410] (-3720.856) (-3721.532) (-3732.740) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 550500 -- [-3723.768] (-3722.357) (-3719.887) (-3724.396) * [-3722.813] (-3723.542) (-3723.442) (-3725.331) -- 0:02:07 551000 -- [-3725.281] (-3720.027) (-3726.898) (-3721.768) * [-3722.672] (-3723.791) (-3718.770) (-3732.035) -- 0:02:07 551500 -- (-3722.270) [-3717.436] (-3730.413) (-3722.856) * (-3718.962) (-3720.333) [-3720.039] (-3726.607) -- 0:02:07 552000 -- (-3723.342) [-3722.421] (-3724.031) (-3720.455) * (-3725.238) [-3717.521] (-3721.543) (-3728.652) -- 0:02:07 552500 -- (-3721.588) (-3717.806) (-3727.049) [-3717.291] * (-3722.106) (-3722.528) [-3718.351] (-3731.800) -- 0:02:07 553000 -- (-3718.265) [-3725.678] (-3728.795) (-3723.149) * (-3721.158) (-3726.928) (-3723.214) [-3725.608] -- 0:02:06 553500 -- (-3724.760) (-3720.291) (-3720.007) [-3725.232] * (-3720.421) (-3729.758) (-3726.099) [-3721.551] -- 0:02:06 554000 -- [-3719.810] (-3721.072) (-3719.428) (-3720.342) * [-3724.986] (-3730.895) (-3720.789) (-3725.774) -- 0:02:06 554500 -- (-3720.020) [-3718.140] (-3721.618) (-3720.951) * [-3719.205] (-3722.154) (-3726.637) (-3727.878) -- 0:02:06 555000 -- (-3724.512) (-3725.634) (-3728.122) [-3719.754] * (-3722.331) [-3721.632] (-3721.778) (-3729.035) -- 0:02:06 Average standard deviation of split frequencies: 0.000000 555500 -- (-3730.744) (-3719.688) [-3722.113] (-3734.492) * (-3726.192) (-3718.881) [-3719.946] (-3721.097) -- 0:02:06 556000 -- (-3726.259) (-3724.869) (-3728.164) [-3717.972] * (-3723.632) (-3720.426) (-3721.138) [-3719.483] -- 0:02:06 556500 -- [-3718.685] (-3723.620) (-3721.765) (-3720.591) * (-3726.353) (-3721.851) [-3717.579] (-3719.261) -- 0:02:05 557000 -- (-3719.990) (-3724.771) (-3722.978) [-3720.232] * (-3722.236) [-3718.263] (-3723.872) (-3725.342) -- 0:02:05 557500 -- (-3725.236) [-3733.341] (-3720.934) (-3721.586) * [-3722.373] (-3720.191) (-3727.139) (-3728.936) -- 0:02:05 558000 -- (-3722.675) (-3723.997) [-3723.605] (-3725.929) * (-3724.408) (-3722.812) (-3727.053) [-3721.384] -- 0:02:05 558500 -- (-3724.244) (-3720.655) (-3721.892) [-3721.859] * (-3727.187) (-3723.172) [-3718.698] (-3726.377) -- 0:02:05 559000 -- (-3728.390) (-3723.469) [-3727.123] (-3718.778) * [-3724.082] (-3724.065) (-3722.765) (-3723.483) -- 0:02:05 559500 -- (-3721.206) [-3718.971] (-3726.298) (-3723.109) * (-3731.874) [-3721.723] (-3718.864) (-3722.295) -- 0:02:05 560000 -- (-3723.934) (-3718.642) [-3725.984] (-3727.700) * (-3724.323) (-3718.661) [-3729.377] (-3726.610) -- 0:02:04 Average standard deviation of split frequencies: 0.000000 560500 -- (-3721.700) (-3728.100) [-3721.420] (-3726.218) * (-3723.354) [-3718.672] (-3730.184) (-3724.328) -- 0:02:04 561000 -- (-3723.823) (-3723.714) [-3724.613] (-3728.844) * (-3722.825) [-3723.703] (-3726.120) (-3724.608) -- 0:02:04 561500 -- (-3720.724) [-3723.933] (-3730.901) (-3729.413) * [-3717.693] (-3722.535) (-3727.033) (-3722.181) -- 0:02:04 562000 -- (-3719.584) [-3721.311] (-3721.826) (-3735.772) * [-3721.443] (-3723.509) (-3726.244) (-3718.613) -- 0:02:04 562500 -- (-3726.463) (-3719.832) (-3729.102) [-3727.964] * (-3723.947) (-3725.103) (-3720.471) [-3717.661] -- 0:02:04 563000 -- (-3722.170) (-3718.883) [-3722.999] (-3730.397) * [-3719.243] (-3724.938) (-3731.804) (-3722.659) -- 0:02:04 563500 -- (-3719.993) (-3722.948) (-3723.448) [-3719.584] * (-3722.589) [-3718.171] (-3722.654) (-3729.649) -- 0:02:03 564000 -- (-3723.116) (-3725.044) (-3725.040) [-3718.611] * [-3730.237] (-3720.751) (-3720.786) (-3721.421) -- 0:02:03 564500 -- (-3716.636) (-3721.916) [-3721.979] (-3721.763) * (-3727.888) (-3722.320) (-3720.043) [-3725.328] -- 0:02:03 565000 -- (-3721.435) (-3722.333) [-3721.997] (-3726.509) * [-3721.641] (-3720.085) (-3724.266) (-3721.545) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 565500 -- [-3719.235] (-3722.834) (-3719.348) (-3728.928) * (-3732.318) (-3725.864) (-3724.562) [-3726.600] -- 0:02:03 566000 -- (-3720.507) (-3723.349) [-3719.989] (-3723.901) * (-3723.522) [-3723.388] (-3721.035) (-3721.015) -- 0:02:03 566500 -- [-3725.184] (-3721.894) (-3721.882) (-3721.103) * (-3728.711) (-3720.352) (-3724.106) [-3721.680] -- 0:02:03 567000 -- (-3724.300) [-3724.210] (-3725.283) (-3721.804) * [-3726.263] (-3719.022) (-3734.902) (-3728.760) -- 0:02:02 567500 -- [-3723.870] (-3723.703) (-3724.336) (-3724.049) * (-3718.491) [-3717.875] (-3726.490) (-3730.622) -- 0:02:02 568000 -- (-3729.223) (-3719.890) (-3728.932) [-3723.951] * (-3726.517) [-3720.787] (-3724.701) (-3724.488) -- 0:02:02 568500 -- [-3719.732] (-3722.467) (-3727.177) (-3725.397) * (-3719.492) (-3723.658) (-3723.770) [-3724.806] -- 0:02:02 569000 -- (-3718.236) (-3719.344) (-3721.379) [-3720.657] * (-3723.142) (-3720.283) (-3722.311) [-3727.908] -- 0:02:02 569500 -- (-3725.050) (-3721.573) (-3728.077) [-3722.149] * (-3725.855) (-3724.246) [-3722.403] (-3721.595) -- 0:02:02 570000 -- (-3722.187) (-3720.696) [-3718.996] (-3726.983) * [-3719.630] (-3720.713) (-3728.780) (-3724.777) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 570500 -- [-3725.010] (-3732.390) (-3717.970) (-3725.282) * [-3719.795] (-3723.166) (-3724.372) (-3726.367) -- 0:02:01 571000 -- (-3726.697) (-3725.456) (-3721.811) [-3719.515] * [-3719.566] (-3721.113) (-3723.620) (-3729.409) -- 0:02:01 571500 -- (-3727.593) (-3718.489) (-3724.014) [-3720.125] * (-3719.278) (-3729.502) [-3720.790] (-3727.651) -- 0:02:01 572000 -- [-3719.808] (-3721.121) (-3721.309) (-3721.983) * [-3720.449] (-3720.929) (-3728.735) (-3725.150) -- 0:02:01 572500 -- (-3729.038) (-3721.744) [-3725.543] (-3719.403) * (-3720.069) (-3726.663) [-3720.446] (-3723.837) -- 0:02:01 573000 -- (-3723.905) (-3720.926) [-3723.315] (-3718.538) * (-3724.625) [-3719.687] (-3722.672) (-3720.734) -- 0:02:01 573500 -- [-3722.828] (-3722.761) (-3730.871) (-3725.790) * (-3722.627) [-3726.800] (-3719.713) (-3726.889) -- 0:02:01 574000 -- (-3725.492) (-3722.127) [-3726.666] (-3724.185) * [-3725.599] (-3723.481) (-3722.602) (-3720.773) -- 0:02:00 574500 -- (-3723.520) [-3722.755] (-3736.339) (-3720.797) * (-3724.011) (-3721.236) (-3719.617) [-3721.793] -- 0:02:00 575000 -- (-3723.778) (-3721.046) [-3723.555] (-3720.962) * (-3734.294) (-3726.099) [-3728.743] (-3717.818) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 575500 -- (-3720.573) [-3721.829] (-3723.906) (-3725.730) * (-3727.078) (-3718.499) (-3729.887) [-3721.854] -- 0:02:00 576000 -- (-3722.156) [-3719.148] (-3725.837) (-3720.974) * (-3722.978) (-3722.083) [-3719.051] (-3725.326) -- 0:02:00 576500 -- (-3720.910) (-3726.311) (-3724.136) [-3721.051] * (-3721.410) (-3731.461) (-3727.430) [-3727.115] -- 0:02:00 577000 -- [-3721.629] (-3721.778) (-3726.082) (-3728.079) * [-3724.068] (-3728.954) (-3725.101) (-3724.729) -- 0:02:00 577500 -- (-3725.083) [-3723.776] (-3724.076) (-3726.011) * (-3719.412) (-3719.407) [-3720.430] (-3725.948) -- 0:01:59 578000 -- [-3721.152] (-3726.806) (-3719.988) (-3728.171) * [-3716.950] (-3722.148) (-3719.663) (-3727.241) -- 0:01:59 578500 -- [-3720.273] (-3722.473) (-3730.623) (-3730.982) * (-3720.336) (-3729.835) (-3726.294) [-3721.483] -- 0:01:59 579000 -- (-3725.841) [-3719.806] (-3727.164) (-3722.938) * [-3718.465] (-3724.076) (-3725.004) (-3723.143) -- 0:01:59 579500 -- (-3725.193) (-3723.211) [-3721.996] (-3725.108) * [-3727.675] (-3723.803) (-3723.119) (-3720.893) -- 0:01:59 580000 -- (-3726.528) (-3726.514) (-3722.423) [-3722.160] * (-3728.753) (-3726.549) (-3721.279) [-3725.534] -- 0:01:59 Average standard deviation of split frequencies: 0.000000 580500 -- (-3718.729) (-3726.694) (-3722.715) [-3722.740] * (-3729.118) [-3725.217] (-3720.535) (-3729.194) -- 0:01:59 581000 -- [-3720.211] (-3724.647) (-3718.690) (-3720.531) * (-3727.042) (-3726.013) [-3720.136] (-3722.814) -- 0:01:58 581500 -- [-3725.447] (-3724.087) (-3728.022) (-3721.473) * [-3724.500] (-3723.690) (-3725.856) (-3720.186) -- 0:01:58 582000 -- (-3722.512) (-3729.014) (-3725.856) [-3720.627] * (-3722.737) [-3722.972] (-3725.528) (-3720.013) -- 0:01:58 582500 -- [-3721.620] (-3726.655) (-3724.570) (-3723.419) * (-3734.316) (-3720.550) (-3720.993) [-3723.813] -- 0:01:58 583000 -- (-3722.631) (-3720.501) (-3717.838) [-3725.541] * (-3721.249) (-3725.309) (-3719.441) [-3723.027] -- 0:01:58 583500 -- [-3720.292] (-3726.059) (-3724.351) (-3723.795) * (-3722.374) [-3724.508] (-3729.262) (-3723.013) -- 0:01:58 584000 -- (-3720.552) (-3722.149) [-3722.803] (-3727.405) * [-3722.650] (-3719.295) (-3727.536) (-3722.062) -- 0:01:58 584500 -- (-3725.985) [-3720.784] (-3719.027) (-3723.381) * (-3717.869) (-3727.372) (-3725.902) [-3720.719] -- 0:01:58 585000 -- (-3725.328) [-3717.150] (-3724.573) (-3723.362) * (-3721.510) (-3723.836) [-3726.663] (-3725.819) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 585500 -- (-3724.090) [-3722.831] (-3723.114) (-3722.597) * [-3726.055] (-3721.360) (-3722.988) (-3717.643) -- 0:01:57 586000 -- (-3721.026) [-3722.152] (-3721.374) (-3719.395) * (-3727.485) (-3719.903) (-3718.774) [-3717.952] -- 0:01:57 586500 -- [-3717.456] (-3718.973) (-3720.652) (-3727.024) * (-3732.633) (-3725.608) [-3718.898] (-3722.450) -- 0:01:57 587000 -- (-3723.542) (-3725.174) (-3720.191) [-3728.009] * [-3724.462] (-3724.292) (-3724.845) (-3727.016) -- 0:01:57 587500 -- (-3721.857) (-3726.019) [-3721.648] (-3727.208) * (-3730.181) (-3725.925) (-3727.644) [-3719.652] -- 0:01:57 588000 -- (-3723.766) (-3724.209) [-3719.754] (-3726.701) * (-3726.394) (-3723.507) [-3724.427] (-3718.663) -- 0:01:57 588500 -- (-3719.093) [-3719.801] (-3721.495) (-3730.159) * (-3726.900) (-3721.284) (-3721.716) [-3726.802] -- 0:01:56 589000 -- [-3723.527] (-3726.410) (-3724.681) (-3723.685) * (-3729.037) (-3722.694) (-3720.769) [-3724.270] -- 0:01:56 589500 -- (-3723.334) (-3733.895) [-3721.464] (-3726.041) * (-3724.917) (-3721.696) (-3720.750) [-3719.093] -- 0:01:56 590000 -- (-3725.870) [-3719.611] (-3721.958) (-3724.535) * (-3725.749) [-3721.140] (-3728.570) (-3723.212) -- 0:01:56 Average standard deviation of split frequencies: 0.000000 590500 -- (-3724.164) (-3723.298) [-3724.465] (-3721.296) * (-3728.494) [-3723.794] (-3719.193) (-3719.955) -- 0:01:56 591000 -- (-3726.805) (-3726.509) (-3721.821) [-3722.315] * (-3720.365) (-3718.861) [-3727.019] (-3722.882) -- 0:01:56 591500 -- (-3725.281) (-3729.812) [-3719.237] (-3721.190) * (-3725.763) (-3719.601) [-3722.271] (-3726.508) -- 0:01:56 592000 -- (-3730.052) (-3720.404) (-3722.272) [-3725.546] * (-3719.631) (-3727.673) (-3726.144) [-3719.810] -- 0:01:55 592500 -- (-3732.877) (-3723.061) (-3719.191) [-3723.162] * [-3720.987] (-3725.692) (-3720.542) (-3724.487) -- 0:01:55 593000 -- (-3731.428) (-3724.662) [-3720.770] (-3724.102) * (-3722.764) [-3721.154] (-3722.277) (-3718.922) -- 0:01:55 593500 -- [-3724.682] (-3722.824) (-3718.222) (-3725.801) * [-3726.207] (-3726.481) (-3729.011) (-3725.278) -- 0:01:55 594000 -- (-3727.376) (-3727.181) [-3723.537] (-3723.436) * (-3729.907) (-3724.822) (-3724.296) [-3718.041] -- 0:01:55 594500 -- (-3723.668) (-3730.934) (-3721.738) [-3726.771] * (-3735.151) (-3727.059) (-3722.522) [-3724.339] -- 0:01:55 595000 -- (-3724.343) [-3725.848] (-3723.763) (-3727.012) * (-3726.581) (-3722.133) [-3723.248] (-3729.479) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 595500 -- (-3721.455) (-3725.610) (-3726.743) [-3722.621] * (-3726.051) [-3723.143] (-3723.022) (-3734.974) -- 0:01:54 596000 -- (-3721.077) [-3722.608] (-3723.540) (-3726.171) * (-3720.620) [-3721.697] (-3725.544) (-3727.838) -- 0:01:54 596500 -- (-3723.209) (-3723.086) [-3721.414] (-3724.524) * [-3718.929] (-3725.516) (-3724.381) (-3723.665) -- 0:01:54 597000 -- [-3723.674] (-3719.184) (-3718.029) (-3719.191) * (-3727.429) (-3719.400) (-3723.516) [-3721.420] -- 0:01:54 597500 -- (-3723.949) (-3723.313) (-3722.971) [-3723.252] * (-3719.910) [-3727.054] (-3718.976) (-3728.552) -- 0:01:54 598000 -- (-3724.228) (-3721.986) (-3722.122) [-3722.453] * [-3723.016] (-3727.088) (-3724.655) (-3722.174) -- 0:01:54 598500 -- (-3722.189) (-3722.050) [-3730.669] (-3720.978) * (-3728.006) (-3721.728) [-3718.448] (-3721.028) -- 0:01:54 599000 -- (-3720.519) [-3720.902] (-3723.256) (-3727.867) * (-3725.152) (-3721.963) [-3721.588] (-3726.537) -- 0:01:53 599500 -- (-3721.937) (-3723.982) (-3725.221) [-3723.318] * (-3726.957) (-3732.419) (-3722.615) [-3718.799] -- 0:01:53 600000 -- (-3727.554) (-3721.357) [-3719.547] (-3722.390) * (-3728.171) [-3723.073] (-3721.368) (-3724.963) -- 0:01:53 Average standard deviation of split frequencies: 0.000000 600500 -- [-3717.690] (-3725.466) (-3722.561) (-3721.050) * [-3720.850] (-3718.691) (-3724.804) (-3729.890) -- 0:01:53 601000 -- [-3724.806] (-3721.838) (-3721.007) (-3724.214) * [-3716.261] (-3722.175) (-3724.382) (-3726.949) -- 0:01:53 601500 -- [-3722.744] (-3725.865) (-3723.277) (-3723.785) * (-3727.211) [-3720.254] (-3719.399) (-3725.463) -- 0:01:53 602000 -- (-3725.667) [-3719.386] (-3724.353) (-3726.192) * (-3722.530) [-3721.132] (-3726.095) (-3722.188) -- 0:01:53 602500 -- (-3722.897) (-3722.089) [-3726.699] (-3728.420) * [-3724.832] (-3730.291) (-3729.093) (-3723.008) -- 0:01:52 603000 -- (-3717.895) (-3727.586) [-3721.064] (-3728.145) * (-3723.115) (-3723.357) (-3721.379) [-3727.103] -- 0:01:52 603500 -- (-3723.145) [-3720.822] (-3723.805) (-3722.660) * [-3718.523] (-3718.802) (-3724.828) (-3722.764) -- 0:01:52 604000 -- (-3724.506) (-3723.400) [-3718.534] (-3721.679) * (-3722.193) (-3721.852) [-3720.190] (-3724.401) -- 0:01:52 604500 -- [-3719.140] (-3724.115) (-3721.815) (-3728.558) * (-3722.747) [-3728.108] (-3720.605) (-3722.496) -- 0:01:52 605000 -- (-3721.171) [-3718.880] (-3719.614) (-3732.509) * (-3725.421) [-3732.707] (-3720.001) (-3725.556) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 605500 -- [-3721.813] (-3723.933) (-3720.431) (-3728.267) * (-3722.322) (-3725.875) [-3722.685] (-3720.363) -- 0:01:52 606000 -- (-3728.550) [-3721.809] (-3719.103) (-3728.694) * [-3720.053] (-3724.695) (-3723.693) (-3722.341) -- 0:01:51 606500 -- (-3720.998) [-3716.834] (-3718.516) (-3729.205) * (-3718.316) (-3724.453) [-3723.466] (-3727.480) -- 0:01:51 607000 -- (-3727.719) [-3720.737] (-3720.523) (-3728.803) * (-3721.360) (-3726.973) (-3718.639) [-3720.471] -- 0:01:51 607500 -- [-3724.705] (-3729.336) (-3725.549) (-3732.834) * (-3721.070) [-3723.237] (-3723.136) (-3722.690) -- 0:01:51 608000 -- (-3722.551) (-3724.717) (-3721.915) [-3722.706] * (-3721.165) [-3722.862] (-3728.788) (-3716.388) -- 0:01:50 608500 -- (-3728.561) [-3718.287] (-3725.015) (-3726.753) * (-3720.700) [-3724.552] (-3722.843) (-3719.994) -- 0:01:51 609000 -- (-3723.051) (-3723.434) [-3724.870] (-3724.860) * (-3721.701) (-3725.890) [-3720.809] (-3726.854) -- 0:01:51 609500 -- (-3730.073) (-3722.295) (-3725.782) [-3722.147] * (-3728.266) (-3720.204) [-3721.648] (-3721.216) -- 0:01:50 610000 -- [-3723.157] (-3725.098) (-3721.457) (-3722.908) * (-3723.162) [-3723.925] (-3718.776) (-3726.372) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 610500 -- [-3731.246] (-3724.889) (-3731.609) (-3719.137) * (-3727.369) [-3721.487] (-3722.141) (-3722.665) -- 0:01:50 611000 -- (-3722.938) (-3724.892) (-3723.494) [-3723.368] * (-3726.326) [-3723.023] (-3721.769) (-3720.519) -- 0:01:50 611500 -- (-3723.628) (-3721.174) (-3722.621) [-3720.583] * (-3718.787) [-3724.985] (-3720.462) (-3723.375) -- 0:01:49 612000 -- [-3721.079] (-3720.621) (-3721.786) (-3724.074) * (-3722.739) (-3728.822) (-3720.965) [-3722.920] -- 0:01:50 612500 -- (-3725.876) [-3724.985] (-3725.162) (-3722.013) * (-3721.798) (-3730.867) (-3724.322) [-3719.862] -- 0:01:50 613000 -- (-3723.667) [-3721.028] (-3722.520) (-3725.879) * (-3723.904) [-3723.428] (-3725.957) (-3719.088) -- 0:01:49 613500 -- (-3722.609) (-3722.789) [-3719.887] (-3726.395) * (-3724.847) (-3721.636) (-3729.051) [-3720.689] -- 0:01:49 614000 -- (-3729.049) (-3720.879) [-3721.924] (-3738.872) * (-3727.524) (-3721.693) [-3722.224] (-3721.645) -- 0:01:49 614500 -- (-3727.920) (-3720.025) (-3719.412) [-3725.835] * (-3722.832) [-3717.797] (-3725.255) (-3727.190) -- 0:01:49 615000 -- [-3724.384] (-3719.633) (-3722.137) (-3725.488) * [-3727.389] (-3723.635) (-3724.486) (-3723.025) -- 0:01:48 Average standard deviation of split frequencies: 0.000000 615500 -- (-3719.652) (-3726.697) [-3721.585] (-3726.623) * (-3727.462) [-3720.185] (-3726.487) (-3725.718) -- 0:01:49 616000 -- (-3723.021) (-3721.799) (-3720.511) [-3720.687] * (-3720.051) (-3725.293) [-3720.003] (-3723.631) -- 0:01:49 616500 -- [-3718.655] (-3721.061) (-3729.224) (-3726.001) * [-3722.800] (-3725.284) (-3718.775) (-3722.097) -- 0:01:48 617000 -- (-3720.626) (-3727.829) (-3724.171) [-3724.773] * [-3723.777] (-3728.791) (-3718.679) (-3723.858) -- 0:01:48 617500 -- [-3719.322] (-3726.857) (-3723.358) (-3729.529) * (-3731.672) (-3719.830) (-3724.395) [-3717.500] -- 0:01:48 618000 -- (-3719.862) (-3728.186) (-3722.409) [-3722.891] * [-3723.785] (-3723.899) (-3720.058) (-3718.249) -- 0:01:48 618500 -- (-3723.420) [-3730.322] (-3726.527) (-3728.908) * (-3723.351) (-3723.030) (-3719.789) [-3721.795] -- 0:01:47 619000 -- (-3721.239) (-3726.601) [-3728.284] (-3723.486) * (-3724.486) [-3717.846] (-3719.817) (-3719.318) -- 0:01:48 619500 -- (-3727.064) (-3723.039) (-3721.441) [-3722.912] * [-3722.808] (-3719.592) (-3723.962) (-3720.584) -- 0:01:48 620000 -- [-3719.145] (-3722.780) (-3720.698) (-3719.740) * (-3722.351) (-3721.329) (-3729.041) [-3717.795] -- 0:01:47 Average standard deviation of split frequencies: 0.000000 620500 -- (-3724.956) (-3721.507) [-3721.801] (-3725.261) * (-3723.823) [-3720.432] (-3727.918) (-3725.400) -- 0:01:47 621000 -- (-3727.856) (-3718.733) [-3720.401] (-3723.375) * [-3723.539] (-3718.702) (-3720.972) (-3722.132) -- 0:01:47 621500 -- (-3723.488) (-3720.496) (-3725.608) [-3724.231] * (-3722.727) [-3716.559] (-3724.924) (-3724.468) -- 0:01:47 622000 -- (-3723.582) (-3720.295) (-3728.237) [-3722.557] * [-3723.538] (-3725.408) (-3724.491) (-3727.176) -- 0:01:47 622500 -- [-3727.590] (-3719.958) (-3722.829) (-3721.018) * (-3727.961) (-3721.897) (-3725.078) [-3722.679] -- 0:01:47 623000 -- (-3729.320) (-3724.652) [-3719.450] (-3721.947) * (-3717.736) [-3721.113] (-3719.351) (-3721.967) -- 0:01:47 623500 -- (-3725.367) [-3720.210] (-3729.640) (-3723.838) * (-3722.288) (-3722.768) (-3727.495) [-3722.454] -- 0:01:46 624000 -- (-3723.814) (-3722.662) [-3722.693] (-3719.852) * (-3721.765) [-3723.644] (-3723.352) (-3718.592) -- 0:01:46 624500 -- (-3723.458) (-3726.841) (-3730.303) [-3720.122] * (-3719.333) (-3721.011) (-3725.661) [-3721.634] -- 0:01:46 625000 -- (-3721.748) (-3722.321) (-3728.681) [-3719.511] * (-3720.549) [-3729.754] (-3718.690) (-3723.892) -- 0:01:46 Average standard deviation of split frequencies: 0.000000 625500 -- (-3723.225) [-3723.906] (-3726.067) (-3725.074) * [-3721.490] (-3741.505) (-3723.214) (-3718.495) -- 0:01:46 626000 -- [-3719.352] (-3724.060) (-3722.905) (-3724.814) * (-3721.901) [-3719.580] (-3727.344) (-3723.707) -- 0:01:46 626500 -- (-3721.074) (-3725.002) [-3718.345] (-3723.201) * (-3721.409) [-3721.701] (-3720.070) (-3724.615) -- 0:01:46 627000 -- (-3721.359) [-3721.550] (-3726.850) (-3722.064) * [-3721.687] (-3730.868) (-3722.861) (-3720.088) -- 0:01:45 627500 -- (-3722.230) (-3723.810) [-3720.544] (-3721.001) * (-3721.279) (-3721.771) [-3721.644] (-3723.540) -- 0:01:45 628000 -- [-3723.628] (-3723.314) (-3722.994) (-3724.121) * (-3723.411) (-3719.198) (-3726.162) [-3721.430] -- 0:01:45 628500 -- (-3727.441) (-3726.636) (-3721.723) [-3719.445] * (-3721.543) (-3721.752) (-3722.674) [-3720.848] -- 0:01:45 629000 -- (-3724.616) [-3723.403] (-3719.716) (-3725.022) * [-3723.844] (-3722.976) (-3718.378) (-3722.293) -- 0:01:44 629500 -- [-3725.387] (-3722.100) (-3722.321) (-3716.734) * (-3720.619) [-3725.583] (-3725.254) (-3721.479) -- 0:01:45 630000 -- (-3720.479) (-3721.946) (-3728.138) [-3722.653] * (-3722.721) [-3720.752] (-3727.187) (-3720.939) -- 0:01:45 Average standard deviation of split frequencies: 0.000000 630500 -- [-3723.225] (-3723.036) (-3719.598) (-3724.389) * (-3723.733) (-3723.600) (-3725.004) [-3722.613] -- 0:01:44 631000 -- (-3724.364) (-3721.890) [-3723.586] (-3718.034) * (-3720.850) (-3718.306) [-3720.643] (-3722.768) -- 0:01:44 631500 -- (-3727.055) (-3724.436) (-3720.731) [-3718.865] * (-3720.368) [-3723.478] (-3721.819) (-3721.942) -- 0:01:44 632000 -- (-3729.953) [-3719.906] (-3719.675) (-3722.203) * (-3724.062) (-3729.705) (-3722.002) [-3722.018] -- 0:01:44 632500 -- (-3720.179) [-3722.938] (-3728.518) (-3721.962) * (-3722.014) [-3727.382] (-3719.840) (-3726.227) -- 0:01:44 633000 -- (-3726.193) (-3722.034) [-3722.922] (-3722.704) * (-3722.967) [-3718.659] (-3731.224) (-3720.036) -- 0:01:44 633500 -- (-3730.542) (-3724.971) [-3724.684] (-3725.594) * (-3722.582) (-3723.572) [-3725.889] (-3721.753) -- 0:01:44 634000 -- (-3723.367) [-3723.910] (-3732.552) (-3721.303) * [-3727.843] (-3728.776) (-3726.701) (-3724.032) -- 0:01:43 634500 -- (-3728.077) (-3722.896) [-3721.505] (-3727.696) * (-3723.869) (-3723.895) [-3721.034] (-3725.421) -- 0:01:43 635000 -- (-3722.854) (-3726.737) (-3719.094) [-3727.047] * (-3718.734) (-3723.268) (-3725.843) [-3724.639] -- 0:01:43 Average standard deviation of split frequencies: 0.000000 635500 -- [-3721.032] (-3719.966) (-3725.422) (-3724.298) * (-3726.160) (-3730.719) [-3719.148] (-3720.685) -- 0:01:43 636000 -- (-3722.183) [-3724.027] (-3721.144) (-3725.367) * (-3735.806) [-3721.107] (-3722.781) (-3721.432) -- 0:01:43 636500 -- [-3719.605] (-3724.924) (-3718.189) (-3726.951) * (-3733.429) (-3720.471) [-3719.343] (-3720.863) -- 0:01:43 637000 -- (-3721.580) [-3722.748] (-3721.683) (-3723.935) * (-3717.893) (-3731.571) (-3720.447) [-3720.803] -- 0:01:43 637500 -- (-3724.990) [-3722.597] (-3719.242) (-3723.666) * (-3723.389) (-3733.629) (-3722.926) [-3723.180] -- 0:01:42 638000 -- (-3719.085) [-3721.594] (-3723.028) (-3728.618) * (-3721.915) [-3719.834] (-3722.515) (-3723.474) -- 0:01:42 638500 -- (-3724.284) (-3722.731) [-3719.851] (-3726.008) * (-3732.441) [-3720.061] (-3724.452) (-3727.203) -- 0:01:42 639000 -- (-3719.577) (-3725.294) [-3720.766] (-3722.110) * (-3727.019) [-3724.116] (-3720.788) (-3720.522) -- 0:01:42 639500 -- (-3727.755) (-3727.233) [-3721.214] (-3725.989) * [-3721.907] (-3722.575) (-3720.620) (-3720.345) -- 0:01:42 640000 -- (-3722.351) (-3727.249) (-3721.925) [-3727.448] * (-3720.296) (-3721.970) [-3721.288] (-3725.292) -- 0:01:42 Average standard deviation of split frequencies: 0.000000 640500 -- (-3724.570) [-3723.705] (-3729.192) (-3719.822) * (-3724.776) (-3722.257) (-3723.832) [-3722.606] -- 0:01:42 641000 -- (-3722.937) (-3721.332) (-3720.404) [-3719.316] * (-3729.864) [-3722.915] (-3719.918) (-3717.736) -- 0:01:41 641500 -- (-3729.828) (-3723.499) (-3718.654) [-3722.214] * (-3718.785) (-3722.602) [-3721.224] (-3722.594) -- 0:01:41 642000 -- (-3726.354) (-3722.873) [-3720.294] (-3722.993) * [-3719.822] (-3718.601) (-3718.400) (-3719.987) -- 0:01:41 642500 -- (-3721.682) (-3726.310) (-3723.063) [-3722.391] * (-3725.179) (-3723.430) (-3723.687) [-3718.677] -- 0:01:41 643000 -- (-3721.700) (-3717.710) (-3723.859) [-3718.973] * (-3724.792) (-3722.675) [-3719.107] (-3718.774) -- 0:01:41 643500 -- [-3724.546] (-3721.707) (-3721.953) (-3717.417) * (-3721.482) (-3723.678) [-3723.038] (-3721.174) -- 0:01:41 644000 -- (-3721.454) [-3721.368] (-3727.676) (-3721.342) * (-3723.082) (-3722.250) [-3722.469] (-3723.597) -- 0:01:41 644500 -- [-3722.703] (-3722.207) (-3722.560) (-3719.993) * (-3719.299) [-3721.695] (-3724.462) (-3720.440) -- 0:01:40 645000 -- (-3721.936) (-3724.122) (-3717.468) [-3724.005] * (-3729.343) (-3731.446) (-3724.307) [-3720.606] -- 0:01:40 Average standard deviation of split frequencies: 0.000000 645500 -- (-3719.939) [-3724.040] (-3718.422) (-3735.521) * (-3722.800) (-3724.520) (-3720.469) [-3721.425] -- 0:01:40 646000 -- (-3721.808) [-3725.701] (-3731.264) (-3728.236) * (-3722.611) (-3722.591) [-3722.045] (-3718.199) -- 0:01:40 646500 -- (-3723.302) [-3722.208] (-3724.731) (-3730.261) * (-3726.486) [-3723.344] (-3721.184) (-3719.248) -- 0:01:40 647000 -- (-3729.075) (-3722.580) (-3726.356) [-3722.014] * (-3720.440) (-3720.924) (-3726.950) [-3720.740] -- 0:01:40 647500 -- (-3726.778) (-3726.079) [-3721.874] (-3722.990) * [-3725.777] (-3722.466) (-3722.035) (-3720.491) -- 0:01:40 648000 -- (-3719.503) (-3724.835) [-3723.018] (-3724.678) * [-3720.822] (-3726.222) (-3717.132) (-3722.281) -- 0:01:39 648500 -- (-3722.365) (-3734.304) (-3719.220) [-3720.518] * (-3722.668) (-3723.490) [-3717.481] (-3722.976) -- 0:01:39 649000 -- (-3723.206) (-3724.805) [-3728.158] (-3733.491) * (-3725.706) [-3723.205] (-3722.006) (-3727.470) -- 0:01:39 649500 -- [-3717.216] (-3724.522) (-3723.775) (-3723.746) * (-3728.710) (-3719.719) [-3726.183] (-3727.020) -- 0:01:39 650000 -- (-3722.317) (-3722.581) [-3720.537] (-3727.000) * (-3717.311) (-3728.498) [-3722.065] (-3722.276) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 650500 -- [-3731.768] (-3719.823) (-3720.953) (-3725.219) * [-3720.223] (-3725.737) (-3722.368) (-3724.087) -- 0:01:39 651000 -- [-3718.444] (-3722.264) (-3721.056) (-3728.191) * [-3721.237] (-3736.529) (-3725.306) (-3731.863) -- 0:01:39 651500 -- (-3722.627) (-3730.611) [-3718.502] (-3724.593) * [-3720.616] (-3726.372) (-3723.204) (-3721.441) -- 0:01:38 652000 -- [-3720.772] (-3721.955) (-3719.518) (-3731.699) * [-3720.249] (-3728.399) (-3725.540) (-3729.124) -- 0:01:38 652500 -- (-3732.476) (-3720.318) (-3721.176) [-3717.515] * [-3721.450] (-3726.666) (-3726.409) (-3720.910) -- 0:01:38 653000 -- (-3732.451) [-3721.776] (-3728.597) (-3728.923) * [-3726.648] (-3726.590) (-3723.166) (-3721.657) -- 0:01:38 653500 -- (-3724.697) (-3721.248) [-3722.246] (-3726.820) * (-3721.801) (-3722.102) [-3725.077] (-3734.841) -- 0:01:38 654000 -- [-3718.709] (-3726.055) (-3724.202) (-3720.551) * (-3717.140) (-3721.459) [-3720.029] (-3725.494) -- 0:01:38 654500 -- (-3726.342) [-3719.987] (-3725.804) (-3730.064) * (-3725.815) [-3723.606] (-3720.715) (-3723.120) -- 0:01:38 655000 -- (-3719.976) (-3720.248) [-3721.682] (-3727.004) * (-3729.398) [-3720.604] (-3727.566) (-3720.968) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 655500 -- (-3724.211) [-3721.528] (-3725.683) (-3731.828) * (-3724.877) (-3716.278) [-3724.467] (-3723.175) -- 0:01:37 656000 -- (-3721.831) [-3722.538] (-3719.980) (-3726.290) * (-3718.788) (-3719.564) [-3718.840] (-3730.877) -- 0:01:37 656500 -- (-3721.322) [-3718.530] (-3722.082) (-3724.207) * (-3728.802) (-3718.623) [-3725.818] (-3732.644) -- 0:01:37 657000 -- [-3717.420] (-3721.947) (-3720.820) (-3721.321) * (-3724.649) (-3725.102) [-3720.549] (-3728.788) -- 0:01:37 657500 -- (-3725.133) [-3721.050] (-3720.136) (-3719.239) * (-3725.893) (-3720.386) [-3721.026] (-3720.914) -- 0:01:37 658000 -- (-3717.477) (-3722.710) (-3721.029) [-3720.162] * (-3733.326) (-3722.015) [-3727.393] (-3724.794) -- 0:01:37 658500 -- (-3729.189) [-3724.225] (-3721.828) (-3721.688) * (-3729.693) [-3716.624] (-3724.394) (-3723.432) -- 0:01:36 659000 -- (-3722.050) (-3721.147) (-3717.913) [-3722.146] * [-3730.521] (-3720.559) (-3721.678) (-3726.879) -- 0:01:36 659500 -- [-3721.599] (-3723.349) (-3723.484) (-3721.034) * (-3725.068) (-3721.412) [-3722.538] (-3730.184) -- 0:01:36 660000 -- (-3720.448) (-3722.244) (-3726.318) [-3722.794] * (-3721.051) (-3723.733) [-3725.473] (-3725.665) -- 0:01:36 Average standard deviation of split frequencies: 0.000000 660500 -- (-3727.101) (-3728.084) (-3727.563) [-3720.695] * (-3718.461) (-3724.193) (-3727.781) [-3722.981] -- 0:01:36 661000 -- (-3724.940) (-3721.359) (-3724.232) [-3725.776] * (-3724.313) (-3726.609) (-3724.688) [-3722.209] -- 0:01:36 661500 -- (-3724.989) [-3718.475] (-3721.180) (-3722.774) * [-3723.342] (-3719.860) (-3741.691) (-3723.457) -- 0:01:36 662000 -- (-3724.138) (-3720.307) (-3719.590) [-3719.924] * (-3723.808) (-3722.666) (-3731.733) [-3718.891] -- 0:01:35 662500 -- [-3720.721] (-3727.274) (-3720.934) (-3730.041) * (-3720.985) (-3724.046) (-3720.914) [-3720.008] -- 0:01:35 663000 -- [-3728.534] (-3723.447) (-3720.348) (-3718.492) * (-3725.996) (-3719.498) (-3728.258) [-3720.017] -- 0:01:35 663500 -- (-3723.780) [-3725.028] (-3719.838) (-3723.716) * [-3727.608] (-3721.952) (-3720.789) (-3724.464) -- 0:01:35 664000 -- (-3724.776) (-3724.647) [-3721.570] (-3725.895) * (-3720.894) [-3723.631] (-3724.050) (-3722.146) -- 0:01:35 664500 -- (-3729.826) (-3721.090) (-3725.883) [-3722.709] * [-3724.957] (-3723.074) (-3725.096) (-3724.375) -- 0:01:34 665000 -- (-3727.364) (-3722.505) (-3726.043) [-3718.671] * (-3721.855) [-3720.729] (-3720.842) (-3720.962) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 665500 -- (-3728.635) (-3722.280) [-3723.659] (-3718.221) * (-3721.802) (-3722.074) [-3723.387] (-3723.672) -- 0:01:34 666000 -- [-3724.568] (-3722.233) (-3723.985) (-3727.129) * (-3719.100) (-3721.838) [-3720.321] (-3722.173) -- 0:01:34 666500 -- (-3730.793) [-3721.171] (-3723.642) (-3728.038) * (-3721.519) (-3727.176) [-3721.403] (-3722.592) -- 0:01:34 667000 -- [-3721.018] (-3726.268) (-3723.512) (-3719.374) * (-3724.802) (-3725.731) (-3724.304) [-3723.017] -- 0:01:34 667500 -- (-3718.996) [-3721.918] (-3718.335) (-3718.189) * (-3721.944) (-3723.652) [-3722.147] (-3724.001) -- 0:01:34 668000 -- (-3724.392) (-3720.558) [-3718.558] (-3721.325) * (-3721.107) [-3723.593] (-3725.753) (-3719.573) -- 0:01:33 668500 -- [-3726.359] (-3719.692) (-3718.291) (-3724.431) * (-3726.117) (-3723.124) [-3725.699] (-3720.914) -- 0:01:34 669000 -- (-3727.348) [-3720.597] (-3730.188) (-3721.276) * (-3723.694) [-3716.925] (-3734.585) (-3722.674) -- 0:01:34 669500 -- (-3721.093) (-3725.239) [-3721.207] (-3726.385) * [-3720.669] (-3718.386) (-3725.858) (-3723.160) -- 0:01:33 670000 -- (-3724.286) [-3721.768] (-3729.785) (-3722.729) * (-3729.651) [-3720.355] (-3719.717) (-3720.045) -- 0:01:33 Average standard deviation of split frequencies: 0.000000 670500 -- (-3730.161) (-3722.079) [-3725.064] (-3727.570) * (-3722.385) (-3723.695) [-3725.595] (-3727.386) -- 0:01:33 671000 -- (-3723.178) [-3723.371] (-3721.377) (-3733.926) * (-3718.803) (-3724.405) [-3720.157] (-3725.819) -- 0:01:33 671500 -- (-3722.633) (-3721.899) [-3719.967] (-3719.342) * [-3723.547] (-3727.095) (-3724.491) (-3718.712) -- 0:01:32 672000 -- (-3729.371) (-3725.070) (-3719.879) [-3724.479] * [-3720.894] (-3721.497) (-3731.107) (-3730.288) -- 0:01:33 672500 -- (-3726.880) (-3725.127) (-3720.778) [-3720.835] * (-3732.332) (-3721.799) [-3719.471] (-3724.447) -- 0:01:33 673000 -- (-3727.845) (-3724.673) (-3721.370) [-3718.212] * (-3735.846) (-3722.309) [-3730.221] (-3723.419) -- 0:01:32 673500 -- (-3727.586) (-3726.330) [-3718.934] (-3721.576) * [-3728.011] (-3724.905) (-3728.589) (-3734.841) -- 0:01:32 674000 -- (-3724.806) (-3726.849) (-3718.965) [-3722.687] * (-3723.937) [-3720.962] (-3734.594) (-3723.005) -- 0:01:32 674500 -- (-3727.372) (-3728.156) [-3719.948] (-3721.507) * (-3730.898) (-3723.067) (-3728.064) [-3720.979] -- 0:01:32 675000 -- (-3724.624) (-3722.110) (-3720.022) [-3721.112] * [-3723.471] (-3724.780) (-3726.822) (-3728.750) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 675500 -- (-3721.212) (-3720.916) [-3718.744] (-3720.120) * [-3724.765] (-3724.600) (-3726.895) (-3731.482) -- 0:01:32 676000 -- (-3723.786) (-3728.513) [-3718.421] (-3722.777) * (-3722.920) (-3724.554) [-3727.897] (-3728.070) -- 0:01:32 676500 -- (-3727.878) [-3718.955] (-3719.433) (-3718.687) * (-3724.172) [-3723.664] (-3724.861) (-3721.935) -- 0:01:31 677000 -- [-3720.127] (-3722.131) (-3720.706) (-3721.594) * [-3725.695] (-3719.615) (-3727.622) (-3720.751) -- 0:01:31 677500 -- (-3723.833) (-3725.781) (-3718.644) [-3728.054] * (-3723.125) (-3731.550) (-3720.198) [-3719.075] -- 0:01:31 678000 -- [-3722.448] (-3731.459) (-3720.537) (-3724.525) * (-3723.041) [-3725.957] (-3718.994) (-3720.577) -- 0:01:31 678500 -- (-3723.649) [-3732.613] (-3724.780) (-3721.310) * (-3719.489) (-3726.239) [-3717.206] (-3720.101) -- 0:01:30 679000 -- (-3721.540) (-3722.870) (-3722.381) [-3719.162] * [-3723.238] (-3727.566) (-3723.647) (-3722.985) -- 0:01:31 679500 -- (-3718.746) [-3723.726] (-3724.013) (-3718.482) * (-3718.799) [-3723.317] (-3720.901) (-3721.981) -- 0:01:31 680000 -- (-3720.631) [-3729.026] (-3721.716) (-3721.293) * (-3725.544) (-3726.738) (-3718.684) [-3724.953] -- 0:01:30 Average standard deviation of split frequencies: 0.000000 680500 -- (-3724.822) (-3721.915) (-3735.519) [-3724.686] * [-3724.317] (-3726.331) (-3721.519) (-3719.323) -- 0:01:30 681000 -- (-3725.711) (-3727.340) [-3723.949] (-3722.859) * (-3720.999) (-3718.606) (-3719.906) [-3720.012] -- 0:01:30 681500 -- (-3722.883) [-3719.834] (-3725.479) (-3726.837) * (-3722.184) (-3723.698) (-3720.530) [-3720.299] -- 0:01:30 682000 -- [-3718.563] (-3727.450) (-3719.460) (-3725.033) * (-3723.520) (-3723.125) (-3723.069) [-3721.610] -- 0:01:29 682500 -- (-3721.882) (-3723.647) [-3721.259] (-3724.182) * (-3725.910) [-3719.916] (-3720.585) (-3722.582) -- 0:01:30 683000 -- (-3723.925) (-3722.700) [-3722.074] (-3720.777) * (-3718.761) [-3724.016] (-3720.548) (-3724.770) -- 0:01:30 683500 -- [-3733.734] (-3727.310) (-3721.332) (-3728.723) * (-3720.023) (-3731.217) [-3721.709] (-3727.256) -- 0:01:29 684000 -- (-3728.688) (-3722.058) (-3722.063) [-3725.923] * (-3720.355) (-3722.333) (-3721.609) [-3720.809] -- 0:01:29 684500 -- (-3721.155) (-3718.783) (-3730.444) [-3718.096] * [-3720.865] (-3721.727) (-3725.062) (-3721.964) -- 0:01:29 685000 -- (-3724.128) (-3718.354) [-3722.081] (-3724.701) * [-3722.372] (-3721.827) (-3726.175) (-3726.092) -- 0:01:29 Average standard deviation of split frequencies: 0.000000 685500 -- [-3720.806] (-3723.161) (-3725.211) (-3724.471) * (-3721.662) [-3720.146] (-3736.453) (-3725.310) -- 0:01:29 686000 -- (-3719.990) (-3723.906) [-3724.067] (-3721.069) * [-3725.735] (-3727.265) (-3729.686) (-3721.865) -- 0:01:29 686500 -- (-3723.165) [-3726.117] (-3721.625) (-3725.500) * [-3730.960] (-3721.054) (-3726.212) (-3727.515) -- 0:01:29 687000 -- (-3725.547) [-3721.150] (-3730.172) (-3721.602) * [-3723.679] (-3719.604) (-3720.168) (-3724.523) -- 0:01:28 687500 -- (-3724.795) [-3722.006] (-3721.093) (-3724.978) * (-3721.581) [-3722.828] (-3725.296) (-3726.608) -- 0:01:28 688000 -- (-3723.052) (-3722.103) (-3727.157) [-3719.958] * (-3723.781) [-3723.114] (-3719.412) (-3726.541) -- 0:01:28 688500 -- [-3718.991] (-3726.046) (-3725.220) (-3732.703) * [-3716.636] (-3721.490) (-3726.009) (-3727.093) -- 0:01:28 689000 -- (-3725.837) (-3729.741) (-3722.915) [-3726.094] * (-3725.113) (-3722.682) [-3721.482] (-3729.067) -- 0:01:28 689500 -- (-3722.294) [-3723.763] (-3721.694) (-3728.821) * (-3720.193) (-3722.419) [-3722.880] (-3718.492) -- 0:01:28 690000 -- (-3721.134) [-3725.735] (-3723.326) (-3723.259) * (-3721.981) [-3720.466] (-3722.538) (-3727.634) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 690500 -- (-3722.241) [-3723.691] (-3724.907) (-3722.154) * (-3723.535) (-3722.733) (-3719.433) [-3724.971] -- 0:01:27 691000 -- (-3723.558) (-3722.569) (-3724.012) [-3721.678] * (-3720.534) (-3724.367) [-3718.710] (-3724.823) -- 0:01:27 691500 -- (-3720.490) [-3722.201] (-3724.035) (-3727.237) * (-3720.018) (-3720.405) [-3724.756] (-3721.399) -- 0:01:27 692000 -- (-3725.862) [-3720.414] (-3721.090) (-3723.374) * [-3717.981] (-3723.824) (-3718.919) (-3725.554) -- 0:01:27 692500 -- (-3718.184) (-3721.114) (-3724.733) [-3721.160] * (-3718.737) (-3724.863) [-3718.435] (-3726.629) -- 0:01:27 693000 -- (-3718.772) [-3720.572] (-3725.999) (-3719.193) * [-3723.797] (-3720.232) (-3729.289) (-3723.183) -- 0:01:26 693500 -- [-3723.321] (-3721.715) (-3720.359) (-3721.665) * (-3730.401) (-3720.124) (-3723.495) [-3722.824] -- 0:01:27 694000 -- (-3721.764) (-3731.496) [-3719.937] (-3719.405) * (-3720.273) (-3724.808) [-3728.621] (-3723.553) -- 0:01:26 694500 -- (-3727.312) (-3728.471) (-3728.700) [-3721.005] * (-3720.268) [-3718.273] (-3717.928) (-3725.647) -- 0:01:26 695000 -- (-3725.597) (-3724.022) [-3723.818] (-3727.759) * (-3722.874) (-3723.648) [-3720.567] (-3727.231) -- 0:01:26 Average standard deviation of split frequencies: 0.000000 695500 -- (-3723.854) (-3730.095) [-3721.995] (-3721.729) * [-3720.850] (-3721.926) (-3718.379) (-3726.674) -- 0:01:26 696000 -- (-3721.997) [-3719.012] (-3727.900) (-3723.242) * (-3720.316) (-3727.186) [-3716.656] (-3720.337) -- 0:01:26 696500 -- (-3720.800) (-3720.223) [-3726.583] (-3722.784) * [-3717.739] (-3724.487) (-3723.531) (-3728.000) -- 0:01:25 697000 -- (-3723.256) (-3717.356) (-3726.713) [-3719.800] * (-3725.111) (-3722.573) (-3723.345) [-3724.456] -- 0:01:26 697500 -- (-3718.191) (-3724.184) (-3719.481) [-3721.049] * (-3721.656) [-3721.546] (-3725.600) (-3726.785) -- 0:01:25 698000 -- (-3722.072) (-3724.279) [-3719.220] (-3720.493) * (-3719.409) (-3724.036) [-3722.959] (-3725.429) -- 0:01:25 698500 -- (-3718.975) [-3719.099] (-3727.711) (-3724.587) * (-3724.549) (-3727.281) [-3718.458] (-3723.182) -- 0:01:25 699000 -- [-3719.557] (-3722.808) (-3722.242) (-3723.738) * (-3729.595) (-3723.267) [-3720.438] (-3721.254) -- 0:01:25 699500 -- (-3726.177) [-3721.167] (-3726.780) (-3720.040) * (-3727.206) [-3724.539] (-3725.398) (-3726.338) -- 0:01:25 700000 -- (-3726.289) (-3720.296) [-3723.805] (-3728.802) * (-3729.374) (-3721.870) [-3723.350] (-3724.920) -- 0:01:24 Average standard deviation of split frequencies: 0.000000 700500 -- (-3727.586) [-3720.113] (-3721.312) (-3727.831) * (-3725.868) (-3723.193) (-3723.545) [-3723.494] -- 0:01:25 701000 -- (-3726.575) (-3722.503) [-3725.355] (-3721.579) * [-3724.311] (-3723.108) (-3725.578) (-3726.673) -- 0:01:24 701500 -- (-3728.655) [-3724.562] (-3734.954) (-3724.250) * (-3719.430) (-3719.504) [-3720.698] (-3725.316) -- 0:01:24 702000 -- (-3722.311) [-3723.115] (-3725.577) (-3723.547) * (-3725.063) (-3727.601) (-3719.786) [-3724.525] -- 0:01:24 702500 -- (-3728.109) (-3722.907) (-3721.153) [-3720.301] * (-3723.168) (-3720.929) (-3721.588) [-3720.744] -- 0:01:24 703000 -- (-3726.577) [-3720.809] (-3721.058) (-3719.514) * (-3720.532) (-3720.704) [-3724.090] (-3729.490) -- 0:01:24 703500 -- (-3722.458) (-3728.494) (-3724.416) [-3719.899] * (-3721.204) (-3724.788) (-3725.131) [-3725.475] -- 0:01:23 704000 -- [-3719.995] (-3730.464) (-3731.709) (-3723.310) * [-3718.263] (-3719.336) (-3723.053) (-3721.151) -- 0:01:24 704500 -- (-3718.975) (-3728.726) [-3729.547] (-3722.598) * (-3725.249) [-3725.709] (-3734.484) (-3720.658) -- 0:01:23 705000 -- (-3719.002) (-3728.439) (-3726.547) [-3725.271] * (-3727.204) (-3729.817) [-3721.159] (-3725.311) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 705500 -- (-3719.995) [-3724.379] (-3721.865) (-3727.265) * (-3725.865) (-3727.893) (-3721.505) [-3728.344] -- 0:01:23 706000 -- (-3721.193) [-3725.604] (-3722.477) (-3719.802) * (-3725.659) (-3728.252) (-3725.963) [-3720.922] -- 0:01:23 706500 -- (-3725.881) (-3718.216) (-3719.885) [-3721.613] * (-3721.097) (-3725.918) [-3723.528] (-3724.333) -- 0:01:23 707000 -- [-3721.280] (-3723.388) (-3724.159) (-3719.806) * (-3726.017) (-3727.887) [-3722.227] (-3723.423) -- 0:01:22 707500 -- (-3718.841) (-3720.144) (-3721.613) [-3720.807] * [-3719.413] (-3726.504) (-3723.971) (-3717.106) -- 0:01:23 708000 -- [-3717.754] (-3723.213) (-3723.405) (-3720.300) * (-3716.993) [-3721.679] (-3722.572) (-3724.648) -- 0:01:22 708500 -- [-3721.900] (-3725.565) (-3729.777) (-3728.679) * (-3724.579) (-3724.260) [-3724.247] (-3719.372) -- 0:01:22 709000 -- (-3724.140) (-3720.961) [-3727.771] (-3721.949) * (-3720.926) [-3719.175] (-3723.170) (-3725.384) -- 0:01:22 709500 -- (-3723.463) (-3732.544) [-3725.047] (-3722.258) * (-3723.059) (-3721.682) [-3723.551] (-3725.804) -- 0:01:22 710000 -- [-3721.310] (-3725.258) (-3725.197) (-3722.087) * (-3729.560) (-3722.138) [-3718.957] (-3722.962) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 710500 -- (-3723.337) (-3720.472) (-3718.317) [-3719.351] * [-3721.808] (-3723.816) (-3719.144) (-3736.408) -- 0:01:21 711000 -- (-3730.737) [-3719.960] (-3721.541) (-3719.446) * (-3720.989) (-3727.864) [-3719.424] (-3735.315) -- 0:01:22 711500 -- (-3736.405) [-3722.077] (-3721.138) (-3719.205) * (-3731.142) [-3723.329] (-3719.412) (-3732.495) -- 0:01:21 712000 -- (-3730.419) [-3720.337] (-3725.990) (-3727.757) * (-3724.619) (-3724.675) [-3718.081] (-3726.190) -- 0:01:21 712500 -- (-3722.357) (-3731.889) [-3724.421] (-3725.120) * (-3721.109) (-3717.898) [-3718.986] (-3725.572) -- 0:01:21 713000 -- (-3729.920) (-3724.636) (-3723.671) [-3719.984] * [-3722.640] (-3718.320) (-3721.238) (-3727.472) -- 0:01:21 713500 -- (-3722.096) (-3723.406) (-3719.723) [-3722.991] * (-3721.058) (-3719.237) (-3720.274) [-3720.662] -- 0:01:21 714000 -- (-3718.832) [-3727.758] (-3724.050) (-3724.638) * (-3725.023) (-3728.326) (-3724.370) [-3728.584] -- 0:01:20 714500 -- [-3721.718] (-3719.933) (-3721.969) (-3726.627) * (-3729.094) (-3723.012) [-3722.356] (-3720.947) -- 0:01:21 715000 -- (-3722.343) (-3721.911) (-3724.454) [-3722.007] * (-3731.036) (-3727.475) (-3725.665) [-3721.560] -- 0:01:20 Average standard deviation of split frequencies: 0.000000 715500 -- (-3724.650) (-3717.667) [-3726.089] (-3722.927) * (-3734.964) (-3721.220) [-3724.392] (-3726.738) -- 0:01:20 716000 -- (-3721.989) (-3727.347) [-3720.349] (-3731.734) * (-3726.845) (-3721.261) (-3723.580) [-3719.447] -- 0:01:20 716500 -- (-3723.336) (-3728.166) [-3721.877] (-3726.586) * (-3725.463) (-3726.446) (-3723.991) [-3723.721] -- 0:01:20 717000 -- (-3721.002) (-3727.214) (-3725.241) [-3725.425] * (-3722.928) [-3725.262] (-3722.333) (-3727.467) -- 0:01:20 717500 -- (-3719.984) (-3720.230) [-3719.366] (-3726.553) * (-3718.979) [-3724.325] (-3722.999) (-3721.334) -- 0:01:19 718000 -- [-3723.929] (-3720.820) (-3720.894) (-3720.635) * [-3724.643] (-3724.313) (-3724.699) (-3723.419) -- 0:01:19 718500 -- (-3726.062) (-3725.820) (-3723.699) [-3724.183] * [-3722.055] (-3731.493) (-3726.330) (-3730.698) -- 0:01:19 719000 -- (-3718.811) [-3721.574] (-3719.994) (-3727.839) * (-3725.820) (-3730.693) [-3722.540] (-3723.053) -- 0:01:19 719500 -- (-3726.977) [-3725.789] (-3719.455) (-3724.802) * (-3720.194) (-3722.679) (-3730.628) [-3720.021] -- 0:01:19 720000 -- [-3718.342] (-3731.676) (-3723.617) (-3722.272) * (-3720.275) (-3728.061) [-3725.391] (-3722.654) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 720500 -- [-3719.107] (-3727.820) (-3731.440) (-3729.053) * (-3718.414) (-3719.235) [-3723.406] (-3726.719) -- 0:01:19 721000 -- [-3716.709] (-3722.148) (-3730.237) (-3720.327) * [-3725.846] (-3716.669) (-3724.721) (-3726.310) -- 0:01:18 721500 -- [-3719.024] (-3727.399) (-3721.799) (-3722.638) * [-3720.507] (-3723.964) (-3727.937) (-3728.624) -- 0:01:18 722000 -- [-3725.648] (-3728.362) (-3724.913) (-3722.482) * (-3723.827) [-3719.431] (-3720.003) (-3719.021) -- 0:01:18 722500 -- (-3723.758) (-3720.547) (-3722.115) [-3727.277] * (-3718.406) (-3723.959) (-3728.359) [-3723.257] -- 0:01:18 723000 -- (-3728.943) (-3723.012) [-3722.482] (-3724.851) * (-3729.257) (-3724.940) (-3720.996) [-3719.364] -- 0:01:18 723500 -- (-3725.394) (-3729.814) [-3719.676] (-3728.078) * (-3727.159) [-3725.273] (-3726.330) (-3720.227) -- 0:01:18 724000 -- (-3723.571) (-3721.727) (-3724.374) [-3722.707] * (-3723.317) (-3737.545) [-3723.025] (-3721.255) -- 0:01:18 724500 -- (-3730.473) (-3723.164) (-3734.272) [-3717.554] * (-3721.291) (-3719.949) (-3723.836) [-3718.267] -- 0:01:17 725000 -- (-3719.625) (-3721.026) [-3731.272] (-3724.879) * (-3720.541) (-3723.980) (-3720.813) [-3721.153] -- 0:01:17 Average standard deviation of split frequencies: 0.000000 725500 -- [-3720.781] (-3723.721) (-3723.133) (-3726.374) * (-3728.387) (-3730.786) (-3721.554) [-3721.951] -- 0:01:17 726000 -- [-3718.752] (-3722.625) (-3723.141) (-3718.799) * (-3724.269) (-3723.177) (-3718.625) [-3723.607] -- 0:01:17 726500 -- [-3720.893] (-3724.871) (-3729.096) (-3720.845) * [-3724.059] (-3717.319) (-3722.134) (-3725.324) -- 0:01:17 727000 -- [-3723.793] (-3722.319) (-3718.710) (-3719.528) * (-3723.435) (-3717.932) [-3722.942] (-3718.790) -- 0:01:17 727500 -- (-3726.304) [-3723.569] (-3722.841) (-3717.443) * (-3726.199) (-3724.817) (-3721.616) [-3725.968] -- 0:01:17 728000 -- (-3726.892) (-3725.370) (-3721.553) [-3719.003] * (-3720.951) (-3730.279) [-3720.432] (-3723.558) -- 0:01:16 728500 -- (-3721.200) (-3722.664) (-3724.835) [-3725.217] * (-3731.423) [-3719.036] (-3733.048) (-3723.532) -- 0:01:16 729000 -- (-3724.844) (-3724.578) (-3723.289) [-3719.437] * [-3723.469] (-3725.478) (-3720.433) (-3718.089) -- 0:01:16 729500 -- (-3726.217) (-3725.234) [-3719.992] (-3724.776) * (-3727.282) (-3725.328) (-3720.931) [-3726.115] -- 0:01:16 730000 -- (-3726.010) (-3726.211) (-3721.909) [-3724.905] * (-3722.061) (-3721.026) [-3723.043] (-3716.919) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 730500 -- [-3717.955] (-3724.802) (-3720.141) (-3722.271) * (-3723.844) [-3726.416] (-3728.412) (-3720.364) -- 0:01:16 731000 -- (-3720.467) (-3719.606) [-3722.367] (-3723.533) * (-3726.534) (-3720.726) [-3726.257] (-3723.845) -- 0:01:16 731500 -- [-3718.670] (-3719.922) (-3721.998) (-3723.270) * (-3723.721) (-3727.198) (-3723.043) [-3723.222] -- 0:01:15 732000 -- (-3720.511) (-3719.805) (-3730.885) [-3720.266] * (-3724.053) (-3724.645) (-3723.568) [-3719.281] -- 0:01:15 732500 -- [-3720.203] (-3723.009) (-3727.830) (-3718.771) * (-3721.799) (-3717.905) (-3718.314) [-3719.382] -- 0:01:15 733000 -- (-3721.034) (-3722.323) (-3726.528) [-3720.346] * (-3730.560) (-3715.168) (-3723.997) [-3719.846] -- 0:01:15 733500 -- (-3723.543) (-3720.779) [-3722.532] (-3724.094) * (-3720.892) [-3721.476] (-3724.001) (-3722.192) -- 0:01:15 734000 -- (-3723.654) [-3721.396] (-3717.948) (-3725.726) * [-3719.930] (-3721.458) (-3717.069) (-3721.308) -- 0:01:15 734500 -- [-3723.577] (-3721.916) (-3725.885) (-3721.064) * (-3726.984) (-3730.900) (-3719.095) [-3722.420] -- 0:01:15 735000 -- (-3725.835) [-3718.566] (-3722.058) (-3720.839) * (-3727.247) (-3719.994) [-3717.677] (-3722.343) -- 0:01:14 Average standard deviation of split frequencies: 0.000000 735500 -- (-3724.935) (-3722.879) [-3723.924] (-3725.048) * [-3723.020] (-3722.495) (-3721.347) (-3725.114) -- 0:01:14 736000 -- (-3720.750) (-3721.651) [-3726.799] (-3720.286) * [-3725.359] (-3719.093) (-3722.732) (-3724.483) -- 0:01:14 736500 -- (-3724.679) [-3721.028] (-3722.784) (-3720.369) * (-3728.952) [-3718.272] (-3726.057) (-3719.246) -- 0:01:14 737000 -- (-3723.977) [-3723.315] (-3724.338) (-3725.424) * (-3722.139) (-3721.618) (-3724.774) [-3719.033] -- 0:01:14 737500 -- [-3721.469] (-3725.865) (-3723.294) (-3727.108) * (-3722.734) [-3717.194] (-3719.651) (-3720.721) -- 0:01:14 738000 -- (-3721.646) (-3721.893) (-3719.716) [-3724.991] * (-3725.122) [-3722.774] (-3724.374) (-3722.973) -- 0:01:14 738500 -- [-3722.171] (-3723.422) (-3720.121) (-3729.189) * [-3721.181] (-3719.991) (-3725.138) (-3723.360) -- 0:01:14 739000 -- (-3722.584) [-3720.344] (-3721.312) (-3724.655) * (-3727.253) [-3729.356] (-3719.245) (-3725.184) -- 0:01:13 739500 -- [-3720.206] (-3723.395) (-3725.024) (-3730.029) * (-3721.028) (-3729.500) (-3721.428) [-3721.134] -- 0:01:13 740000 -- (-3719.893) (-3720.782) [-3727.053] (-3723.408) * (-3720.799) (-3720.823) [-3718.994] (-3720.557) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 740500 -- [-3719.372] (-3726.874) (-3727.429) (-3731.349) * (-3721.823) (-3723.137) (-3717.622) [-3716.890] -- 0:01:13 741000 -- (-3718.810) (-3723.139) [-3720.157] (-3723.456) * [-3718.334] (-3719.369) (-3721.496) (-3722.070) -- 0:01:13 741500 -- [-3724.371] (-3725.468) (-3729.384) (-3722.392) * [-3719.372] (-3725.518) (-3719.640) (-3723.574) -- 0:01:13 742000 -- (-3725.486) (-3724.134) (-3719.388) [-3722.372] * (-3722.647) (-3724.484) [-3724.770] (-3720.726) -- 0:01:13 742500 -- [-3721.075] (-3723.299) (-3726.353) (-3723.545) * (-3718.827) (-3721.402) (-3728.784) [-3719.398] -- 0:01:12 743000 -- (-3727.063) (-3718.503) [-3720.491] (-3719.791) * (-3718.833) [-3721.973] (-3723.044) (-3726.404) -- 0:01:12 743500 -- (-3728.591) (-3726.929) (-3717.068) [-3718.473] * (-3725.550) [-3724.075] (-3727.371) (-3724.715) -- 0:01:12 744000 -- (-3719.442) (-3726.312) [-3718.952] (-3720.116) * (-3726.706) (-3721.375) [-3721.510] (-3723.479) -- 0:01:12 744500 -- (-3722.144) [-3720.804] (-3721.743) (-3722.194) * (-3721.868) [-3722.554] (-3725.649) (-3727.437) -- 0:01:12 745000 -- (-3725.338) [-3722.964] (-3723.776) (-3727.332) * [-3720.456] (-3718.794) (-3723.254) (-3723.808) -- 0:01:12 Average standard deviation of split frequencies: 0.000000 745500 -- (-3721.266) [-3723.102] (-3729.913) (-3720.245) * (-3727.522) (-3722.124) (-3716.620) [-3721.807] -- 0:01:12 746000 -- (-3723.449) (-3720.540) (-3719.870) [-3721.330] * (-3722.624) [-3721.672] (-3723.635) (-3727.088) -- 0:01:11 746500 -- (-3727.249) [-3725.485] (-3717.463) (-3722.622) * (-3724.295) [-3726.239] (-3727.833) (-3722.496) -- 0:01:11 747000 -- [-3722.244] (-3720.995) (-3723.021) (-3729.586) * [-3722.734] (-3723.824) (-3723.058) (-3726.771) -- 0:01:11 747500 -- (-3722.413) (-3727.517) [-3718.685] (-3722.567) * (-3726.232) (-3725.916) (-3724.046) [-3718.700] -- 0:01:11 748000 -- [-3725.169] (-3723.133) (-3722.544) (-3728.598) * (-3727.648) (-3731.320) (-3725.614) [-3718.898] -- 0:01:11 748500 -- [-3723.102] (-3721.096) (-3720.981) (-3723.920) * [-3728.195] (-3728.042) (-3734.430) (-3720.778) -- 0:01:11 749000 -- [-3718.060] (-3719.994) (-3717.124) (-3719.378) * (-3721.394) (-3727.119) [-3728.747] (-3718.842) -- 0:01:11 749500 -- (-3720.490) (-3717.756) [-3721.377] (-3725.699) * (-3720.442) (-3718.574) (-3725.470) [-3727.215] -- 0:01:10 750000 -- (-3724.803) (-3727.913) (-3721.139) [-3720.344] * (-3719.338) (-3726.411) (-3720.926) [-3725.291] -- 0:01:10 Average standard deviation of split frequencies: 0.000000 750500 -- (-3725.099) (-3720.515) [-3721.395] (-3719.673) * (-3722.978) (-3720.896) [-3721.509] (-3718.904) -- 0:01:10 751000 -- (-3722.550) (-3727.135) [-3724.693] (-3726.836) * (-3726.966) (-3720.672) (-3723.629) [-3721.374] -- 0:01:10 751500 -- (-3724.348) (-3726.103) [-3723.599] (-3726.886) * (-3725.586) [-3721.018] (-3723.674) (-3725.560) -- 0:01:10 752000 -- [-3725.229] (-3728.476) (-3726.023) (-3721.074) * (-3727.060) [-3722.551] (-3726.617) (-3721.752) -- 0:01:10 752500 -- (-3721.834) [-3725.900] (-3725.246) (-3725.223) * [-3722.676] (-3725.215) (-3723.600) (-3727.059) -- 0:01:10 753000 -- (-3728.750) [-3722.009] (-3723.880) (-3723.643) * (-3720.438) (-3722.913) (-3720.727) [-3720.749] -- 0:01:09 753500 -- (-3719.194) (-3723.392) (-3724.607) [-3722.261] * (-3717.072) (-3725.681) (-3721.289) [-3722.493] -- 0:01:09 754000 -- [-3722.620] (-3731.115) (-3720.339) (-3722.715) * (-3722.169) (-3718.477) (-3721.741) [-3727.126] -- 0:01:09 754500 -- (-3727.704) (-3729.388) [-3720.029] (-3722.818) * [-3724.438] (-3720.511) (-3721.193) (-3724.833) -- 0:01:09 755000 -- (-3721.732) (-3730.414) (-3719.429) [-3727.109] * (-3726.602) (-3719.527) [-3722.098] (-3721.425) -- 0:01:09 Average standard deviation of split frequencies: 0.000000 755500 -- (-3717.459) (-3724.213) [-3723.511] (-3725.530) * (-3723.869) (-3726.659) (-3723.340) [-3724.808] -- 0:01:09 756000 -- (-3721.666) [-3721.233] (-3720.027) (-3733.229) * (-3731.498) [-3729.789] (-3717.083) (-3720.987) -- 0:01:09 756500 -- (-3724.166) [-3720.767] (-3719.915) (-3724.511) * [-3729.677] (-3729.957) (-3722.778) (-3724.122) -- 0:01:08 757000 -- (-3724.345) (-3722.650) [-3724.634] (-3724.234) * (-3722.415) [-3719.867] (-3722.643) (-3722.874) -- 0:01:08 757500 -- (-3716.444) [-3719.955] (-3725.350) (-3723.816) * (-3719.199) (-3721.200) [-3722.379] (-3720.540) -- 0:01:08 758000 -- (-3721.849) [-3718.447] (-3721.417) (-3723.668) * [-3716.394] (-3720.398) (-3720.349) (-3722.195) -- 0:01:08 758500 -- (-3721.802) [-3723.955] (-3725.806) (-3721.558) * (-3721.043) [-3723.959] (-3718.444) (-3722.793) -- 0:01:08 759000 -- (-3725.188) (-3717.585) (-3729.736) [-3723.041] * (-3720.543) [-3723.819] (-3725.900) (-3723.377) -- 0:01:08 759500 -- (-3725.293) [-3720.548] (-3737.188) (-3722.603) * (-3723.159) [-3718.965] (-3719.457) (-3725.064) -- 0:01:08 760000 -- (-3722.969) (-3721.104) (-3732.501) [-3722.608] * [-3719.302] (-3724.349) (-3718.923) (-3731.912) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 760500 -- [-3724.441] (-3721.859) (-3721.538) (-3717.679) * [-3720.129] (-3732.576) (-3728.515) (-3724.059) -- 0:01:07 761000 -- (-3721.686) (-3727.976) (-3719.214) [-3723.835] * (-3719.779) [-3722.730] (-3730.262) (-3722.156) -- 0:01:07 761500 -- (-3726.891) (-3724.926) (-3737.124) [-3723.475] * (-3722.873) (-3727.770) (-3726.430) [-3720.483] -- 0:01:07 762000 -- (-3724.801) (-3727.122) [-3723.241] (-3725.149) * [-3722.882] (-3725.749) (-3730.632) (-3725.463) -- 0:01:07 762500 -- [-3721.170] (-3728.730) (-3720.019) (-3729.939) * [-3717.769] (-3725.217) (-3733.537) (-3722.427) -- 0:01:07 763000 -- (-3723.455) [-3723.780] (-3729.932) (-3724.233) * (-3721.763) (-3726.087) [-3725.021] (-3728.136) -- 0:01:07 763500 -- (-3720.074) (-3723.846) (-3726.137) [-3720.774] * (-3721.433) (-3723.123) (-3722.479) [-3720.542] -- 0:01:06 764000 -- [-3720.322] (-3717.581) (-3722.655) (-3718.863) * (-3720.180) (-3727.844) [-3723.017] (-3730.615) -- 0:01:06 764500 -- [-3723.931] (-3725.585) (-3727.796) (-3727.558) * (-3726.879) [-3721.956] (-3723.353) (-3722.523) -- 0:01:06 765000 -- (-3722.089) [-3721.818] (-3730.188) (-3722.140) * (-3725.976) [-3718.711] (-3720.671) (-3723.029) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 765500 -- [-3722.664] (-3726.447) (-3735.800) (-3722.930) * [-3722.909] (-3732.896) (-3724.954) (-3725.479) -- 0:01:06 766000 -- (-3720.365) [-3722.544] (-3731.552) (-3722.541) * (-3722.670) (-3729.916) (-3727.070) [-3717.117] -- 0:01:06 766500 -- (-3729.997) [-3721.962] (-3726.122) (-3724.849) * (-3727.199) (-3723.146) [-3725.667] (-3716.687) -- 0:01:06 767000 -- (-3725.328) (-3723.270) (-3726.695) [-3721.902] * (-3725.687) (-3721.464) (-3719.667) [-3721.695] -- 0:01:05 767500 -- (-3722.998) (-3720.533) (-3731.465) [-3720.948] * (-3722.840) (-3721.449) [-3718.080] (-3720.179) -- 0:01:05 768000 -- (-3722.497) (-3717.706) [-3725.239] (-3722.145) * [-3722.118] (-3724.560) (-3726.064) (-3724.432) -- 0:01:05 768500 -- (-3727.613) (-3723.285) [-3726.303] (-3722.933) * (-3722.322) [-3720.829] (-3719.677) (-3725.015) -- 0:01:05 769000 -- (-3725.676) (-3723.938) (-3732.605) [-3727.487] * [-3727.292] (-3725.274) (-3720.214) (-3724.439) -- 0:01:05 769500 -- (-3729.687) [-3722.913] (-3721.107) (-3717.471) * (-3730.288) (-3728.676) [-3719.199] (-3720.443) -- 0:01:05 770000 -- [-3725.535] (-3716.637) (-3720.800) (-3724.828) * (-3726.620) (-3728.479) (-3724.623) [-3722.841] -- 0:01:05 Average standard deviation of split frequencies: 0.000000 770500 -- (-3720.118) (-3721.910) [-3721.863] (-3722.757) * [-3723.623] (-3722.833) (-3725.192) (-3725.665) -- 0:01:04 771000 -- (-3729.208) [-3720.169] (-3727.637) (-3722.340) * [-3724.508] (-3725.512) (-3732.568) (-3720.158) -- 0:01:04 771500 -- [-3727.570] (-3720.169) (-3724.971) (-3725.605) * (-3724.475) (-3721.722) (-3724.336) [-3721.490] -- 0:01:04 772000 -- (-3729.071) (-3720.412) (-3732.936) [-3720.802] * (-3723.739) [-3720.919] (-3732.919) (-3725.833) -- 0:01:04 772500 -- [-3725.826] (-3728.200) (-3729.560) (-3723.060) * (-3730.145) (-3727.839) (-3732.757) [-3719.416] -- 0:01:04 773000 -- (-3724.869) [-3721.896] (-3729.014) (-3724.365) * [-3718.844] (-3722.004) (-3721.596) (-3719.488) -- 0:01:04 773500 -- (-3722.152) (-3722.478) (-3723.169) [-3721.728] * (-3724.578) (-3730.556) (-3726.740) [-3719.267] -- 0:01:04 774000 -- (-3719.923) (-3728.324) (-3726.139) [-3730.868] * (-3723.863) (-3727.780) [-3729.598] (-3722.712) -- 0:01:03 774500 -- (-3720.849) [-3721.142] (-3722.447) (-3721.095) * (-3721.204) (-3728.724) (-3729.419) [-3725.941] -- 0:01:03 775000 -- (-3719.549) (-3723.934) (-3720.942) [-3721.463] * (-3720.777) (-3720.452) [-3719.361] (-3721.449) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 775500 -- (-3728.625) (-3721.927) [-3720.378] (-3726.563) * (-3718.106) (-3719.734) [-3719.470] (-3725.570) -- 0:01:03 776000 -- (-3726.464) (-3719.152) (-3719.494) [-3725.680] * (-3720.256) (-3727.447) (-3725.420) [-3722.722] -- 0:01:03 776500 -- (-3723.274) (-3721.379) [-3718.182] (-3722.143) * (-3721.876) [-3721.226] (-3724.301) (-3721.766) -- 0:01:03 777000 -- (-3722.358) (-3721.899) (-3726.425) [-3719.494] * (-3731.245) (-3727.665) [-3719.112] (-3720.421) -- 0:01:03 777500 -- (-3722.548) [-3725.902] (-3721.692) (-3719.122) * (-3731.807) [-3727.288] (-3720.322) (-3726.274) -- 0:01:02 778000 -- [-3719.784] (-3731.585) (-3722.134) (-3727.709) * (-3733.871) [-3718.314] (-3719.611) (-3719.616) -- 0:01:02 778500 -- (-3723.010) (-3734.868) (-3723.233) [-3723.138] * [-3729.469] (-3723.045) (-3719.912) (-3722.544) -- 0:01:02 779000 -- (-3720.087) [-3721.617] (-3724.586) (-3724.179) * [-3723.430] (-3719.817) (-3721.928) (-3724.705) -- 0:01:02 779500 -- [-3722.048] (-3724.602) (-3726.778) (-3719.554) * [-3725.093] (-3724.549) (-3722.295) (-3720.515) -- 0:01:02 780000 -- [-3724.002] (-3723.816) (-3722.879) (-3721.357) * [-3727.843] (-3722.760) (-3722.077) (-3720.455) -- 0:01:02 Average standard deviation of split frequencies: 0.000000 780500 -- (-3720.715) (-3725.461) (-3729.128) [-3719.533] * (-3724.580) (-3718.979) [-3723.900] (-3720.653) -- 0:01:02 781000 -- (-3718.509) (-3724.042) [-3721.383] (-3724.611) * (-3728.079) (-3724.888) (-3726.471) [-3727.789] -- 0:01:01 781500 -- (-3719.774) (-3726.082) [-3729.251] (-3723.032) * (-3722.167) (-3721.377) (-3719.939) [-3722.246] -- 0:01:01 782000 -- (-3728.206) (-3727.761) (-3726.439) [-3721.432] * (-3726.329) [-3720.256] (-3723.480) (-3728.930) -- 0:01:01 782500 -- [-3720.354] (-3719.798) (-3718.036) (-3724.956) * [-3722.069] (-3721.980) (-3721.609) (-3728.739) -- 0:01:01 783000 -- (-3726.750) (-3729.844) [-3722.292] (-3727.131) * (-3737.094) [-3719.777] (-3720.094) (-3718.726) -- 0:01:01 783500 -- [-3724.609] (-3718.835) (-3722.740) (-3725.355) * [-3723.204] (-3722.336) (-3721.700) (-3722.834) -- 0:01:01 784000 -- (-3721.621) [-3718.239] (-3725.322) (-3735.492) * (-3723.475) (-3722.564) [-3721.010] (-3717.911) -- 0:01:01 784500 -- (-3720.908) (-3723.711) [-3720.462] (-3724.327) * [-3723.884] (-3723.708) (-3728.049) (-3726.648) -- 0:01:00 785000 -- [-3734.774] (-3725.071) (-3720.818) (-3726.272) * (-3726.404) [-3724.221] (-3724.599) (-3728.120) -- 0:01:00 Average standard deviation of split frequencies: 0.000000 785500 -- [-3725.938] (-3722.443) (-3721.892) (-3727.629) * (-3729.933) (-3722.927) (-3730.844) [-3720.594] -- 0:01:00 786000 -- (-3720.341) (-3718.335) [-3727.127] (-3720.917) * (-3724.424) (-3721.434) [-3728.441] (-3721.147) -- 0:01:00 786500 -- (-3722.848) [-3722.254] (-3726.787) (-3724.059) * (-3731.411) [-3719.672] (-3726.545) (-3719.323) -- 0:01:00 787000 -- [-3725.180] (-3726.197) (-3720.806) (-3722.196) * (-3721.718) [-3722.147] (-3722.034) (-3722.884) -- 0:01:00 787500 -- (-3725.774) [-3725.044] (-3720.857) (-3722.738) * (-3724.120) (-3723.755) [-3722.668] (-3724.212) -- 0:01:00 788000 -- [-3718.379] (-3719.332) (-3721.043) (-3728.608) * [-3724.665] (-3723.617) (-3732.602) (-3720.625) -- 0:00:59 788500 -- [-3722.607] (-3726.750) (-3722.111) (-3724.564) * (-3728.254) (-3721.807) (-3721.927) [-3735.826] -- 0:00:59 789000 -- (-3723.315) (-3721.046) [-3725.250] (-3724.985) * (-3722.573) (-3729.342) (-3720.899) [-3724.866] -- 0:00:59 789500 -- (-3726.834) (-3723.417) [-3722.469] (-3725.308) * (-3724.876) (-3721.651) (-3728.241) [-3723.099] -- 0:00:59 790000 -- [-3719.374] (-3730.257) (-3720.158) (-3719.670) * (-3726.304) (-3722.706) [-3720.130] (-3727.745) -- 0:00:59 Average standard deviation of split frequencies: 0.000000 790500 -- [-3725.108] (-3720.323) (-3726.775) (-3725.030) * [-3726.639] (-3725.217) (-3724.478) (-3725.153) -- 0:00:59 791000 -- (-3718.463) (-3719.541) [-3724.326] (-3721.008) * (-3727.980) (-3720.611) [-3719.369] (-3726.925) -- 0:00:59 791500 -- (-3722.413) (-3722.269) [-3720.704] (-3722.224) * (-3723.900) (-3722.711) (-3725.519) [-3727.867] -- 0:00:59 792000 -- (-3718.869) (-3723.901) (-3726.289) [-3720.042] * (-3720.749) (-3720.531) [-3723.636] (-3721.970) -- 0:00:58 792500 -- (-3721.074) (-3722.841) (-3721.985) [-3720.571] * (-3722.010) (-3724.272) (-3723.232) [-3723.900] -- 0:00:58 793000 -- (-3723.488) [-3723.847] (-3724.002) (-3725.332) * (-3720.655) (-3726.970) [-3721.519] (-3723.312) -- 0:00:58 793500 -- (-3727.612) [-3724.414] (-3732.036) (-3724.736) * (-3727.739) (-3720.956) [-3723.841] (-3723.009) -- 0:00:58 794000 -- [-3722.173] (-3725.958) (-3719.651) (-3728.559) * (-3722.830) (-3721.655) [-3723.628] (-3727.288) -- 0:00:58 794500 -- (-3728.715) (-3723.275) [-3724.796] (-3728.902) * (-3730.303) (-3718.022) [-3721.910] (-3730.008) -- 0:00:58 795000 -- (-3730.004) [-3724.144] (-3723.509) (-3729.084) * (-3721.937) (-3719.478) (-3720.253) [-3722.782] -- 0:00:58 Average standard deviation of split frequencies: 0.000000 795500 -- [-3728.842] (-3734.274) (-3725.092) (-3721.852) * (-3727.647) (-3722.848) [-3718.303] (-3725.656) -- 0:00:57 796000 -- (-3725.613) (-3717.380) [-3731.615] (-3722.689) * (-3720.470) (-3719.011) [-3722.607] (-3722.419) -- 0:00:57 796500 -- (-3722.440) (-3723.683) (-3729.899) [-3723.627] * (-3726.814) (-3723.753) (-3721.744) [-3720.714] -- 0:00:57 797000 -- (-3717.662) (-3729.474) (-3726.227) [-3720.880] * [-3722.319] (-3725.433) (-3724.513) (-3723.793) -- 0:00:57 797500 -- (-3728.058) [-3722.537] (-3725.920) (-3723.015) * [-3723.115] (-3724.276) (-3723.811) (-3726.925) -- 0:00:57 798000 -- [-3722.824] (-3728.612) (-3723.630) (-3728.334) * (-3723.345) [-3724.647] (-3721.595) (-3724.512) -- 0:00:57 798500 -- (-3723.848) (-3728.343) [-3723.451] (-3727.449) * (-3723.096) (-3723.897) [-3724.402] (-3722.046) -- 0:00:57 799000 -- [-3717.226] (-3720.725) (-3719.638) (-3720.396) * (-3718.782) (-3722.536) [-3722.095] (-3723.668) -- 0:00:56 799500 -- (-3720.775) (-3729.150) (-3724.674) [-3722.079] * (-3724.757) (-3728.808) (-3729.325) [-3724.832] -- 0:00:56 800000 -- [-3718.953] (-3727.755) (-3721.424) (-3729.966) * (-3727.467) (-3729.062) [-3719.179] (-3726.316) -- 0:00:56 Average standard deviation of split frequencies: 0.000000 800500 -- [-3719.362] (-3722.251) (-3725.721) (-3721.784) * (-3724.769) [-3722.205] (-3720.358) (-3727.598) -- 0:00:56 801000 -- [-3725.824] (-3729.036) (-3729.881) (-3725.213) * (-3725.501) (-3726.251) (-3724.972) [-3725.875] -- 0:00:56 801500 -- (-3723.667) (-3730.795) (-3721.748) [-3722.635] * (-3733.367) (-3727.687) (-3725.806) [-3718.528] -- 0:00:56 802000 -- (-3722.273) (-3722.809) (-3719.513) [-3727.774] * [-3725.409] (-3733.681) (-3725.181) (-3722.922) -- 0:00:56 802500 -- (-3723.651) (-3723.737) [-3725.108] (-3723.480) * (-3723.031) (-3724.638) (-3726.451) [-3721.917] -- 0:00:55 803000 -- (-3721.567) (-3727.874) (-3719.441) [-3718.450] * (-3724.987) (-3721.152) (-3718.986) [-3725.210] -- 0:00:55 803500 -- (-3718.561) [-3723.534] (-3719.827) (-3724.918) * (-3727.777) (-3720.781) [-3720.931] (-3725.742) -- 0:00:55 804000 -- (-3724.784) (-3726.794) [-3721.180] (-3733.670) * (-3718.145) (-3718.902) (-3723.152) [-3723.230] -- 0:00:55 804500 -- (-3727.871) (-3723.447) (-3722.744) [-3722.500] * [-3718.783] (-3721.804) (-3729.696) (-3721.473) -- 0:00:55 805000 -- (-3724.612) (-3717.665) [-3719.275] (-3726.147) * [-3727.176] (-3728.139) (-3724.140) (-3728.172) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 805500 -- (-3723.575) (-3720.662) [-3722.480] (-3732.818) * (-3726.863) (-3722.272) [-3724.796] (-3719.408) -- 0:00:55 806000 -- (-3728.352) [-3717.178] (-3720.110) (-3731.717) * (-3729.916) (-3728.754) [-3719.016] (-3729.790) -- 0:00:54 806500 -- (-3724.902) (-3721.039) (-3720.827) [-3721.614] * (-3723.308) (-3726.060) (-3721.671) [-3729.146] -- 0:00:54 807000 -- (-3724.651) (-3724.615) [-3717.030] (-3726.668) * (-3729.962) (-3721.781) (-3728.172) [-3721.053] -- 0:00:54 807500 -- (-3728.708) [-3729.410] (-3726.806) (-3720.265) * [-3725.749] (-3721.891) (-3723.373) (-3719.367) -- 0:00:54 808000 -- (-3725.174) [-3725.399] (-3723.630) (-3723.264) * (-3727.113) (-3722.654) [-3721.025] (-3718.494) -- 0:00:54 808500 -- (-3728.411) (-3725.326) (-3724.176) [-3721.782] * [-3717.153] (-3721.611) (-3726.900) (-3720.779) -- 0:00:54 809000 -- (-3733.326) (-3723.788) (-3733.711) [-3719.456] * (-3723.131) (-3722.469) [-3729.103] (-3722.195) -- 0:00:54 809500 -- (-3720.320) (-3724.607) (-3722.330) [-3724.666] * (-3726.575) (-3722.508) [-3725.128] (-3725.278) -- 0:00:53 810000 -- (-3722.191) (-3721.774) (-3726.781) [-3724.392] * [-3720.429] (-3727.294) (-3722.986) (-3725.709) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 810500 -- (-3720.952) (-3718.481) [-3717.433] (-3726.131) * (-3727.425) (-3729.069) [-3722.790] (-3723.397) -- 0:00:53 811000 -- (-3723.009) (-3724.267) (-3725.243) [-3720.602] * [-3721.442] (-3726.647) (-3716.906) (-3726.159) -- 0:00:53 811500 -- (-3723.818) (-3719.793) (-3729.678) [-3726.713] * (-3722.173) [-3722.602] (-3723.485) (-3722.116) -- 0:00:53 812000 -- (-3723.234) [-3724.200] (-3723.663) (-3723.280) * (-3725.340) (-3720.592) [-3718.247] (-3723.024) -- 0:00:53 812500 -- (-3723.295) (-3724.772) (-3724.435) [-3719.041] * [-3725.024] (-3718.806) (-3719.103) (-3722.876) -- 0:00:53 813000 -- (-3729.240) [-3719.321] (-3726.349) (-3723.066) * (-3723.157) (-3722.080) [-3721.253] (-3717.126) -- 0:00:52 813500 -- (-3727.590) (-3717.329) [-3721.990] (-3720.512) * [-3719.840] (-3719.052) (-3724.152) (-3720.574) -- 0:00:52 814000 -- (-3725.083) (-3718.409) (-3718.475) [-3726.630] * (-3724.604) (-3726.540) (-3719.953) [-3723.378] -- 0:00:52 814500 -- [-3716.851] (-3723.417) (-3718.773) (-3724.066) * (-3729.476) (-3724.298) (-3726.772) [-3721.278] -- 0:00:52 815000 -- (-3723.333) (-3725.475) [-3719.596] (-3725.978) * (-3722.581) (-3721.641) [-3720.226] (-3724.305) -- 0:00:52 Average standard deviation of split frequencies: 0.000000 815500 -- (-3721.168) (-3722.394) [-3720.993] (-3722.558) * (-3725.519) (-3724.000) [-3722.036] (-3720.899) -- 0:00:52 816000 -- (-3719.128) (-3724.385) [-3725.088] (-3723.302) * (-3720.573) [-3724.027] (-3722.098) (-3723.749) -- 0:00:52 816500 -- (-3720.151) (-3721.695) (-3718.817) [-3728.381] * (-3721.789) (-3725.101) (-3720.256) [-3719.917] -- 0:00:51 817000 -- [-3722.821] (-3734.524) (-3720.092) (-3718.069) * (-3720.248) (-3736.230) [-3721.097] (-3726.956) -- 0:00:51 817500 -- (-3726.458) (-3727.101) [-3725.036] (-3720.304) * (-3716.661) (-3729.100) [-3719.787] (-3721.064) -- 0:00:51 818000 -- [-3727.092] (-3729.356) (-3719.344) (-3722.740) * (-3721.457) (-3726.881) [-3723.175] (-3724.748) -- 0:00:51 818500 -- (-3720.581) (-3725.675) [-3724.112] (-3720.334) * [-3719.122] (-3722.988) (-3727.669) (-3720.347) -- 0:00:51 819000 -- (-3721.320) (-3721.373) (-3720.857) [-3725.222] * (-3720.013) (-3722.010) (-3721.764) [-3720.401] -- 0:00:51 819500 -- (-3721.723) (-3725.467) [-3724.159] (-3722.564) * [-3719.601] (-3719.714) (-3722.925) (-3721.606) -- 0:00:51 820000 -- (-3730.566) (-3722.049) (-3721.091) [-3725.050] * (-3725.875) (-3722.037) [-3719.326] (-3724.613) -- 0:00:50 Average standard deviation of split frequencies: 0.000000 820500 -- (-3725.794) [-3722.640] (-3720.273) (-3722.479) * (-3727.576) [-3722.662] (-3720.786) (-3722.368) -- 0:00:50 821000 -- [-3722.275] (-3718.677) (-3722.420) (-3722.845) * (-3725.081) [-3719.937] (-3721.312) (-3725.289) -- 0:00:50 821500 -- [-3721.204] (-3717.754) (-3728.547) (-3723.128) * (-3725.145) (-3717.169) [-3722.637] (-3719.814) -- 0:00:50 822000 -- (-3723.857) (-3719.062) [-3724.242] (-3731.362) * (-3724.412) (-3725.487) [-3724.526] (-3720.972) -- 0:00:50 822500 -- (-3722.063) (-3719.121) [-3721.920] (-3723.219) * (-3728.076) (-3726.041) [-3727.790] (-3724.305) -- 0:00:50 823000 -- (-3723.405) (-3721.799) (-3720.372) [-3722.800] * [-3723.344] (-3730.653) (-3728.541) (-3722.639) -- 0:00:50 823500 -- [-3717.832] (-3724.956) (-3726.581) (-3720.873) * (-3722.732) (-3735.559) (-3722.004) [-3718.056] -- 0:00:49 824000 -- [-3724.061] (-3721.416) (-3725.840) (-3719.991) * [-3723.862] (-3732.552) (-3726.738) (-3723.755) -- 0:00:49 824500 -- (-3722.052) (-3721.710) (-3722.614) [-3718.945] * (-3725.172) (-3736.838) (-3724.408) [-3722.197] -- 0:00:49 825000 -- (-3717.347) (-3721.008) (-3727.025) [-3718.765] * (-3723.744) [-3719.130] (-3727.101) (-3721.341) -- 0:00:49 Average standard deviation of split frequencies: 0.000000 825500 -- (-3721.732) (-3723.643) (-3723.979) [-3722.335] * (-3726.788) [-3719.575] (-3723.585) (-3719.893) -- 0:00:49 826000 -- (-3722.272) (-3720.798) (-3728.592) [-3725.518] * (-3722.257) [-3723.428] (-3723.851) (-3724.068) -- 0:00:49 826500 -- [-3723.249] (-3722.791) (-3722.514) (-3725.454) * (-3724.005) (-3720.269) [-3726.702] (-3725.521) -- 0:00:49 827000 -- (-3719.628) (-3728.310) (-3722.769) [-3723.780] * (-3721.026) (-3718.630) (-3726.117) [-3728.251] -- 0:00:48 827500 -- (-3728.263) [-3721.157] (-3721.711) (-3726.733) * [-3725.555] (-3722.442) (-3727.083) (-3720.059) -- 0:00:48 828000 -- (-3724.711) (-3723.797) [-3724.823] (-3725.868) * (-3727.909) (-3721.062) (-3720.118) [-3722.211] -- 0:00:48 828500 -- (-3730.295) [-3725.935] (-3720.532) (-3718.170) * (-3720.377) (-3717.249) (-3725.473) [-3717.567] -- 0:00:48 829000 -- (-3733.629) (-3726.435) [-3720.948] (-3720.266) * [-3722.216] (-3722.770) (-3726.616) (-3719.513) -- 0:00:48 829500 -- (-3727.231) [-3721.824] (-3724.003) (-3719.051) * (-3728.168) (-3723.730) [-3721.351] (-3718.211) -- 0:00:48 830000 -- (-3723.705) (-3723.415) [-3726.259] (-3729.423) * [-3720.300] (-3720.988) (-3722.658) (-3723.511) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 830500 -- [-3725.806] (-3717.877) (-3721.800) (-3731.848) * (-3726.785) (-3725.740) (-3720.604) [-3719.185] -- 0:00:47 831000 -- (-3724.165) (-3720.724) (-3722.190) [-3721.512] * (-3727.324) (-3720.058) [-3725.670] (-3728.107) -- 0:00:47 831500 -- (-3724.158) (-3723.195) (-3723.396) [-3717.616] * (-3721.121) (-3728.992) [-3717.950] (-3722.438) -- 0:00:47 832000 -- (-3716.874) (-3721.581) (-3721.884) [-3722.621] * [-3719.755] (-3724.294) (-3730.914) (-3722.872) -- 0:00:47 832500 -- (-3718.570) (-3723.031) (-3729.889) [-3719.065] * [-3722.100] (-3719.894) (-3726.165) (-3724.689) -- 0:00:47 833000 -- (-3728.109) (-3726.855) [-3725.288] (-3725.949) * (-3721.430) (-3721.988) [-3722.651] (-3731.190) -- 0:00:47 833500 -- (-3723.974) [-3723.349] (-3728.101) (-3724.564) * [-3724.654] (-3729.186) (-3720.622) (-3725.804) -- 0:00:47 834000 -- [-3718.663] (-3731.779) (-3728.146) (-3724.423) * (-3718.902) (-3725.483) [-3720.580] (-3722.868) -- 0:00:46 834500 -- [-3726.163] (-3720.892) (-3724.621) (-3721.401) * (-3727.917) [-3722.869] (-3721.321) (-3726.566) -- 0:00:46 835000 -- (-3718.940) (-3724.885) (-3725.057) [-3723.756] * [-3729.974] (-3722.153) (-3723.104) (-3727.208) -- 0:00:46 Average standard deviation of split frequencies: 0.000000 835500 -- (-3726.585) (-3723.614) [-3718.914] (-3729.751) * [-3719.584] (-3720.230) (-3721.864) (-3728.613) -- 0:00:46 836000 -- [-3723.266] (-3724.382) (-3727.804) (-3726.186) * (-3722.952) (-3722.150) [-3720.432] (-3724.648) -- 0:00:46 836500 -- (-3720.743) [-3718.432] (-3721.796) (-3724.410) * (-3724.505) (-3723.886) (-3725.116) [-3727.880] -- 0:00:46 837000 -- (-3722.789) (-3723.750) [-3725.487] (-3724.353) * (-3718.607) (-3723.397) [-3724.309] (-3722.057) -- 0:00:46 837500 -- (-3729.068) (-3723.637) [-3718.749] (-3724.691) * [-3720.268] (-3720.454) (-3726.011) (-3722.733) -- 0:00:45 838000 -- (-3718.683) (-3726.188) [-3721.046] (-3724.087) * (-3722.201) (-3724.865) [-3724.585] (-3724.226) -- 0:00:45 838500 -- [-3723.083] (-3725.034) (-3719.495) (-3719.863) * [-3719.667] (-3731.736) (-3723.508) (-3723.287) -- 0:00:45 839000 -- (-3719.897) (-3729.035) (-3720.414) [-3718.825] * (-3719.913) (-3724.808) [-3719.897] (-3723.020) -- 0:00:45 839500 -- [-3718.519] (-3723.353) (-3727.253) (-3723.044) * (-3724.100) [-3720.337] (-3728.299) (-3718.337) -- 0:00:45 840000 -- (-3717.789) (-3722.198) [-3717.191] (-3718.425) * (-3722.491) [-3717.553] (-3723.679) (-3722.664) -- 0:00:45 Average standard deviation of split frequencies: 0.000000 840500 -- (-3726.428) [-3723.858] (-3716.790) (-3725.408) * (-3723.265) [-3723.828] (-3721.440) (-3722.675) -- 0:00:45 841000 -- (-3723.573) (-3722.975) [-3721.202] (-3724.166) * (-3725.093) (-3723.766) [-3723.324] (-3723.993) -- 0:00:44 841500 -- [-3728.751] (-3724.812) (-3716.252) (-3724.427) * (-3721.792) [-3718.120] (-3718.819) (-3720.019) -- 0:00:44 842000 -- (-3722.370) [-3724.509] (-3718.990) (-3725.643) * (-3718.297) (-3728.794) (-3728.012) [-3719.574] -- 0:00:44 842500 -- [-3723.157] (-3723.754) (-3724.532) (-3737.160) * (-3720.301) (-3722.637) [-3718.784] (-3718.754) -- 0:00:44 843000 -- (-3719.538) (-3722.570) [-3724.133] (-3722.076) * (-3720.678) (-3718.483) [-3724.536] (-3723.182) -- 0:00:44 843500 -- [-3717.961] (-3723.640) (-3726.452) (-3719.663) * (-3726.871) [-3722.489] (-3724.625) (-3720.906) -- 0:00:44 844000 -- (-3719.021) (-3722.864) [-3725.557] (-3725.894) * (-3731.844) (-3723.541) (-3725.539) [-3722.154] -- 0:00:44 844500 -- (-3717.764) (-3722.996) [-3720.885] (-3722.641) * [-3720.119] (-3728.560) (-3721.731) (-3719.371) -- 0:00:44 845000 -- (-3723.495) (-3724.089) (-3733.372) [-3722.641] * (-3727.894) (-3730.239) (-3720.540) [-3723.956] -- 0:00:43 Average standard deviation of split frequencies: 0.000000 845500 -- (-3717.957) [-3720.780] (-3731.847) (-3724.884) * (-3721.547) [-3721.019] (-3731.099) (-3726.233) -- 0:00:43 846000 -- (-3720.382) (-3726.950) (-3727.138) [-3722.615] * [-3717.335] (-3727.666) (-3723.143) (-3725.713) -- 0:00:43 846500 -- (-3729.364) (-3725.688) [-3722.751] (-3723.279) * (-3720.751) [-3729.989] (-3721.563) (-3726.784) -- 0:00:43 847000 -- [-3719.948] (-3724.815) (-3723.266) (-3723.606) * [-3725.090] (-3721.907) (-3724.016) (-3722.887) -- 0:00:43 847500 -- (-3728.678) [-3722.692] (-3732.983) (-3725.796) * (-3725.718) (-3723.189) (-3722.917) [-3726.223] -- 0:00:43 848000 -- (-3721.783) (-3732.631) (-3719.979) [-3730.410] * (-3728.571) [-3722.959] (-3724.633) (-3719.693) -- 0:00:43 848500 -- [-3719.489] (-3725.899) (-3725.388) (-3733.568) * (-3733.432) [-3725.303] (-3727.002) (-3721.470) -- 0:00:42 849000 -- (-3723.938) [-3728.309] (-3726.494) (-3728.480) * (-3729.374) [-3722.557] (-3722.954) (-3725.821) -- 0:00:42 849500 -- (-3717.140) [-3719.895] (-3730.284) (-3728.440) * [-3723.025] (-3720.249) (-3721.681) (-3720.105) -- 0:00:42 850000 -- (-3722.910) [-3717.888] (-3726.440) (-3723.857) * (-3722.499) (-3721.841) (-3729.055) [-3721.204] -- 0:00:42 Average standard deviation of split frequencies: 0.000000 850500 -- (-3726.224) [-3720.162] (-3721.070) (-3725.740) * (-3722.566) [-3725.829] (-3719.162) (-3722.414) -- 0:00:42 851000 -- (-3722.209) (-3717.736) (-3717.234) [-3719.273] * (-3725.811) [-3724.757] (-3730.628) (-3721.017) -- 0:00:42 851500 -- [-3721.688] (-3722.916) (-3720.578) (-3721.027) * (-3720.543) (-3722.958) (-3723.897) [-3722.109] -- 0:00:42 852000 -- (-3721.293) (-3723.139) [-3717.668] (-3724.566) * [-3717.427] (-3723.103) (-3722.249) (-3719.168) -- 0:00:41 852500 -- [-3722.690] (-3724.638) (-3722.230) (-3718.995) * (-3721.896) (-3726.377) (-3726.835) [-3724.790] -- 0:00:41 853000 -- (-3721.624) (-3724.653) (-3725.547) [-3719.826] * (-3723.866) (-3731.241) [-3722.790] (-3724.534) -- 0:00:41 853500 -- [-3721.101] (-3722.418) (-3723.249) (-3721.309) * [-3723.393] (-3725.860) (-3719.578) (-3725.254) -- 0:00:41 854000 -- (-3723.622) [-3724.207] (-3727.760) (-3721.538) * (-3729.011) (-3723.925) (-3719.749) [-3720.473] -- 0:00:41 854500 -- [-3722.144] (-3728.694) (-3720.755) (-3723.423) * [-3728.532] (-3719.702) (-3727.327) (-3726.190) -- 0:00:41 855000 -- (-3723.096) [-3720.152] (-3718.065) (-3721.199) * [-3731.995] (-3725.569) (-3720.894) (-3720.073) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 855500 -- (-3725.579) [-3722.108] (-3720.174) (-3726.158) * (-3728.698) (-3717.935) [-3719.893] (-3725.512) -- 0:00:40 856000 -- (-3729.241) (-3722.786) (-3727.770) [-3725.263] * (-3726.047) [-3718.407] (-3723.397) (-3727.323) -- 0:00:40 856500 -- (-3723.522) (-3725.219) [-3723.723] (-3725.254) * (-3722.242) (-3722.395) [-3718.095] (-3726.714) -- 0:00:40 857000 -- (-3726.532) (-3725.718) (-3722.339) [-3722.902] * (-3726.558) (-3721.771) [-3720.658] (-3723.504) -- 0:00:40 857500 -- (-3720.324) [-3718.973] (-3719.316) (-3722.629) * (-3732.210) [-3720.667] (-3719.907) (-3717.170) -- 0:00:40 858000 -- (-3727.446) [-3721.394] (-3726.275) (-3724.716) * (-3728.654) [-3718.903] (-3721.812) (-3721.423) -- 0:00:40 858500 -- (-3727.825) (-3725.753) (-3728.554) [-3723.926] * (-3722.299) (-3728.185) (-3722.435) [-3725.058] -- 0:00:40 859000 -- (-3724.514) (-3723.276) [-3725.580] (-3723.628) * (-3720.008) (-3722.752) (-3725.310) [-3718.770] -- 0:00:39 859500 -- [-3723.992] (-3720.610) (-3727.320) (-3726.536) * (-3720.737) (-3718.771) [-3721.834] (-3721.236) -- 0:00:39 860000 -- (-3725.015) (-3726.077) [-3724.388] (-3726.604) * (-3729.148) (-3729.696) [-3725.768] (-3724.569) -- 0:00:39 Average standard deviation of split frequencies: 0.000000 860500 -- [-3720.525] (-3721.165) (-3726.109) (-3726.435) * (-3729.613) (-3721.015) [-3727.311] (-3731.860) -- 0:00:39 861000 -- (-3727.030) [-3721.758] (-3723.783) (-3731.967) * [-3717.648] (-3721.161) (-3728.501) (-3724.009) -- 0:00:39 861500 -- (-3724.465) (-3720.914) (-3730.190) [-3719.384] * (-3720.581) (-3723.171) [-3723.918] (-3724.583) -- 0:00:39 862000 -- [-3722.573] (-3719.908) (-3725.234) (-3725.953) * (-3721.067) (-3726.898) (-3718.779) [-3729.346] -- 0:00:39 862500 -- (-3726.973) [-3718.782] (-3720.322) (-3717.236) * (-3731.134) (-3721.315) (-3721.307) [-3718.657] -- 0:00:38 863000 -- (-3720.685) [-3724.784] (-3727.389) (-3720.797) * (-3733.363) (-3719.081) (-3722.631) [-3723.353] -- 0:00:38 863500 -- [-3725.277] (-3727.847) (-3721.244) (-3723.449) * (-3733.159) [-3723.097] (-3722.164) (-3728.930) -- 0:00:38 864000 -- (-3718.508) [-3724.994] (-3717.593) (-3732.239) * (-3727.423) [-3722.309] (-3730.734) (-3720.293) -- 0:00:38 864500 -- (-3722.774) (-3720.677) [-3731.051] (-3723.504) * (-3731.856) (-3727.103) [-3722.326] (-3719.364) -- 0:00:38 865000 -- (-3723.193) (-3718.542) [-3723.427] (-3720.869) * (-3722.327) [-3727.289] (-3720.244) (-3719.212) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 865500 -- [-3720.748] (-3719.306) (-3721.319) (-3722.908) * [-3728.664] (-3725.059) (-3726.448) (-3723.908) -- 0:00:38 866000 -- (-3722.282) (-3721.332) (-3731.630) [-3720.578] * [-3720.846] (-3720.543) (-3722.754) (-3729.911) -- 0:00:37 866500 -- (-3731.378) [-3721.547] (-3727.671) (-3719.633) * (-3722.753) (-3728.986) (-3725.975) [-3727.960] -- 0:00:37 867000 -- (-3721.591) (-3721.904) (-3733.230) [-3721.258] * (-3722.522) (-3724.755) (-3726.936) [-3721.272] -- 0:00:37 867500 -- (-3718.005) (-3721.559) (-3721.620) [-3725.135] * [-3724.267] (-3724.284) (-3728.577) (-3720.075) -- 0:00:37 868000 -- [-3723.225] (-3724.165) (-3730.313) (-3728.271) * (-3718.882) (-3720.913) (-3730.929) [-3718.334] -- 0:00:37 868500 -- (-3723.259) (-3726.113) [-3718.319] (-3722.199) * (-3721.111) [-3719.094] (-3723.275) (-3722.721) -- 0:00:37 869000 -- (-3725.314) (-3734.641) [-3719.116] (-3722.853) * (-3722.338) [-3724.245] (-3728.405) (-3720.025) -- 0:00:37 869500 -- (-3724.590) (-3732.602) [-3719.267] (-3724.084) * [-3723.203] (-3724.340) (-3722.394) (-3730.762) -- 0:00:36 870000 -- [-3724.198] (-3730.660) (-3720.783) (-3723.027) * (-3726.828) [-3723.943] (-3722.760) (-3721.965) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 870500 -- [-3719.714] (-3725.207) (-3730.035) (-3724.007) * [-3721.524] (-3720.232) (-3726.338) (-3729.226) -- 0:00:36 871000 -- (-3721.560) [-3726.702] (-3718.865) (-3725.606) * (-3716.658) [-3719.543] (-3721.938) (-3718.527) -- 0:00:36 871500 -- (-3725.099) (-3723.727) (-3719.663) [-3724.957] * [-3719.775] (-3721.261) (-3723.785) (-3722.566) -- 0:00:36 872000 -- (-3723.559) (-3723.574) [-3723.923] (-3722.435) * (-3727.283) (-3719.669) (-3720.925) [-3725.138] -- 0:00:36 872500 -- (-3723.744) (-3725.001) (-3723.365) [-3719.500] * (-3724.227) (-3724.264) [-3720.810] (-3720.019) -- 0:00:36 873000 -- (-3725.731) (-3727.060) [-3722.993] (-3722.463) * (-3722.452) [-3717.655] (-3727.449) (-3723.909) -- 0:00:35 873500 -- [-3723.305] (-3728.420) (-3719.893) (-3720.007) * (-3723.075) (-3727.065) (-3719.227) [-3719.998] -- 0:00:35 874000 -- (-3726.832) (-3717.948) (-3720.247) [-3720.277] * [-3720.074] (-3729.500) (-3718.112) (-3722.327) -- 0:00:35 874500 -- (-3725.857) (-3726.502) (-3720.613) [-3727.853] * (-3722.578) (-3733.373) (-3721.802) [-3720.754] -- 0:00:35 875000 -- [-3726.883] (-3722.787) (-3727.047) (-3724.677) * (-3722.892) [-3722.438] (-3726.241) (-3723.426) -- 0:00:35 Average standard deviation of split frequencies: 0.000000 875500 -- [-3721.388] (-3728.637) (-3725.922) (-3726.464) * (-3725.204) (-3733.113) (-3722.590) [-3721.148] -- 0:00:35 876000 -- (-3719.003) (-3731.003) [-3721.258] (-3727.852) * (-3724.996) (-3721.869) (-3726.843) [-3719.029] -- 0:00:35 876500 -- [-3721.896] (-3729.349) (-3724.040) (-3723.363) * (-3724.015) (-3724.477) [-3719.291] (-3719.674) -- 0:00:34 877000 -- [-3722.438] (-3725.159) (-3723.390) (-3730.694) * (-3729.859) (-3727.363) (-3724.685) [-3719.068] -- 0:00:34 877500 -- (-3729.247) (-3722.752) (-3724.697) [-3723.204] * (-3723.845) (-3727.657) (-3724.945) [-3719.700] -- 0:00:34 878000 -- (-3726.067) (-3720.534) (-3729.429) [-3727.273] * [-3725.553] (-3723.807) (-3723.395) (-3719.211) -- 0:00:34 878500 -- (-3717.607) (-3721.841) (-3722.890) [-3725.454] * (-3726.097) (-3732.371) (-3721.151) [-3721.827] -- 0:00:34 879000 -- (-3721.246) (-3722.900) (-3721.247) [-3722.568] * (-3725.870) (-3723.945) (-3720.016) [-3721.515] -- 0:00:34 879500 -- (-3718.767) (-3725.193) (-3723.777) [-3722.726] * (-3731.928) (-3720.694) (-3719.353) [-3724.617] -- 0:00:34 880000 -- (-3727.375) (-3727.923) [-3726.524] (-3719.564) * (-3724.611) (-3720.255) (-3728.626) [-3722.205] -- 0:00:33 Average standard deviation of split frequencies: 0.000000 880500 -- (-3718.902) [-3718.940] (-3725.190) (-3719.348) * (-3723.837) (-3723.851) (-3718.868) [-3716.502] -- 0:00:33 881000 -- (-3723.401) [-3720.665] (-3720.027) (-3720.533) * (-3725.401) [-3723.135] (-3720.214) (-3722.783) -- 0:00:33 881500 -- (-3721.197) (-3718.536) (-3722.278) [-3721.487] * (-3725.433) [-3724.765] (-3728.089) (-3723.069) -- 0:00:33 882000 -- (-3720.224) [-3721.581] (-3720.834) (-3720.872) * (-3719.226) [-3723.102] (-3720.175) (-3726.278) -- 0:00:33 882500 -- [-3720.391] (-3725.232) (-3723.721) (-3721.599) * (-3730.618) (-3721.118) (-3721.503) [-3722.944] -- 0:00:33 883000 -- (-3722.766) [-3722.084] (-3728.881) (-3720.926) * (-3728.178) (-3723.249) [-3722.817] (-3720.792) -- 0:00:33 883500 -- (-3726.898) [-3721.880] (-3729.490) (-3725.309) * (-3722.188) (-3726.788) (-3729.410) [-3725.514] -- 0:00:32 884000 -- (-3721.293) [-3719.067] (-3723.863) (-3725.101) * [-3721.087] (-3719.222) (-3721.005) (-3719.297) -- 0:00:32 884500 -- [-3719.657] (-3722.358) (-3720.809) (-3727.534) * (-3723.158) [-3723.293] (-3726.981) (-3724.939) -- 0:00:32 885000 -- (-3717.647) [-3723.953] (-3718.290) (-3727.601) * [-3718.875] (-3720.783) (-3721.809) (-3720.610) -- 0:00:32 Average standard deviation of split frequencies: 0.000000 885500 -- (-3726.270) [-3718.237] (-3722.638) (-3722.944) * [-3720.268] (-3722.434) (-3719.916) (-3718.635) -- 0:00:32 886000 -- (-3721.639) [-3719.341] (-3729.328) (-3723.023) * (-3724.253) (-3724.341) (-3721.930) [-3724.059] -- 0:00:32 886500 -- (-3721.670) (-3719.312) (-3724.442) [-3720.999] * (-3716.456) (-3725.104) (-3717.293) [-3722.691] -- 0:00:32 887000 -- [-3719.928] (-3726.357) (-3721.585) (-3722.885) * (-3721.645) (-3733.544) [-3718.270] (-3723.357) -- 0:00:31 887500 -- (-3729.903) (-3724.849) [-3719.953] (-3730.674) * [-3723.524] (-3721.529) (-3719.932) (-3722.718) -- 0:00:31 888000 -- (-3725.181) (-3728.754) [-3722.527] (-3724.070) * [-3721.731] (-3719.613) (-3723.317) (-3731.729) -- 0:00:31 888500 -- (-3728.298) (-3724.205) (-3726.072) [-3719.562] * (-3729.220) [-3722.436] (-3726.941) (-3719.821) -- 0:00:31 889000 -- (-3721.284) (-3722.794) [-3717.815] (-3718.768) * (-3723.277) [-3722.689] (-3723.031) (-3726.539) -- 0:00:31 889500 -- (-3725.576) [-3722.217] (-3717.524) (-3721.042) * [-3723.579] (-3722.759) (-3716.504) (-3721.103) -- 0:00:31 890000 -- [-3722.290] (-3722.274) (-3726.852) (-3723.950) * (-3722.394) (-3720.314) [-3722.564] (-3725.750) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 890500 -- (-3725.666) (-3731.338) (-3721.430) [-3723.501] * (-3727.958) [-3721.452] (-3718.591) (-3730.505) -- 0:00:30 891000 -- (-3729.429) [-3726.259] (-3726.825) (-3722.157) * (-3724.860) (-3721.728) (-3719.284) [-3729.214] -- 0:00:30 891500 -- (-3721.658) (-3721.711) (-3724.668) [-3721.625] * (-3729.578) (-3723.411) (-3719.855) [-3722.039] -- 0:00:30 892000 -- [-3721.643] (-3724.947) (-3724.879) (-3723.184) * [-3722.533] (-3722.219) (-3726.703) (-3722.394) -- 0:00:30 892500 -- (-3727.765) [-3723.719] (-3729.231) (-3716.599) * (-3724.963) (-3725.152) (-3720.223) [-3721.704] -- 0:00:30 893000 -- (-3724.062) [-3722.459] (-3732.709) (-3722.192) * [-3717.977] (-3722.558) (-3720.105) (-3723.620) -- 0:00:30 893500 -- (-3726.351) [-3722.900] (-3724.510) (-3722.509) * (-3719.819) (-3721.483) [-3723.069] (-3720.308) -- 0:00:30 894000 -- (-3724.914) (-3731.710) [-3720.110] (-3721.298) * (-3721.387) [-3723.317] (-3725.382) (-3723.765) -- 0:00:29 894500 -- (-3726.182) [-3729.970] (-3718.905) (-3720.199) * [-3719.516] (-3721.080) (-3720.300) (-3718.598) -- 0:00:29 895000 -- (-3728.028) (-3719.648) (-3725.327) [-3723.129] * (-3722.003) [-3721.425] (-3722.406) (-3720.795) -- 0:00:29 Average standard deviation of split frequencies: 0.000000 895500 -- (-3730.549) [-3720.048] (-3723.737) (-3720.331) * (-3718.988) (-3723.139) [-3721.773] (-3717.400) -- 0:00:29 896000 -- (-3726.206) (-3723.231) [-3720.586] (-3716.852) * (-3726.910) (-3720.530) [-3719.266] (-3720.506) -- 0:00:29 896500 -- [-3721.953] (-3720.738) (-3719.648) (-3721.106) * (-3724.072) (-3720.048) [-3720.500] (-3719.398) -- 0:00:29 897000 -- (-3729.194) (-3725.099) [-3722.126] (-3722.034) * (-3724.865) [-3718.032] (-3722.681) (-3727.447) -- 0:00:29 897500 -- (-3721.412) [-3721.665] (-3720.226) (-3722.594) * (-3723.735) [-3723.462] (-3718.212) (-3721.906) -- 0:00:29 898000 -- (-3719.512) (-3717.278) (-3721.897) [-3724.057] * [-3721.106] (-3722.962) (-3718.981) (-3717.968) -- 0:00:28 898500 -- (-3720.915) (-3718.529) (-3728.362) [-3721.038] * (-3728.936) (-3724.016) (-3722.468) [-3719.125] -- 0:00:28 899000 -- (-3721.575) [-3718.158] (-3718.990) (-3725.437) * [-3724.160] (-3728.081) (-3721.483) (-3720.628) -- 0:00:28 899500 -- (-3725.995) (-3719.364) [-3724.597] (-3723.204) * (-3726.634) (-3724.581) [-3721.994] (-3719.045) -- 0:00:28 900000 -- (-3722.400) (-3729.767) [-3719.914] (-3725.128) * (-3718.195) (-3723.601) (-3722.612) [-3720.581] -- 0:00:28 Average standard deviation of split frequencies: 0.000000 900500 -- (-3719.247) (-3730.786) [-3720.701] (-3723.860) * [-3723.073] (-3721.984) (-3728.239) (-3722.531) -- 0:00:28 901000 -- [-3724.042] (-3723.862) (-3721.285) (-3726.184) * [-3717.932] (-3720.728) (-3723.350) (-3727.079) -- 0:00:28 901500 -- (-3720.335) (-3723.715) [-3721.268] (-3725.496) * (-3723.372) (-3725.624) [-3723.409] (-3725.388) -- 0:00:27 902000 -- (-3717.012) [-3721.843] (-3721.404) (-3720.927) * [-3721.534] (-3720.247) (-3721.327) (-3722.131) -- 0:00:27 902500 -- (-3719.673) [-3720.222] (-3727.045) (-3725.289) * [-3720.508] (-3720.927) (-3724.141) (-3726.496) -- 0:00:27 903000 -- (-3723.263) [-3719.881] (-3726.296) (-3733.889) * (-3720.560) (-3723.661) (-3730.110) [-3721.810] -- 0:00:27 903500 -- (-3721.221) (-3727.991) [-3724.030] (-3729.743) * [-3719.203] (-3722.541) (-3723.462) (-3726.151) -- 0:00:27 904000 -- (-3720.940) [-3720.975] (-3717.612) (-3724.081) * (-3723.409) [-3718.050] (-3722.533) (-3721.471) -- 0:00:27 904500 -- (-3721.216) [-3721.475] (-3730.384) (-3723.365) * (-3718.345) [-3722.315] (-3728.927) (-3726.621) -- 0:00:27 905000 -- (-3720.682) [-3719.201] (-3724.745) (-3723.351) * (-3720.566) (-3724.701) (-3720.106) [-3719.754] -- 0:00:26 Average standard deviation of split frequencies: 0.000000 905500 -- (-3722.449) [-3724.430] (-3722.419) (-3732.531) * (-3725.977) [-3718.708] (-3720.487) (-3725.135) -- 0:00:26 906000 -- (-3720.820) (-3725.328) [-3723.338] (-3722.434) * (-3726.748) (-3719.755) [-3723.930] (-3723.682) -- 0:00:26 906500 -- (-3724.694) (-3729.214) (-3716.155) [-3724.592] * (-3721.423) (-3721.239) (-3718.923) [-3721.564] -- 0:00:26 907000 -- (-3724.597) (-3732.638) (-3722.170) [-3720.294] * (-3723.932) (-3722.908) (-3733.536) [-3721.834] -- 0:00:26 907500 -- (-3720.197) [-3724.561] (-3722.078) (-3721.738) * [-3728.065] (-3724.309) (-3730.193) (-3722.972) -- 0:00:26 908000 -- (-3723.357) [-3720.490] (-3721.925) (-3717.172) * [-3721.109] (-3718.073) (-3723.899) (-3731.044) -- 0:00:26 908500 -- (-3723.555) (-3724.015) [-3724.537] (-3725.307) * [-3716.282] (-3723.573) (-3723.343) (-3733.824) -- 0:00:25 909000 -- (-3724.699) [-3722.978] (-3723.815) (-3725.985) * [-3717.095] (-3728.654) (-3723.385) (-3721.627) -- 0:00:25 909500 -- [-3727.128] (-3727.244) (-3724.054) (-3728.489) * [-3719.079] (-3725.771) (-3728.404) (-3722.228) -- 0:00:25 910000 -- [-3723.365] (-3722.911) (-3721.311) (-3720.119) * (-3722.712) (-3721.746) (-3722.267) [-3720.955] -- 0:00:25 Average standard deviation of split frequencies: 0.000000 910500 -- (-3726.659) (-3725.462) [-3720.516] (-3723.927) * [-3717.518] (-3726.018) (-3729.075) (-3717.651) -- 0:00:25 911000 -- (-3723.741) (-3727.884) [-3719.969] (-3724.132) * (-3720.945) (-3727.663) (-3726.048) [-3722.635] -- 0:00:25 911500 -- [-3718.485] (-3723.428) (-3720.368) (-3722.376) * (-3722.351) (-3723.501) [-3725.101] (-3722.255) -- 0:00:25 912000 -- [-3721.400] (-3726.381) (-3722.769) (-3724.383) * (-3723.681) (-3723.423) (-3728.427) [-3720.921] -- 0:00:24 912500 -- (-3729.301) (-3722.032) [-3722.306] (-3725.733) * [-3721.398] (-3723.458) (-3724.059) (-3716.915) -- 0:00:24 913000 -- (-3726.362) [-3724.410] (-3724.157) (-3721.336) * (-3723.401) (-3722.819) (-3729.987) [-3718.154] -- 0:00:24 913500 -- (-3729.260) (-3721.569) (-3721.253) [-3720.967] * (-3720.548) (-3722.940) (-3720.152) [-3717.975] -- 0:00:24 914000 -- (-3724.368) (-3719.902) [-3719.615] (-3716.263) * (-3720.666) (-3726.239) [-3721.216] (-3720.478) -- 0:00:24 914500 -- (-3718.455) (-3723.998) (-3719.698) [-3725.899] * (-3727.517) (-3728.087) [-3719.233] (-3723.333) -- 0:00:24 915000 -- [-3725.026] (-3725.161) (-3724.719) (-3724.001) * (-3721.396) [-3727.068] (-3730.031) (-3722.033) -- 0:00:24 Average standard deviation of split frequencies: 0.000000 915500 -- (-3722.040) [-3720.119] (-3724.715) (-3728.380) * (-3722.945) [-3717.113] (-3722.463) (-3719.227) -- 0:00:23 916000 -- (-3718.437) (-3720.828) (-3727.407) [-3728.671] * (-3724.118) [-3722.896] (-3721.381) (-3721.518) -- 0:00:23 916500 -- (-3729.868) (-3725.487) [-3722.618] (-3729.191) * (-3724.822) [-3718.313] (-3731.602) (-3727.312) -- 0:00:23 917000 -- (-3725.154) (-3730.707) (-3724.987) [-3721.228] * (-3721.189) (-3720.799) [-3726.271] (-3730.018) -- 0:00:23 917500 -- (-3718.092) (-3725.279) (-3722.620) [-3720.900] * (-3719.702) (-3721.659) [-3723.331] (-3722.698) -- 0:00:23 918000 -- [-3723.639] (-3723.924) (-3722.223) (-3727.726) * (-3719.345) (-3722.583) (-3724.530) [-3723.451] -- 0:00:23 918500 -- (-3719.607) (-3724.820) (-3719.665) [-3728.195] * (-3721.974) (-3732.466) (-3729.076) [-3724.599] -- 0:00:23 919000 -- (-3723.308) (-3724.469) [-3721.609] (-3722.499) * [-3722.934] (-3720.424) (-3720.149) (-3719.594) -- 0:00:22 919500 -- [-3719.361] (-3729.569) (-3723.265) (-3717.597) * (-3725.851) [-3724.824] (-3721.442) (-3724.174) -- 0:00:22 920000 -- [-3722.567] (-3728.817) (-3725.908) (-3720.282) * (-3718.452) [-3720.273] (-3719.483) (-3725.616) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 920500 -- [-3718.221] (-3728.750) (-3724.042) (-3722.735) * (-3721.768) (-3718.183) [-3724.741] (-3721.564) -- 0:00:22 921000 -- (-3721.982) [-3719.113] (-3724.250) (-3720.542) * (-3720.852) (-3722.254) [-3723.317] (-3727.416) -- 0:00:22 921500 -- (-3722.598) (-3725.054) (-3723.123) [-3721.278] * [-3727.030] (-3720.915) (-3731.959) (-3722.549) -- 0:00:22 922000 -- (-3726.239) (-3721.275) [-3720.413] (-3723.916) * [-3723.007] (-3722.090) (-3722.584) (-3725.866) -- 0:00:22 922500 -- [-3718.822] (-3716.493) (-3729.687) (-3718.544) * (-3730.176) [-3721.851] (-3724.530) (-3722.330) -- 0:00:21 923000 -- [-3719.438] (-3716.703) (-3723.660) (-3722.258) * (-3723.509) (-3718.438) [-3725.190] (-3721.069) -- 0:00:21 923500 -- (-3725.083) (-3725.804) [-3726.310] (-3727.124) * (-3724.358) (-3726.751) [-3721.720] (-3721.163) -- 0:00:21 924000 -- [-3724.833] (-3721.686) (-3722.693) (-3723.272) * (-3725.414) (-3725.264) [-3722.014] (-3724.084) -- 0:00:21 924500 -- (-3726.022) [-3723.541] (-3728.632) (-3726.666) * [-3725.022] (-3721.132) (-3722.436) (-3724.726) -- 0:00:21 925000 -- (-3739.171) (-3729.496) (-3732.882) [-3730.324] * (-3720.307) (-3720.082) [-3720.847] (-3721.872) -- 0:00:21 Average standard deviation of split frequencies: 0.000000 925500 -- (-3721.703) (-3722.045) (-3724.486) [-3719.844] * [-3717.221] (-3724.475) (-3725.023) (-3722.310) -- 0:00:21 926000 -- (-3720.881) (-3722.544) [-3720.348] (-3724.410) * [-3720.315] (-3721.676) (-3725.995) (-3725.963) -- 0:00:20 926500 -- [-3719.758] (-3730.972) (-3727.010) (-3724.375) * (-3719.622) [-3723.206] (-3726.439) (-3724.949) -- 0:00:20 927000 -- (-3722.034) (-3720.891) (-3725.915) [-3719.239] * [-3722.680] (-3722.968) (-3727.279) (-3721.609) -- 0:00:20 927500 -- [-3719.856] (-3726.068) (-3726.741) (-3721.299) * (-3719.590) (-3731.050) [-3724.639] (-3727.136) -- 0:00:20 928000 -- (-3727.887) (-3720.296) (-3724.752) [-3721.331] * [-3720.493] (-3725.092) (-3728.409) (-3729.369) -- 0:00:20 928500 -- (-3724.643) [-3718.480] (-3720.629) (-3723.370) * (-3721.802) (-3730.893) (-3721.805) [-3724.297] -- 0:00:20 929000 -- (-3721.981) (-3721.670) [-3719.692] (-3720.541) * (-3719.073) [-3722.226] (-3720.528) (-3722.715) -- 0:00:20 929500 -- [-3723.567] (-3717.705) (-3727.661) (-3723.556) * (-3721.560) [-3720.882] (-3720.048) (-3720.390) -- 0:00:19 930000 -- (-3722.812) (-3720.658) (-3721.295) [-3724.120] * (-3721.266) (-3725.309) (-3718.587) [-3720.270] -- 0:00:19 Average standard deviation of split frequencies: 0.000000 930500 -- [-3723.356] (-3719.464) (-3722.264) (-3726.466) * [-3718.049] (-3722.320) (-3719.371) (-3722.285) -- 0:00:19 931000 -- (-3720.734) [-3718.959] (-3720.591) (-3723.162) * (-3725.025) (-3721.872) (-3720.596) [-3719.606] -- 0:00:19 931500 -- (-3718.157) (-3723.895) (-3723.161) [-3725.232] * (-3721.573) (-3719.094) (-3726.120) [-3724.498] -- 0:00:19 932000 -- (-3720.149) [-3720.519] (-3723.832) (-3724.567) * [-3724.772] (-3717.798) (-3724.720) (-3726.085) -- 0:00:19 932500 -- (-3727.093) [-3723.113] (-3723.766) (-3726.341) * (-3722.871) [-3719.200] (-3721.200) (-3719.242) -- 0:00:19 933000 -- [-3723.382] (-3721.440) (-3720.296) (-3722.530) * [-3726.467] (-3719.961) (-3723.583) (-3723.151) -- 0:00:18 933500 -- (-3734.126) (-3722.446) (-3723.377) [-3721.446] * (-3727.701) (-3721.650) (-3724.170) [-3727.070] -- 0:00:18 934000 -- (-3717.852) (-3717.910) (-3727.119) [-3730.393] * (-3724.684) [-3724.141] (-3719.886) (-3723.045) -- 0:00:18 934500 -- (-3720.172) (-3728.058) (-3726.196) [-3720.524] * [-3720.459] (-3723.673) (-3719.737) (-3721.304) -- 0:00:18 935000 -- (-3723.051) [-3723.749] (-3732.021) (-3722.937) * (-3723.708) (-3720.151) (-3721.861) [-3720.643] -- 0:00:18 Average standard deviation of split frequencies: 0.000000 935500 -- (-3719.811) [-3725.534] (-3722.715) (-3722.148) * (-3717.995) (-3721.711) (-3722.430) [-3720.811] -- 0:00:18 936000 -- [-3722.754] (-3717.453) (-3720.722) (-3725.352) * (-3723.998) (-3733.058) [-3720.711] (-3717.238) -- 0:00:18 936500 -- (-3721.227) (-3722.027) (-3719.947) [-3719.827] * (-3727.698) [-3720.647] (-3715.241) (-3724.715) -- 0:00:17 937000 -- (-3719.434) (-3724.507) [-3719.163] (-3721.431) * (-3720.940) (-3722.700) [-3724.016] (-3723.580) -- 0:00:17 937500 -- (-3725.044) (-3725.632) (-3719.640) [-3721.182] * (-3728.373) (-3718.712) (-3725.124) [-3723.550] -- 0:00:17 938000 -- (-3724.987) (-3726.917) (-3723.656) [-3725.998] * [-3725.368] (-3721.160) (-3733.197) (-3721.129) -- 0:00:17 938500 -- [-3722.765] (-3725.076) (-3725.711) (-3721.276) * (-3718.752) (-3726.142) (-3720.987) [-3725.697] -- 0:00:17 939000 -- (-3721.126) (-3721.456) (-3723.714) [-3726.611] * (-3719.974) [-3722.195] (-3723.799) (-3724.030) -- 0:00:17 939500 -- [-3719.422] (-3721.992) (-3721.971) (-3720.482) * (-3724.836) (-3719.756) (-3718.701) [-3732.046] -- 0:00:17 940000 -- (-3716.593) (-3723.490) [-3720.477] (-3725.286) * [-3724.301] (-3721.179) (-3722.573) (-3724.718) -- 0:00:16 Average standard deviation of split frequencies: 0.000000 940500 -- [-3722.781] (-3728.925) (-3726.030) (-3722.282) * (-3727.243) (-3725.553) [-3717.513] (-3720.325) -- 0:00:16 941000 -- (-3722.691) (-3724.296) (-3726.096) [-3727.578] * [-3717.610] (-3722.434) (-3723.465) (-3729.434) -- 0:00:16 941500 -- (-3725.524) (-3727.073) (-3719.305) [-3721.196] * [-3720.739] (-3721.429) (-3720.423) (-3728.421) -- 0:00:16 942000 -- (-3726.523) (-3727.805) [-3718.281] (-3719.745) * (-3725.441) (-3730.013) [-3723.205] (-3729.084) -- 0:00:16 942500 -- (-3719.027) [-3726.131] (-3720.339) (-3721.567) * (-3720.915) [-3722.277] (-3729.699) (-3727.043) -- 0:00:16 943000 -- (-3718.152) (-3735.063) (-3719.373) [-3724.049] * (-3722.372) [-3720.397] (-3724.046) (-3724.839) -- 0:00:16 943500 -- (-3723.968) (-3726.930) (-3722.281) [-3721.344] * (-3718.402) [-3717.490] (-3724.544) (-3727.818) -- 0:00:15 944000 -- (-3724.779) [-3718.602] (-3728.181) (-3718.428) * [-3721.183] (-3720.280) (-3727.493) (-3724.647) -- 0:00:15 944500 -- (-3724.059) [-3718.383] (-3725.511) (-3729.145) * (-3725.217) (-3720.527) [-3722.489] (-3721.041) -- 0:00:15 945000 -- (-3722.201) [-3719.897] (-3718.924) (-3722.173) * (-3734.680) (-3718.793) (-3730.071) [-3719.979] -- 0:00:15 Average standard deviation of split frequencies: 0.000000 945500 -- (-3721.067) (-3726.430) [-3721.654] (-3726.516) * [-3723.449] (-3727.010) (-3723.746) (-3737.142) -- 0:00:15 946000 -- [-3717.410] (-3721.875) (-3720.744) (-3719.476) * (-3721.984) [-3725.060] (-3720.001) (-3718.484) -- 0:00:15 946500 -- [-3717.542] (-3724.117) (-3721.004) (-3722.389) * [-3719.706] (-3718.968) (-3726.983) (-3729.953) -- 0:00:15 947000 -- (-3722.115) [-3725.055] (-3718.686) (-3724.863) * (-3725.057) [-3721.978] (-3725.326) (-3723.072) -- 0:00:14 947500 -- (-3726.289) [-3726.042] (-3721.332) (-3722.769) * (-3732.501) (-3722.612) [-3719.082] (-3718.931) -- 0:00:14 948000 -- (-3723.968) (-3725.999) (-3719.863) [-3724.649] * [-3720.625] (-3719.045) (-3725.087) (-3719.854) -- 0:00:14 948500 -- (-3729.025) (-3723.022) (-3722.584) [-3722.732] * (-3722.767) [-3720.919] (-3724.281) (-3718.466) -- 0:00:14 949000 -- [-3719.853] (-3723.936) (-3729.645) (-3719.548) * (-3723.079) [-3718.916] (-3726.424) (-3721.806) -- 0:00:14 949500 -- [-3723.347] (-3720.083) (-3723.218) (-3718.638) * (-3721.382) [-3721.422] (-3717.802) (-3722.467) -- 0:00:14 950000 -- (-3720.693) (-3727.210) [-3724.382] (-3724.634) * (-3720.911) (-3722.919) [-3723.611] (-3723.511) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 950500 -- [-3724.283] (-3721.951) (-3725.525) (-3721.197) * [-3718.367] (-3717.264) (-3721.500) (-3719.132) -- 0:00:14 951000 -- (-3721.862) (-3726.424) (-3724.968) [-3722.522] * (-3718.143) (-3725.302) (-3721.333) [-3720.242] -- 0:00:13 951500 -- (-3724.856) (-3724.307) (-3728.742) [-3722.444] * (-3721.741) [-3716.968] (-3721.453) (-3726.532) -- 0:00:13 952000 -- (-3722.739) [-3717.772] (-3724.746) (-3720.720) * (-3721.759) (-3716.745) (-3723.841) [-3727.151] -- 0:00:13 952500 -- (-3721.900) (-3721.724) [-3732.271] (-3722.216) * [-3725.804] (-3726.775) (-3718.420) (-3721.428) -- 0:00:13 953000 -- (-3722.082) (-3720.286) (-3724.654) [-3727.197] * (-3728.460) [-3724.459] (-3721.915) (-3724.182) -- 0:00:13 953500 -- (-3731.016) (-3730.805) (-3719.807) [-3715.963] * [-3721.836] (-3721.347) (-3723.186) (-3726.243) -- 0:00:13 954000 -- (-3726.023) [-3723.082] (-3719.808) (-3720.991) * (-3724.921) [-3718.053] (-3730.347) (-3728.002) -- 0:00:13 954500 -- (-3725.982) [-3727.556] (-3730.067) (-3719.866) * (-3722.507) [-3719.271] (-3718.547) (-3729.880) -- 0:00:12 955000 -- (-3729.921) (-3729.662) [-3722.797] (-3720.494) * (-3723.436) [-3722.568] (-3727.699) (-3726.329) -- 0:00:12 Average standard deviation of split frequencies: 0.000000 955500 -- (-3723.788) (-3720.988) [-3728.813] (-3720.268) * [-3723.671] (-3719.084) (-3720.742) (-3725.018) -- 0:00:12 956000 -- (-3722.543) (-3723.693) [-3723.669] (-3726.603) * (-3723.737) (-3725.854) (-3727.401) [-3721.428] -- 0:00:12 956500 -- (-3728.898) [-3721.060] (-3720.560) (-3723.485) * (-3721.476) (-3727.372) (-3722.043) [-3722.082] -- 0:00:12 957000 -- (-3725.868) [-3719.407] (-3720.782) (-3723.559) * [-3719.455] (-3725.902) (-3723.272) (-3719.015) -- 0:00:12 957500 -- (-3720.414) [-3722.574] (-3721.648) (-3734.197) * (-3726.329) [-3728.948] (-3724.267) (-3723.327) -- 0:00:12 958000 -- [-3721.003] (-3724.598) (-3724.747) (-3724.717) * (-3725.396) [-3721.822] (-3722.080) (-3719.533) -- 0:00:11 958500 -- [-3718.416] (-3728.260) (-3725.686) (-3722.568) * (-3721.459) [-3718.337] (-3722.130) (-3722.505) -- 0:00:11 959000 -- [-3721.725] (-3728.153) (-3733.669) (-3725.844) * [-3721.394] (-3718.309) (-3722.814) (-3720.290) -- 0:00:11 959500 -- [-3719.541] (-3727.433) (-3732.492) (-3719.011) * (-3723.155) (-3719.450) [-3723.586] (-3719.166) -- 0:00:11 960000 -- [-3721.456] (-3724.875) (-3724.788) (-3725.950) * (-3726.502) (-3720.122) (-3729.287) [-3721.917] -- 0:00:11 Average standard deviation of split frequencies: 0.000000 960500 -- (-3726.010) (-3727.550) [-3725.903] (-3720.629) * (-3728.315) (-3727.170) [-3726.040] (-3724.191) -- 0:00:11 961000 -- (-3722.867) [-3725.113] (-3722.424) (-3731.519) * (-3727.052) [-3718.087] (-3726.691) (-3724.250) -- 0:00:11 961500 -- [-3720.546] (-3727.615) (-3721.598) (-3730.118) * (-3726.037) (-3720.957) (-3723.659) [-3721.665] -- 0:00:10 962000 -- (-3720.986) (-3726.204) [-3725.878] (-3721.123) * [-3722.335] (-3723.334) (-3719.763) (-3722.423) -- 0:00:10 962500 -- (-3729.422) (-3725.565) (-3726.246) [-3719.726] * (-3729.589) [-3723.350] (-3722.466) (-3723.066) -- 0:00:10 963000 -- (-3724.608) (-3726.335) (-3723.933) [-3716.166] * (-3728.355) (-3723.599) [-3719.998] (-3727.967) -- 0:00:10 963500 -- (-3726.756) (-3721.709) [-3722.623] (-3719.188) * (-3723.762) (-3721.898) (-3721.528) [-3727.958] -- 0:00:10 964000 -- (-3725.688) (-3724.910) [-3721.396] (-3720.937) * [-3722.639] (-3723.315) (-3723.795) (-3729.523) -- 0:00:10 964500 -- (-3724.436) [-3721.734] (-3721.512) (-3721.547) * [-3726.436] (-3719.675) (-3723.748) (-3721.550) -- 0:00:10 965000 -- (-3724.289) (-3722.603) [-3719.943] (-3720.554) * (-3725.782) [-3721.956] (-3722.852) (-3724.018) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 965500 -- [-3718.275] (-3729.562) (-3723.933) (-3724.369) * (-3726.040) [-3721.703] (-3730.630) (-3725.616) -- 0:00:09 966000 -- (-3717.155) [-3721.569] (-3722.199) (-3726.505) * (-3723.147) (-3720.100) (-3725.079) [-3719.822] -- 0:00:09 966500 -- (-3723.780) (-3719.691) (-3723.944) [-3717.261] * (-3720.634) (-3721.674) (-3725.163) [-3717.809] -- 0:00:09 967000 -- (-3722.888) (-3728.601) [-3721.159] (-3725.292) * (-3719.647) [-3719.455] (-3728.913) (-3737.402) -- 0:00:09 967500 -- (-3726.997) (-3724.861) (-3718.834) [-3724.457] * [-3720.741] (-3718.585) (-3724.199) (-3723.599) -- 0:00:09 968000 -- (-3720.732) (-3722.110) [-3719.361] (-3726.375) * (-3723.695) (-3723.275) (-3721.092) [-3720.850] -- 0:00:09 968500 -- [-3724.050] (-3722.722) (-3722.742) (-3717.985) * (-3726.033) (-3718.518) [-3728.017] (-3729.357) -- 0:00:08 969000 -- (-3726.898) (-3721.076) (-3717.167) [-3724.781] * (-3718.329) [-3721.732] (-3724.595) (-3722.639) -- 0:00:08 969500 -- (-3720.278) [-3726.070] (-3720.044) (-3720.913) * [-3719.975] (-3725.066) (-3727.156) (-3725.793) -- 0:00:08 970000 -- (-3723.610) (-3726.127) [-3724.243] (-3722.309) * (-3725.378) [-3720.099] (-3724.329) (-3726.789) -- 0:00:08 Average standard deviation of split frequencies: 0.000000 970500 -- (-3721.495) (-3727.755) (-3720.442) [-3718.509] * (-3723.374) [-3721.727] (-3726.992) (-3723.945) -- 0:00:08 971000 -- (-3721.253) (-3739.487) (-3723.012) [-3724.739] * (-3719.635) (-3729.062) (-3723.528) [-3721.411] -- 0:00:08 971500 -- (-3723.396) [-3726.537] (-3727.119) (-3718.382) * (-3726.884) [-3724.787] (-3723.551) (-3719.993) -- 0:00:08 972000 -- (-3724.585) (-3718.332) (-3725.675) [-3718.626] * (-3720.432) (-3725.918) [-3721.173] (-3721.635) -- 0:00:07 972500 -- (-3717.023) (-3724.238) (-3724.462) [-3719.280] * (-3721.954) (-3727.542) (-3723.075) [-3724.395] -- 0:00:07 973000 -- (-3721.768) (-3719.851) (-3727.183) [-3719.906] * (-3721.917) [-3718.187] (-3726.452) (-3726.994) -- 0:00:07 973500 -- (-3726.128) (-3720.709) (-3717.168) [-3724.911] * (-3720.485) (-3732.351) [-3723.354] (-3719.433) -- 0:00:07 974000 -- [-3723.619] (-3726.817) (-3722.991) (-3719.806) * [-3718.712] (-3725.054) (-3724.704) (-3723.087) -- 0:00:07 974500 -- (-3718.773) (-3724.546) (-3724.252) [-3726.335] * (-3723.329) (-3722.975) (-3732.681) [-3726.496] -- 0:00:07 975000 -- [-3723.969] (-3722.354) (-3724.596) (-3723.987) * (-3726.858) [-3721.678] (-3727.502) (-3727.270) -- 0:00:07 Average standard deviation of split frequencies: 0.000000 975500 -- [-3724.228] (-3718.795) (-3727.517) (-3727.796) * (-3723.341) (-3721.743) (-3725.646) [-3727.049] -- 0:00:06 976000 -- [-3719.975] (-3725.935) (-3723.916) (-3725.719) * (-3723.056) [-3724.583] (-3729.336) (-3721.484) -- 0:00:06 976500 -- (-3731.118) (-3722.117) (-3726.984) [-3728.570] * (-3727.087) (-3721.638) [-3725.135] (-3728.746) -- 0:00:06 977000 -- (-3725.176) (-3722.871) [-3723.583] (-3719.955) * [-3724.088] (-3720.528) (-3721.411) (-3730.462) -- 0:00:06 977500 -- (-3727.131) (-3727.155) (-3723.572) [-3724.362] * [-3720.060] (-3722.191) (-3728.462) (-3726.523) -- 0:00:06 978000 -- [-3720.989] (-3722.627) (-3722.627) (-3728.699) * (-3723.350) (-3720.291) [-3718.382] (-3733.153) -- 0:00:06 978500 -- (-3721.455) [-3717.161] (-3721.928) (-3724.070) * [-3726.059] (-3718.718) (-3719.682) (-3719.637) -- 0:00:06 979000 -- (-3732.432) (-3723.051) [-3717.972] (-3724.263) * (-3722.624) (-3725.422) [-3724.557] (-3720.695) -- 0:00:05 979500 -- (-3722.851) [-3720.216] (-3726.714) (-3722.678) * (-3733.326) (-3717.757) (-3721.568) [-3717.497] -- 0:00:05 980000 -- (-3724.544) (-3726.131) [-3719.788] (-3723.779) * (-3723.703) (-3720.929) (-3719.928) [-3719.079] -- 0:00:05 Average standard deviation of split frequencies: 0.000000 980500 -- [-3727.847] (-3721.679) (-3722.841) (-3725.546) * (-3728.630) [-3724.966] (-3721.100) (-3734.703) -- 0:00:05 981000 -- (-3720.548) (-3726.296) [-3719.820] (-3718.088) * (-3731.673) (-3729.517) (-3725.754) [-3721.489] -- 0:00:05 981500 -- [-3718.558] (-3727.299) (-3725.304) (-3718.550) * (-3729.748) (-3719.502) (-3721.419) [-3722.868] -- 0:00:05 982000 -- [-3718.554] (-3722.353) (-3717.902) (-3721.007) * (-3724.408) (-3718.304) [-3722.515] (-3721.708) -- 0:00:05 982500 -- (-3718.024) [-3721.893] (-3727.245) (-3717.887) * (-3718.943) (-3721.439) (-3722.146) [-3722.124] -- 0:00:04 983000 -- [-3717.441] (-3721.988) (-3723.596) (-3723.669) * [-3722.449] (-3722.278) (-3729.094) (-3723.059) -- 0:00:04 983500 -- (-3725.151) (-3729.560) (-3720.586) [-3725.191] * (-3725.909) (-3718.677) (-3718.996) [-3717.855] -- 0:00:04 984000 -- (-3719.613) (-3726.635) (-3723.100) [-3724.131] * [-3724.400] (-3724.505) (-3719.515) (-3725.882) -- 0:00:04 984500 -- (-3725.634) (-3723.832) (-3721.148) [-3719.203] * (-3733.801) [-3719.746] (-3727.909) (-3724.727) -- 0:00:04 985000 -- (-3722.481) (-3725.509) (-3723.060) [-3718.145] * (-3725.614) (-3717.724) [-3729.396] (-3725.428) -- 0:00:04 Average standard deviation of split frequencies: 0.000000 985500 -- [-3724.925] (-3719.862) (-3723.394) (-3722.293) * (-3726.013) [-3723.366] (-3722.557) (-3728.814) -- 0:00:04 986000 -- (-3721.876) (-3718.101) (-3723.452) [-3725.112] * (-3726.487) (-3719.686) [-3716.121] (-3721.989) -- 0:00:03 986500 -- [-3721.313] (-3733.382) (-3728.983) (-3723.482) * (-3724.934) [-3721.945] (-3720.276) (-3721.895) -- 0:00:03 987000 -- (-3722.846) (-3723.403) (-3729.015) [-3723.124] * (-3721.587) (-3722.615) [-3718.996] (-3720.836) -- 0:00:03 987500 -- (-3722.314) (-3722.686) (-3729.526) [-3725.236] * (-3726.280) (-3724.657) [-3722.430] (-3729.606) -- 0:00:03 988000 -- (-3722.395) (-3720.081) [-3721.126] (-3732.504) * (-3724.343) [-3725.864] (-3718.657) (-3726.041) -- 0:00:03 988500 -- (-3716.821) (-3726.067) (-3718.504) [-3728.577] * (-3728.529) [-3723.899] (-3720.044) (-3724.957) -- 0:00:03 989000 -- [-3721.920] (-3726.177) (-3721.061) (-3723.965) * (-3723.645) (-3718.619) [-3720.151] (-3724.731) -- 0:00:03 989500 -- [-3721.350] (-3723.228) (-3724.100) (-3727.947) * [-3725.909] (-3726.472) (-3722.745) (-3719.678) -- 0:00:02 990000 -- (-3718.441) (-3731.255) [-3720.051] (-3726.501) * [-3725.781] (-3722.443) (-3738.809) (-3728.648) -- 0:00:02 Average standard deviation of split frequencies: 0.000000 990500 -- (-3722.422) (-3733.514) [-3723.376] (-3716.376) * (-3724.450) [-3724.177] (-3722.344) (-3721.510) -- 0:00:02 991000 -- [-3720.949] (-3724.030) (-3726.905) (-3719.725) * (-3722.520) [-3724.509] (-3723.269) (-3732.134) -- 0:00:02 991500 -- (-3720.233) (-3724.736) (-3722.725) [-3724.029] * (-3720.697) (-3723.257) (-3719.833) [-3725.236] -- 0:00:02 992000 -- (-3727.970) (-3722.025) [-3727.331] (-3721.503) * [-3723.934] (-3720.935) (-3731.798) (-3724.374) -- 0:00:02 992500 -- (-3724.920) [-3723.428] (-3725.856) (-3723.474) * [-3723.487] (-3729.058) (-3725.947) (-3729.631) -- 0:00:02 993000 -- (-3727.383) [-3719.790] (-3726.409) (-3727.016) * [-3730.032] (-3724.665) (-3723.104) (-3729.970) -- 0:00:01 993500 -- (-3726.819) [-3719.516] (-3723.288) (-3721.532) * (-3721.143) (-3720.450) [-3722.528] (-3720.465) -- 0:00:01 994000 -- (-3719.146) (-3720.541) (-3722.004) [-3722.676] * (-3719.233) (-3726.937) (-3728.968) [-3723.219] -- 0:00:01 994500 -- (-3718.069) (-3729.448) (-3724.171) [-3720.050] * [-3726.199] (-3728.303) (-3723.290) (-3727.861) -- 0:00:01 995000 -- (-3722.089) [-3722.091] (-3724.154) (-3724.024) * (-3724.216) [-3721.662] (-3723.957) (-3728.469) -- 0:00:01 Average standard deviation of split frequencies: 0.000000 995500 -- [-3718.748] (-3722.934) (-3722.854) (-3719.922) * (-3719.113) (-3728.998) [-3725.852] (-3720.148) -- 0:00:01 996000 -- (-3727.725) (-3722.661) (-3723.539) [-3722.977] * (-3723.727) [-3723.812] (-3729.659) (-3726.314) -- 0:00:01 996500 -- (-3724.036) [-3726.782] (-3720.073) (-3725.115) * (-3728.027) [-3718.562] (-3723.334) (-3724.967) -- 0:00:00 997000 -- [-3723.755] (-3719.763) (-3723.039) (-3721.327) * [-3722.074] (-3730.016) (-3721.144) (-3723.157) -- 0:00:00 997500 -- (-3725.938) (-3719.659) (-3726.144) [-3720.249] * (-3719.135) (-3719.284) (-3723.596) [-3722.882] -- 0:00:00 998000 -- [-3721.152] (-3720.978) (-3722.249) (-3720.512) * (-3728.410) (-3717.482) (-3728.040) [-3719.728] -- 0:00:00 998500 -- (-3725.025) (-3722.125) (-3726.190) [-3718.932] * [-3721.514] (-3721.518) (-3723.674) (-3718.864) -- 0:00:00 999000 -- (-3721.800) (-3723.234) (-3726.610) [-3723.415] * (-3734.549) (-3720.090) [-3722.085] (-3721.885) -- 0:00:00 999500 -- (-3723.813) [-3721.438] (-3722.911) (-3722.480) * (-3724.955) (-3717.748) [-3719.209] (-3723.124) -- 0:00:00 1000000 -- [-3724.481] (-3721.675) (-3726.027) (-3722.660) * (-3730.157) (-3717.499) (-3725.885) [-3721.379] -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3724.481003 -- 15.988218 Chain 1 -- -3724.481004 -- 15.988218 Chain 2 -- -3721.675449 -- 17.779327 Chain 2 -- -3721.675449 -- 17.779327 Chain 3 -- -3726.027005 -- 16.079144 Chain 3 -- -3726.027005 -- 16.079144 Chain 4 -- -3722.659765 -- 16.586156 Chain 4 -- -3722.659765 -- 16.586156 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3730.156714 -- 15.466973 Chain 1 -- -3730.156714 -- 15.466973 Chain 2 -- -3717.499039 -- 17.146902 Chain 2 -- -3717.499037 -- 17.146902 Chain 3 -- -3725.885362 -- 17.317745 Chain 3 -- -3725.885362 -- 17.317745 Chain 4 -- -3721.378811 -- 17.343150 Chain 4 -- -3721.378811 -- 17.343150 Analysis completed in 4 mins 42 seconds Analysis used 282.31 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3714.61 Likelihood of best state for "cold" chain of run 2 was -3714.61 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 41.7 % ( 27 %) Dirichlet(Revmat{all}) 58.4 % ( 48 %) Slider(Revmat{all}) 21.4 % ( 26 %) Dirichlet(Pi{all}) 25.0 % ( 20 %) Slider(Pi{all}) 57.6 % ( 20 %) Multiplier(Alpha{1,2}) 54.1 % ( 21 %) Multiplier(Alpha{3}) 75.9 % ( 52 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 24 %) Multiplier(V{all}) 16.1 % ( 13 %) Nodeslider(V{all}) 24.8 % ( 27 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 41.5 % ( 26 %) Dirichlet(Revmat{all}) 58.7 % ( 36 %) Slider(Revmat{all}) 21.5 % ( 28 %) Dirichlet(Pi{all}) 25.2 % ( 22 %) Slider(Pi{all}) 57.8 % ( 21 %) Multiplier(Alpha{1,2}) 53.7 % ( 28 %) Multiplier(Alpha{3}) 75.9 % ( 61 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 24 %) Multiplier(V{all}) 16.2 % ( 13 %) Nodeslider(V{all}) 25.2 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.83 0.68 0.56 2 | 166701 0.85 0.71 3 | 167001 166429 0.86 4 | 167002 166366 166501 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.83 0.69 0.56 2 | 167456 0.85 0.71 3 | 166271 167019 0.86 4 | 166354 166378 166522 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3720.92 | 1 1 2 | | 2 11 2 2 | |2 1 2 1 12 2 | | 2 2 2 1 1 2 1 1 2 1 2 11 | | 11 21 2 2 2 2 1 1 2 2 121 2*22 | | * 11 1 21 1* 2 11 2122 1 1 2 1 1 2 | | 2 11 2 2 2 22 12 * * 1| | * 1 211 1 21 * 21 21 | |1 2 2 2 21 * *1 1 | | 2 2 1 2| | 1 | | 2 | | | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3724.52 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3719.64 -3730.11 2 -3719.51 -3729.33 -------------------------------------- TOTAL -3719.58 -3729.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.189077 0.000257 0.159200 0.222165 0.188174 1398.94 1449.97 1.001 r(A<->C){all} 0.097242 0.000380 0.060532 0.135450 0.096057 1173.53 1200.98 1.000 r(A<->G){all} 0.258165 0.001002 0.196821 0.318386 0.256882 845.78 849.69 1.000 r(A<->T){all} 0.106706 0.000340 0.070165 0.142745 0.106066 1122.21 1133.18 1.000 r(C<->G){all} 0.108685 0.000685 0.057809 0.158378 0.107646 990.69 1152.01 1.000 r(C<->T){all} 0.317615 0.001242 0.251182 0.389749 0.316655 720.05 913.54 1.000 r(G<->T){all} 0.111587 0.000581 0.068112 0.159611 0.110006 979.26 1054.62 1.000 pi(A){all} 0.347158 0.000123 0.325303 0.368486 0.347037 955.78 1069.91 1.000 pi(C){all} 0.197939 0.000085 0.179615 0.215731 0.197720 1186.62 1198.37 1.000 pi(G){all} 0.190215 0.000080 0.173522 0.208727 0.190064 948.74 1126.14 1.000 pi(T){all} 0.264688 0.000107 0.246279 0.286423 0.264693 1061.93 1175.99 1.000 alpha{1,2} 0.330111 0.056640 0.000106 0.776169 0.278501 1293.65 1338.83 1.000 alpha{3} 1.306965 0.422380 0.352092 2.605617 1.162313 902.98 1201.99 1.000 pinvar{all} 0.146599 0.011462 0.000009 0.348673 0.125051 970.68 1077.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 Key to taxon bipartitions (saved to file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------- 1 -- .**** 2 -- .*... 3 -- ..*.. 4 -- ...*. 5 -- ....* 6 -- ...** 7 -- .**.. ----------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 6 3002 1.000000 0.000000 1.000000 1.000000 2 7 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.018923 0.000017 0.011589 0.027090 0.018614 1.000 2 length{all}[2] 0.003614 0.000002 0.001042 0.006817 0.003368 1.000 2 length{all}[3] 0.003166 0.000002 0.000662 0.006126 0.002926 1.000 2 length{all}[4] 0.046198 0.000050 0.033039 0.060722 0.045829 1.000 2 length{all}[5] 0.033948 0.000034 0.023211 0.045734 0.033703 1.001 2 length{all}[6] 0.061604 0.000074 0.045945 0.078552 0.061054 1.000 2 length{all}[7] 0.021623 0.000019 0.012911 0.029907 0.021257 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------ C2 (2) |----------------100----------------+ + \------------------------------------ C3 (3) | | /------------------------------------ C4 (4) \----------------100----------------+ \------------------------------------ C5 (5) Phylogram (based on average branch lengths): /------------- C1 (1) | | /--- C2 (2) |-------------+ + \-- C3 (3) | | /------------------------------- C4 (4) \----------------------------------------+ \----------------------- C5 (5) |------------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 5 ls = 1710 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Sites with gaps or missing data are removed. 18 ambiguity characters in seq. 1 21 ambiguity characters in seq. 2 21 ambiguity characters in seq. 3 12 ambiguity characters in seq. 4 12 ambiguity characters in seq. 5 8 sites are removed. 20 21 91 252 287 568 569 570 Sequences read.. Counting site patterns.. 0:00 241 patterns at 562 / 562 sites (100.0%), 0:00 Counting codons.. 80 bytes for distance 235216 bytes for conP 32776 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), (4, 5)); MP score: 243 352824 bytes for conP, adjusted 0.052554 0.056207 0.007751 0.008321 0.144614 0.120069 0.090258 0.300000 1.300000 ntime & nrate & np: 7 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 9 lnL0 = -3798.391581 Iterating by ming2 Initial: fx= 3798.391581 x= 0.05255 0.05621 0.00775 0.00832 0.14461 0.12007 0.09026 0.30000 1.30000 1 h-m-p 0.0000 0.0001 351.6801 +CCYCCC 3791.882100 5 0.0001 25 | 0/9 2 h-m-p 0.0000 0.0004 4312.4954 +YYCCCC 3763.219822 5 0.0001 46 | 0/9 3 h-m-p 0.0000 0.0002 1199.7284 +CYYCYCCC 3715.323335 7 0.0002 70 | 0/9 4 h-m-p 0.0001 0.0005 299.7630 CYCCC 3710.190663 4 0.0002 89 | 0/9 5 h-m-p 0.0003 0.0014 189.6956 YCC 3708.150638 2 0.0002 104 | 0/9 6 h-m-p 0.0003 0.0024 125.3824 CCCC 3706.403110 3 0.0004 122 | 0/9 7 h-m-p 0.0002 0.0047 245.0817 +YCCCC 3692.944702 4 0.0020 142 | 0/9 8 h-m-p 0.0000 0.0002 3006.5750 YCYCYCC 3674.028992 6 0.0001 164 | 0/9 9 h-m-p 0.0062 0.0310 5.1059 YC 3673.994511 1 0.0009 177 | 0/9 10 h-m-p 0.0085 0.9738 0.5193 +++YCCC 3644.918117 3 0.3827 197 | 0/9 11 h-m-p 0.1387 0.6933 0.7208 CYCC 3639.166518 3 0.1546 223 | 0/9 12 h-m-p 0.8847 4.4235 0.1107 CYCCC 3632.779585 4 1.4042 251 | 0/9 13 h-m-p 1.5505 7.7526 0.0929 CCCC 3629.722395 3 2.2031 278 | 0/9 14 h-m-p 0.6624 4.1325 0.3090 CYCCC 3627.984524 4 0.4243 306 | 0/9 15 h-m-p 0.8626 4.3132 0.1429 CCCCC 3626.393396 4 1.0301 335 | 0/9 16 h-m-p 1.6000 8.0000 0.0662 CYC 3625.418875 2 1.8647 359 | 0/9 17 h-m-p 1.6000 8.0000 0.0491 CCC 3625.056693 2 1.8744 384 | 0/9 18 h-m-p 1.6000 8.0000 0.0248 YC 3625.025415 1 1.2357 406 | 0/9 19 h-m-p 1.6000 8.0000 0.0077 CC 3625.020434 1 1.8067 429 | 0/9 20 h-m-p 1.6000 8.0000 0.0011 C 3625.019986 0 1.4536 450 | 0/9 21 h-m-p 1.6000 8.0000 0.0005 C 3625.019947 0 1.3636 471 | 0/9 22 h-m-p 1.6000 8.0000 0.0001 C 3625.019945 0 1.3820 492 | 0/9 23 h-m-p 1.6000 8.0000 0.0000 Y 3625.019945 0 1.2152 513 | 0/9 24 h-m-p 1.6000 8.0000 0.0000 -C 3625.019945 0 0.1582 535 | 0/9 25 h-m-p 0.1260 8.0000 0.0000 -----C 3625.019945 0 0.0000 561 Out.. lnL = -3625.019945 562 lfun, 562 eigenQcodon, 3934 P(t) Time used: 0:02 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), (4, 5)); MP score: 243 0.052554 0.056207 0.007751 0.008321 0.144614 0.120069 0.090258 1.930873 0.573207 0.492243 ntime & nrate & np: 7 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.112780 np = 10 lnL0 = -3640.364919 Iterating by ming2 Initial: fx= 3640.364919 x= 0.05255 0.05621 0.00775 0.00832 0.14461 0.12007 0.09026 1.93087 0.57321 0.49224 1 h-m-p 0.0000 0.0001 134.0818 YC 3640.162142 1 0.0000 16 | 0/10 2 h-m-p 0.0000 0.0064 112.9471 ++CYCC 3637.949547 3 0.0006 36 | 0/10 3 h-m-p 0.0000 0.0001 551.8163 CYCCC 3637.191332 4 0.0000 56 | 0/10 4 h-m-p 0.0000 0.0010 539.5439 ++YYCCCC 3627.608610 5 0.0004 79 | 0/10 5 h-m-p 0.0000 0.0002 1826.5288 CYCCC 3622.012311 4 0.0001 100 | 0/10 6 h-m-p 0.0012 0.0061 30.0412 YC 3621.797196 1 0.0006 114 | 0/10 7 h-m-p 0.0004 0.0044 38.4885 YCC 3621.524955 2 0.0007 130 | 0/10 8 h-m-p 0.0001 0.0007 205.2902 CC 3621.161532 1 0.0002 145 | 0/10 9 h-m-p 0.0056 0.0298 7.0365 YC 3621.128870 1 0.0010 159 | 0/10 10 h-m-p 0.0012 0.6041 9.4655 +++CCCC 3618.282012 3 0.0732 181 | 0/10 11 h-m-p 0.2322 1.1612 1.1294 +YCCC 3609.447815 3 0.6722 200 | 0/10 12 h-m-p 1.6000 8.0000 0.0660 YCC 3609.009814 2 0.6852 216 | 0/10 13 h-m-p 0.4414 2.2072 0.0850 YC 3608.882343 1 0.7666 240 | 0/10 14 h-m-p 0.4865 2.4325 0.0403 YC 3608.855546 1 1.0473 264 | 0/10 15 h-m-p 0.6098 3.0490 0.0132 YC 3608.849368 1 1.0621 288 | 0/10 16 h-m-p 1.6000 8.0000 0.0016 YC 3608.849177 1 1.0408 312 | 0/10 17 h-m-p 1.6000 8.0000 0.0002 C 3608.849141 0 1.6262 335 | 0/10 18 h-m-p 1.6000 8.0000 0.0001 Y 3608.849137 0 1.0924 358 | 0/10 19 h-m-p 1.6000 8.0000 0.0000 C 3608.849137 0 1.4834 381 | 0/10 20 h-m-p 1.6000 8.0000 0.0000 Y 3608.849137 0 1.1053 404 | 0/10 21 h-m-p 1.6000 8.0000 0.0000 Y 3608.849137 0 0.4000 427 | 0/10 22 h-m-p 0.5335 8.0000 0.0000 ----------------.. | 0/10 23 h-m-p 0.0113 5.6540 0.0020 ------------- | 0/10 24 h-m-p 0.0113 5.6540 0.0020 ------------- Out.. lnL = -3608.849137 533 lfun, 1599 eigenQcodon, 7462 P(t) Time used: 0:05 Model 2: PositiveSelection TREE # 1 (1, (2, 3), (4, 5)); MP score: 243 initial w for M2:NSpselection reset. 0.052554 0.056207 0.007751 0.008321 0.144614 0.120069 0.090258 1.990657 0.986220 0.117156 0.463564 2.408838 ntime & nrate & np: 7 3 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.670296 np = 12 lnL0 = -3648.121159 Iterating by ming2 Initial: fx= 3648.121159 x= 0.05255 0.05621 0.00775 0.00832 0.14461 0.12007 0.09026 1.99066 0.98622 0.11716 0.46356 2.40884 1 h-m-p 0.0000 0.0002 158.7672 +CCC 3647.720943 2 0.0000 34 | 0/12 2 h-m-p 0.0000 0.0023 194.2447 +YCCC 3646.009294 3 0.0002 67 | 0/12 3 h-m-p 0.0000 0.0001 258.5470 CYCCC 3645.626111 4 0.0000 101 | 0/12 4 h-m-p 0.0000 0.0015 185.0144 +YCCC 3643.200782 3 0.0004 134 | 0/12 5 h-m-p 0.0002 0.0013 317.6459 ++ 3623.373085 m 0.0013 161 | 1/12 6 h-m-p 0.0022 0.0785 70.7733 CYC 3622.560084 2 0.0019 191 | 1/12 7 h-m-p 0.0050 0.0258 27.3420 CCC 3622.136101 2 0.0016 221 | 1/12 8 h-m-p 0.0015 0.0291 28.6718 +CCCCC 3617.135659 4 0.0079 256 | 0/12 9 h-m-p 0.0002 0.0010 365.5926 YYC 3615.950912 2 0.0002 284 | 0/12 10 h-m-p 0.0013 0.0240 45.5067 YCCC 3615.442251 3 0.0008 316 | 0/12 11 h-m-p 0.0082 0.2996 4.4674 +++ 3613.179824 m 0.2996 344 | 1/12 12 h-m-p 0.7886 3.9431 1.6233 YCCC 3610.187029 3 0.4514 376 | 1/12 13 h-m-p 0.0438 0.2189 1.9098 +CC 3609.246493 1 0.1676 405 | 0/12 14 h-m-p 0.0015 0.0075 13.3060 +YC 3609.221372 1 0.0038 433 | 0/12 15 h-m-p 0.0100 0.0509 5.0821 +YC 3608.892213 1 0.0438 462 | 0/12 16 h-m-p 0.0086 0.0430 0.0642 ++ 3608.889504 m 0.0430 489 | 1/12 17 h-m-p 0.0235 1.5947 0.1018 +++YC 3608.850640 1 0.9600 520 | 1/12 18 h-m-p 1.6000 8.0000 0.0057 YC 3608.849315 1 1.2227 547 | 1/12 19 h-m-p 1.4089 8.0000 0.0050 C 3608.849147 0 1.4124 573 | 1/12 20 h-m-p 1.6000 8.0000 0.0013 Y 3608.849137 0 0.9673 599 | 1/12 21 h-m-p 1.6000 8.0000 0.0001 Y 3608.849137 0 0.8522 625 | 1/12 22 h-m-p 1.6000 8.0000 0.0000 Y 3608.849137 0 0.9049 651 | 1/12 23 h-m-p 1.6000 8.0000 0.0000 C 3608.849137 0 1.3909 677 | 1/12 24 h-m-p 1.6000 8.0000 0.0000 -Y 3608.849137 0 0.1787 704 | 1/12 25 h-m-p 0.6327 8.0000 0.0000 ----------------.. | 1/12 26 h-m-p 0.0160 8.0000 0.0020 ---------C 3608.849137 0 0.0000 779 | 1/12 27 h-m-p 0.0031 1.5289 0.0079 ------------.. | 1/12 28 h-m-p 0.0160 8.0000 0.0020 ------------- Out.. lnL = -3608.849137 853 lfun, 3412 eigenQcodon, 17913 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3616.884971 S = -3364.771957 -244.615381 Calculating f(w|X), posterior probabilities of site classes. did 10 / 241 patterns 0:14 did 20 / 241 patterns 0:14 did 30 / 241 patterns 0:14 did 40 / 241 patterns 0:14 did 50 / 241 patterns 0:14 did 60 / 241 patterns 0:14 did 70 / 241 patterns 0:14 did 80 / 241 patterns 0:15 did 90 / 241 patterns 0:15 did 100 / 241 patterns 0:15 did 110 / 241 patterns 0:15 did 120 / 241 patterns 0:15 did 130 / 241 patterns 0:15 did 140 / 241 patterns 0:15 did 150 / 241 patterns 0:15 did 160 / 241 patterns 0:15 did 170 / 241 patterns 0:15 did 180 / 241 patterns 0:15 did 190 / 241 patterns 0:15 did 200 / 241 patterns 0:15 did 210 / 241 patterns 0:15 did 220 / 241 patterns 0:15 did 230 / 241 patterns 0:15 did 240 / 241 patterns 0:15 did 241 / 241 patterns 0:15 Time used: 0:15 Model 3: discrete TREE # 1 (1, (2, 3), (4, 5)); MP score: 243 0.052554 0.056207 0.007751 0.008321 0.144614 0.120069 0.090258 1.990657 0.331355 0.382499 0.160035 0.399515 0.668942 ntime & nrate & np: 7 4 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 8.991330 np = 13 lnL0 = -3621.004526 Iterating by ming2 Initial: fx= 3621.004526 x= 0.05255 0.05621 0.00775 0.00832 0.14461 0.12007 0.09026 1.99066 0.33136 0.38250 0.16004 0.39951 0.66894 1 h-m-p 0.0000 0.0001 133.8496 YC 3620.813219 1 0.0000 32 | 0/13 2 h-m-p 0.0000 0.0031 98.2268 +YCCC 3619.938190 3 0.0003 67 | 0/13 3 h-m-p 0.0000 0.0002 130.8993 YYYC 3619.803551 3 0.0000 99 | 0/13 4 h-m-p 0.0000 0.0009 199.2379 +YCCC 3618.857283 3 0.0002 134 | 0/13 5 h-m-p 0.0001 0.0005 222.0529 ++ 3614.495344 m 0.0005 163 | 1/13 6 h-m-p 0.0009 0.0076 53.3641 YCCC 3613.887998 3 0.0020 197 | 1/13 7 h-m-p 0.0003 0.0016 190.4415 YCC 3613.704364 2 0.0002 228 | 1/13 8 h-m-p 0.0012 0.0147 29.4707 YC 3613.345321 1 0.0022 257 | 1/13 9 h-m-p 0.0006 0.0035 120.0145 YCCC 3612.509586 3 0.0012 290 | 1/13 10 h-m-p 0.0404 0.2021 3.2428 YYCC 3611.446923 3 0.0317 322 | 0/13 11 h-m-p 0.0035 0.0558 29.5488 YCCCC 3610.899309 4 0.0018 357 | 0/13 12 h-m-p 0.0142 0.2943 3.7411 ++CCC 3609.533484 2 0.2136 392 | 0/13 13 h-m-p 0.0317 0.1586 3.8800 YC 3609.204044 1 0.0621 422 | 0/13 14 h-m-p 0.2463 1.2316 0.2080 +YC 3608.995203 1 0.6525 453 | 0/13 15 h-m-p 0.0267 0.1334 0.9648 +YC 3608.872117 1 0.1177 484 | 0/13 16 h-m-p 0.0482 0.2410 0.0585 ++ 3608.867247 m 0.2410 513 | 1/13 17 h-m-p 0.0008 0.0904 16.9376 +YC 3608.863972 1 0.0022 544 | 1/13 18 h-m-p 1.0528 8.0000 0.0347 CC 3608.853479 1 1.3722 574 | 1/13 19 h-m-p 1.6000 8.0000 0.0279 ++ 3608.828519 m 8.0000 602 | 1/13 20 h-m-p 0.0814 0.4072 0.3275 ++ 3608.816818 m 0.4072 630 | 2/13 21 h-m-p 0.4347 8.0000 0.2994 YC 3608.812530 1 0.1820 659 | 2/13 22 h-m-p 1.6000 8.0000 0.0133 C 3608.810420 0 1.8092 686 | 2/13 23 h-m-p 1.6000 8.0000 0.0046 C 3608.809915 0 1.3974 713 | 2/13 24 h-m-p 1.6000 8.0000 0.0014 Y 3608.809899 0 1.0265 740 | 2/13 25 h-m-p 1.6000 8.0000 0.0001 Y 3608.809899 0 0.9867 767 | 2/13 26 h-m-p 1.6000 8.0000 0.0000 Y 3608.809899 0 1.2694 794 | 2/13 27 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/13 28 h-m-p 0.0160 8.0000 0.0010 -----------Y 3608.809899 0 0.0000 873 | 2/13 29 h-m-p 0.0000 0.0005 29.3963 -----Y 3608.809899 0 0.0000 905 | 2/13 30 h-m-p 0.0160 8.0000 0.0010 ---Y 3608.809899 0 0.0001 935 | 2/13 31 h-m-p 0.0160 8.0000 0.0004 -------Y 3608.809899 0 0.0000 969 Out.. lnL = -3608.809899 970 lfun, 3880 eigenQcodon, 20370 P(t) Time used: 0:25 Model 7: beta TREE # 1 (1, (2, 3), (4, 5)); MP score: 243 0.052554 0.056207 0.007751 0.008321 0.144614 0.120069 0.090258 1.977626 0.665673 1.549129 ntime & nrate & np: 7 1 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 10.341185 np = 10 lnL0 = -3615.509296 Iterating by ming2 Initial: fx= 3615.509296 x= 0.05255 0.05621 0.00775 0.00832 0.14461 0.12007 0.09026 1.97763 0.66567 1.54913 1 h-m-p 0.0000 0.0001 133.8179 YC 3615.313174 1 0.0000 26 | 0/10 2 h-m-p 0.0000 0.0049 99.1460 +CCC 3614.720963 2 0.0002 54 | 0/10 3 h-m-p 0.0001 0.0003 62.5989 YC 3614.688452 1 0.0000 78 | 0/10 4 h-m-p 0.0000 0.0024 47.5662 +YC 3614.621647 1 0.0001 103 | 0/10 5 h-m-p 0.0006 0.0158 8.5092 YC 3614.612166 1 0.0003 127 | 0/10 6 h-m-p 0.0005 0.1042 4.7099 +CC 3614.586581 1 0.0030 153 | 0/10 7 h-m-p 0.0002 0.0113 79.4864 +CCCC 3614.406993 3 0.0012 183 | 0/10 8 h-m-p 0.0008 0.0066 126.3166 YCC 3614.316764 2 0.0004 209 | 0/10 9 h-m-p 0.0034 0.1164 14.7320 ++YYYYYCCCC 3612.712393 8 0.0581 245 | 0/10 10 h-m-p 0.0086 0.0429 18.1052 +YYCCC 3611.828390 4 0.0259 275 | 0/10 11 h-m-p 0.0053 0.0264 11.5196 YCCYCC 3610.946032 5 0.0171 307 | 0/10 12 h-m-p 0.0596 0.2978 0.5407 YYYCCC 3610.792877 5 0.0622 337 | 0/10 13 h-m-p 0.0160 8.0000 2.1559 ++CYC 3609.040712 2 0.1912 365 | 0/10 14 h-m-p 1.6000 8.0000 0.0149 CYC 3608.964491 2 1.5143 391 | 0/10 15 h-m-p 1.2467 6.8151 0.0182 CYCYC 3608.909029 4 2.2163 420 | 0/10 16 h-m-p 1.1809 5.9045 0.0157 YCYC 3608.862002 3 2.1053 447 | 0/10 17 h-m-p 0.5390 2.6949 0.0208 YYC 3608.855561 2 0.4752 472 | 0/10 18 h-m-p 0.4503 2.2513 0.0182 YYC 3608.846720 2 0.3172 497 | 0/10 19 h-m-p 1.2725 8.0000 0.0045 C 3608.845584 0 2.0156 520 | 0/10 20 h-m-p 1.6000 8.0000 0.0007 C 3608.845305 0 0.5893 543 | 0/10 21 h-m-p 0.1475 8.0000 0.0028 C 3608.845285 0 0.2312 566 | 0/10 22 h-m-p 1.2133 8.0000 0.0005 Y 3608.845270 0 0.6701 589 | 0/10 23 h-m-p 1.4234 8.0000 0.0003 C 3608.845269 0 0.3907 612 | 0/10 24 h-m-p 0.5509 8.0000 0.0002 Y 3608.845269 0 0.2507 635 | 0/10 25 h-m-p 0.3166 8.0000 0.0001 C 3608.845269 0 0.1083 658 | 0/10 26 h-m-p 0.1190 8.0000 0.0001 Y 3608.845269 0 0.0233 681 | 0/10 27 h-m-p 0.0238 8.0000 0.0001 Y 3608.845269 0 0.0128 704 | 0/10 28 h-m-p 0.0160 8.0000 0.0001 +C 3608.845269 0 0.0971 728 | 0/10 29 h-m-p 0.1065 8.0000 0.0001 ---Y 3608.845269 0 0.0004 754 | 0/10 30 h-m-p 0.0160 8.0000 0.0001 +++Y 3608.845265 0 2.2500 780 | 0/10 31 h-m-p 1.5529 8.0000 0.0002 -------Y 3608.845265 0 0.0000 810 Out.. lnL = -3608.845265 811 lfun, 8921 eigenQcodon, 56770 P(t) Time used: 0:51 Model 8: beta&w>1 TREE # 1 (1, (2, 3), (4, 5)); MP score: 243 initial w for M8:NSbetaw>1 reset. 0.052554 0.056207 0.007751 0.008321 0.144614 0.120069 0.090258 1.977982 0.900000 0.401601 1.403915 2.022819 ntime & nrate & np: 7 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 8.788670 np = 12 lnL0 = -3611.921693 Iterating by ming2 Initial: fx= 3611.921693 x= 0.05255 0.05621 0.00775 0.00832 0.14461 0.12007 0.09026 1.97798 0.90000 0.40160 1.40392 2.02282 1 h-m-p 0.0000 0.0002 145.0260 +YYC 3611.582247 2 0.0000 32 | 0/12 2 h-m-p 0.0000 0.0029 183.5639 +CYC 3610.453108 2 0.0001 63 | 0/12 3 h-m-p 0.0000 0.0001 200.0705 YYYC 3610.266011 3 0.0000 93 | 0/12 4 h-m-p 0.0001 0.0024 46.5745 CCC 3610.130541 2 0.0002 124 | 0/12 5 h-m-p 0.0007 0.0119 10.4753 CC 3610.116290 1 0.0003 153 | 0/12 6 h-m-p 0.0015 0.1378 1.9549 YC 3610.114397 1 0.0010 181 | 0/12 7 h-m-p 0.0003 0.0456 7.2256 YC 3610.110318 1 0.0007 209 | 0/12 8 h-m-p 0.0004 0.0890 11.4335 +CC 3610.096643 1 0.0016 239 | 0/12 9 h-m-p 0.0006 0.0356 30.9390 ++CYCCC 3609.675037 4 0.0160 275 | 0/12 10 h-m-p 0.0226 0.1128 5.5442 YCCC 3609.624842 3 0.0130 307 | 0/12 11 h-m-p 0.0277 0.2216 2.5953 YCC 3609.541101 2 0.0576 337 | 0/12 12 h-m-p 0.6507 7.0982 0.2297 CCC 3609.346120 2 0.9689 368 | 0/12 13 h-m-p 0.7587 3.7936 0.2289 CYCYC 3609.136149 4 1.5407 402 | 0/12 14 h-m-p 0.3557 1.7785 0.4536 YCYCCC 3609.007663 5 0.5571 437 | 0/12 15 h-m-p 0.1759 0.8794 0.6019 ++ 3608.845656 m 0.8794 464 | 1/12 16 h-m-p 0.1394 0.6971 0.1239 YYCCCCC 3608.828590 6 0.0412 501 | 1/12 17 h-m-p 0.0377 0.2149 0.1352 YC 3608.828515 1 0.0053 528 | 1/12 18 h-m-p 0.0665 8.0000 0.0107 ++CC 3608.824548 1 1.2336 558 | 1/12 19 h-m-p 1.6000 8.0000 0.0021 C 3608.823417 0 1.9182 584 | 1/12 20 h-m-p 1.6000 8.0000 0.0009 Y 3608.823384 0 0.9268 610 | 1/12 21 h-m-p 1.6000 8.0000 0.0002 Y 3608.823384 0 0.2299 636 | 1/12 22 h-m-p 0.6013 8.0000 0.0001 C 3608.823384 0 0.7477 662 | 1/12 23 h-m-p 1.0945 8.0000 0.0001 +Y 3608.823382 0 5.5759 689 | 1/12 24 h-m-p 1.6000 8.0000 0.0002 C 3608.823381 0 0.4746 715 | 1/12 25 h-m-p 1.2570 8.0000 0.0001 C 3608.823381 0 1.2764 741 | 1/12 26 h-m-p 1.1629 8.0000 0.0001 ++ 3608.823375 m 8.0000 767 | 1/12 27 h-m-p 1.6000 8.0000 0.0003 ---------Y 3608.823375 0 0.0000 802 Out.. lnL = -3608.823375 803 lfun, 9636 eigenQcodon, 61831 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3616.285442 S = -3365.015949 -244.448923 Calculating f(w|X), posterior probabilities of site classes. did 10 / 241 patterns 1:20 did 20 / 241 patterns 1:20 did 30 / 241 patterns 1:21 did 40 / 241 patterns 1:21 did 50 / 241 patterns 1:21 did 60 / 241 patterns 1:21 did 70 / 241 patterns 1:21 did 80 / 241 patterns 1:22 did 90 / 241 patterns 1:22 did 100 / 241 patterns 1:22 did 110 / 241 patterns 1:22 did 120 / 241 patterns 1:22 did 130 / 241 patterns 1:23 did 140 / 241 patterns 1:23 did 150 / 241 patterns 1:23 did 160 / 241 patterns 1:23 did 170 / 241 patterns 1:23 did 180 / 241 patterns 1:24 did 190 / 241 patterns 1:24 did 200 / 241 patterns 1:24 did 210 / 241 patterns 1:24 did 220 / 241 patterns 1:24 did 230 / 241 patterns 1:25 did 240 / 241 patterns 1:25 did 241 / 241 patterns 1:25 Time used: 1:25 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=570 D_melanogaster_Zyx-PA MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR D_sechellia_Zyx-PA MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR D_simulans_Zyx-PA MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR D_yakuba_Zyx-PA MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR D_erecta_Zyx-PA MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR *******:: :**.*.: ** *********::*.:**:.** *: :* D_melanogaster_Zyx-PA LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK D_sechellia_Zyx-PA LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK D_simulans_Zyx-PA LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK D_yakuba_Zyx-PA SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK D_erecta_Zyx-PA LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK * *** ****:*********** *************.** : ****** D_melanogaster_Zyx-PA YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK D_sechellia_Zyx-PA YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK D_simulans_Zyx-PA YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK D_yakuba_Zyx-PA YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK D_erecta_Zyx-PA YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK * :****.***::***:*****************************: ** D_melanogaster_Zyx-PA PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS D_sechellia_Zyx-PA PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS D_simulans_Zyx-PA PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS D_yakuba_Zyx-PA PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA D_erecta_Zyx-PA PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA ***..:**::************.**. ::. : ** *: * :*.**: D_melanogaster_Zyx-PA NVNETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTN D_sechellia_Zyx-PA NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN D_simulans_Zyx-PA NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN D_yakuba_Zyx-PA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN D_erecta_Zyx-PA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN **:*:*** *:*******************:** ***********::*:* D_melanogaster_Zyx-PA P-LQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN D_sechellia_Zyx-PA P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHN D_simulans_Zyx-PA P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHN D_yakuba_Zyx-PA PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPS-ADMFPRESCNMYN D_erecta_Zyx-PA PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPS-ADMLPRETCNLYN * ********::***. .**: *************. .* :***. *::* D_melanogaster_Zyx-PA SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL D_sechellia_Zyx-PA SYVNDNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGL D_simulans_Zyx-PA SYVNDNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGL D_yakuba_Zyx-PA SYVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGL D_erecta_Zyx-PA SYVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGL ***.*. *.*.:: ** ***:**** ******:*.**. .: ****:*** D_melanogaster_Zyx-PA KNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTD D_sechellia_Zyx-PA KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD D_simulans_Zyx-PA KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD D_yakuba_Zyx-PA KNYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD D_erecta_Zyx-PA KNFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCAD **::**.*:****:***************************** ****:* D_melanogaster_Zyx-PA CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH D_sechellia_Zyx-PA CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYH D_simulans_Zyx-PA CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH D_yakuba_Zyx-PA CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYH D_erecta_Zyx-PA CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH **********************************:*********:***** D_melanogaster_Zyx-PA PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD D_sechellia_Zyx-PA PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD D_simulans_Zyx-PA PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD D_yakuba_Zyx-PA PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPF D_erecta_Zyx-PA PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD ************************************************* D_melanogaster_Zyx-PA PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS D_sechellia_Zyx-PA PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS D_simulans_Zyx-PA PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS D_yakuba_Zyx-PA PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS D_erecta_Zyx-PA PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS ************************************************** D_melanogaster_Zyx-PA CNAKRVQALTNRMTSEHoo- D_sechellia_Zyx-PA CNAKRVQALTNRMTSEHooo D_simulans_Zyx-PA CNAKRVQALTNRMTSEHooo D_yakuba_Zyx-PA CNAQRVQALTKRMTSEH--- D_erecta_Zyx-PA CNAQRVQALTKRMTSEH--- ***:******:******
>D_melanogaster_Zyx-PA ATGGAGTCTGTGGCCCAGCAACTTAGAGAGCTGTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCTTGTATGTATTGGACATGGAAAAGTTGCGA AGCTAGTCGCCAAGATAAGTAATAATCAAAATGCATCAGTAAAGAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTGTGTTCGCGGGAACCACTATATTCACAAC CTCTGATTGGAGTCGAGAAAACAATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATAAACAGAAAAAC AACTTTAGATAATCCGGCAATTTTGGAACAGCAATTAGAAGCTCTTGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTACAAGCTAAG CCAACACAACCTCTCAACAGCTTTACAAAGCCCCTTTCAAAGACTTTAAG CAAAAGCTTAATATATTCTAATTTAGGTTCTGTTCGCAAAGAAATAGAAA CATTAGAACTATTAACAGACGAAACTAAGATTTCTGCGAGTACATATTCA AACGTTAATGAAACTGACAACGAAAAAGATGAGTTACCGCCACCACCTAG TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACAACGAAT CCT---TTACAAATATATGCAAACCAATATGCGATGCAGCATGATGCCAC AGGCAAGAGCTCTTCTACATATGATTCAATATATGAACCTATAAACCCTC GACCCTGTGTTGCAGATACGCTGCCTCGTGAAAGTTATAATCTGCATAAT TCATACGTTAATGATAATAATCCAAACATTTCCCATGAATACAATATTTC GAATTCGATTGAAGCTAACCAAACACTATACATACATGGTAATGCTAGAA CTACATTTTATGACGTGAACAGCATCCATAGAAATGATAAGGAAGGTCTA AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTGGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGTGGAT GTACAGCAATGGATCAAATATACCACATATTTTGCTTCACATGTACAGAT TGCCAAATTAACTTACAGGGAAAACCTTTCTATGCATTAGACGGCAAACC CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAGATCGAAGTTTTCA TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGACCATGTTCTATGTAAAAGC TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA T--------- >D_sechellia_Zyx-PA ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCGAGATAAGTAAAAAGCAAAATGCATCATTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA TATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGACAACGAAAAAGATGAGTTACCGCCCCCACCTAG TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACATCGAAT CCT---TTGCAAATATATGCAAACCAATATGCGTTGCAACATGATGCCAC AGGCAAGAGCTCTTATACATATGATTCAATATATGAACCTATAAACCCTC GACCCTGTGTTGTAGATACGCTGCCTCGTGAAAGTTGTAATCTGCATAAT TCATACGTCAATGATAATAATCCAAACATTTGCCATGAATACAATATTTC GAATTCGATTGATGCTAACCAAACACTATACATACATGGTAATGCTAAAA CTACATTTTATGACGTGAACACCATACATAGAAATGATAAGGAAGGTCTA AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTTGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGCGGAT GTACAGCAATGGATCAAATATACCACATATCTTGCTTCACATGTACAGAT TGCCAAATTAACTTACAGGGAAAACCATTTTATGCATTAGACGGCAAACC CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGGAACCAATTTTAGAGAGAATTCTTAGAGCTTCTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAGATCGAAGTTTTCA TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGTTCTATGTAAAAGC TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA T--------- >D_simulans_Zyx-PA ATGGAGTCTGTGGCCCAGCAACTTAGAGGGCTTTCGCTTCCAAAAGGTGA CACAGGC------TCACCGCCTGTATGTATTGGACATGGAAAAGTTGCGG AGATAGTCGCCAAGATAAGTAAAAAGCAAAATGCATCAGTAAACAGGAGA TTGGATATACCTCCTAAGCCGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTCATGTTCGCGGGAACCACTTTATTCACAAC CTCTGATTGGAGTCGAGAAA---ATGAGGGGGCATATGCCTTTTAGAAAA TACCTCAGCTCTGAATTCGGAGTTGCTGATACTCAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATATTGGAACAGCAATTAGAAGCCCTAGCTT ACCATAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGAGTAAAAGCTAAA CCAACACAGCCTCTCAAAAGCTTTACAAAGCCACTTTCAAAAACTTTGAG CAAAAGCTTAATATATTCTAATTTAGGGTTTGAACACAATAAAATAGAAA CATCAGAACTAGCAACAGACGAAACTAAGAGATCAGCGAGTACCTATTCA AACGTTCATGAAACCGACAACGAAAAAGATGAGTTACCGCCCCCACCTAG TCCAGAGAGCGCTGTGAGTTCTTCATACAGTGAGCTTCGTCACGCCACTT TGGAATTCAACAAACCAATTGATTATTTACAAAATAACCAGACATCGAAT CCT---TTGCAAATATATGCAAACCAATATGCGTTGCAACATGATGCCAC AGGCAAGAGCTCTTATACATATGATTCAATATATGAACCTATAAACCCTC GACCCTGTGTTGTAGATACGCTGCCTCGTGAAAATTGTAATCTGCATAAT TCATACGTCAATGATAATAATCCAAACATTTGCCATGAATACAATATTTC GAATTCGATTGATGCTAACCAAACACTATACATACATGGTAATGCTAGAA CTACATTTTATGACGTGAACTCCATACATAGAAATGATAAGGAAGGTCTA AAAAATTACATTTCAATACCCACCGAACCGGTTCAAGAATTTGAAAACTA CGGTAGATGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGCGGAT GTACAGCAATGGATCAAATATACCACATATCTTGCTTCACATGTACAGAT TGCCAAATTAACTTACAGGGAAAACCATTTTATGCATTAGACGGCAAACC CTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGGAACCAATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGACTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCTCTAGATCGAAGTTTTCA TCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGACCACGTTCTATGTAAAAGC TGCAATGCAAAAAGGGTTCAGGCTTTAACAAACCGCATGACGTCAGAACA T--------- >D_yakuba_Zyx-PA ATGGAGTCAGTGGCCCAGCAAATTAGAGAGATGTCGCTTTCAAAAGACGA AATATTAAAAAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTGGCAG AGTTAGTCGGCAAGATAAGTCAAAAGCAAAATGAATCTGTATACAGGAGA TCGGATACACCTCCTAAGCTGCCGATAAAATATAATGAAATGCCTCAGGT TCCATCAAGCCGACAGGTTTCGTGTTCGAGGGAACCACTTTACTCACAAC CTCTGATTGGAGCCGAGAAAACAATAAGTGTGCATATGCCTTTTAGAAAA TACCATACCTCTGAATTTGGAGTTGCTGATACTGAAATAAACAGAAAATC AACTTTGGATAATCCAGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAGAAGGGTCTTTTGGGAGTACCAGCTAAA CCAACACAATCTTTCAACAGCTTTTCAGAGCCACTTTCAAAGACTTTAAG CAAAAGCTTAATATATTGTAATTTAGATTCTGTACACAAAAGTGAAAATA GATCAGAACTATTAACAGAGGAAACTCCGATTGCTGCAAATACATATGCA AATGTTCATGAAGCCGACAACGAAATAGATGACTTACCGCCACCTCCTAG TCCAGAGAGCGCTGTGAGCTCTTCATACAGCGAGCTTCGGCGCGCCACTT CGGAATTTAACAAACCAATTGATTATTTGCAAAATGACCAGACATCGAAT CCTTCTTTGCAAATATATGCAAACCAATATTCGTTGCAGCATGATCCCAT TAGCAAGAGCTCTTCAACATATGATTCAATATATGAACCTATAAACCCAC GACCCTCT---GCAGATATGTTTCCTCGTGAAAGTTGTAATATGTATAAT TCATACGTCAATGATAATACTCCAAGCATTTCCAACAAATTAAATATTTT AAATTCGATCGAAGCGAACCAAACACTATACATACATGGTAACGCTAGAA CTAAATTTTATAAAGGGAGCACTGATCATAGAAATGATAAGGAAGGTCTA AAAAACTACATTTCAATAACCACCGATCCAGTTCAAGAATTAGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTGCTTGGAGAAAGTAGTGGAT GTACAGCAATGGATCAAATATACCATATATCTTGCTTCACATGTACGGAT TGCCAAATTAACTTACAGGGAAAACCATTCTATGCACTAGACGGCAAACC TTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGCA TGAAACCTATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTCGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCTCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCATTT CCAGGACAAGAAGAAACGATCAGGGTAGTGGCCCTAGATCGAAGTTTTCA CCTAGAATGTTATAAGTGCGAGGACTGCGGGCTTTTACTGTCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGTTCTATGTAAAAGC TGCAATGCACAACGAGTTCAGGCTTTAACGAAGCGCATGACATCAGAACA T--------- >D_erecta_Zyx-PA ATGGAGTCAGTGGCCCAGCAACTTAAAGAGCTGTCGCTTTCAAAAGACGA AACATTAAATAGCTCACCGCCTGTATGTATTGGACATGGAAAAGTTGCAG AGTTAGTCGGCAAGATAAGTCAAAGGCAAAATGATTCCGTATATAAGAGA TTGGATACACCTCCTAAGCCGCCGATAAAATATAAGGAAATGCCTCAGGT TCCATCAAGCAGACAGGTTTTATGTTCGCGGGAACCACTTTATTCACAAC CGCTGATTGGAGTCGAGAAAACAATAAGTGGGCATATGCCTTTTAGAAAA TACCTTAGCTCTGAATTCGGAGCTGCTGATACTGAAATGAACAGAAAAAC AACTTTGGATAATCCGGCAATACTGGAACAGCAATTAGAAGCCCTGGCTT ACCACAAACTTCAAATGGAAAAAAAGGGTCTTTTGGGTCTACAAGCTAAA CCAACACAATCTGTAAACAGCTTTTCAGAGCCTCTTTCAAAGACTTTGAG CAAAAGCTTAATATATTGCAATTTAGATTCTGTACACAAAAGTGCAGAAA GATCAGAACTATTTACAGAGACAACTAAGATTACTGCAAGTACATACGCA AATGTTCATGAAGCTGACAACGAAATAGATGACTTACCGCCACCACCTAG TCCAGAAAGCGCTGTGAGTTCTTCATACAGCGAGCTTCGGCGTGCCACTT CGGAATTTAACAAGCCAATTGATTATTTGCAAAATGACGAGACATCGAAT CCTTCTTTACAAATATATGCAAACCAATATGCGTTGCAGCATGATGCCAT AAGCAAGAGCACTTCTACATATGATTCAATATATGAGCCTATAAACCCGC GACCGTCT---GCAGATATGTTGCCTCGTGAAACTTGTAATCTGTATAAT TCATACGTCAGTGATAGTATTCCAAGCATTTCCAATGAATTAAATATTTT AAATTCGATTGAAGCAAACCAAACAGCATACATACATGGTAATGCTAAAA CAAAATTTTATAACTTGAACACTGTCCATAGAAATGATAATGAAGGTCTA AAAAACTTCGTTTCAATACCCACCGATCCAGTTCAAGAATTAGAAAACTA CGGTAGGTGTGTCAAATGCAATTCACGTGTACTTGGAGAAAGTAGTGGAT GTACAGCAATGGATCAAATATACCATATAACTTGCTTCACATGTGCAGAT TGTCAAATTAATTTGCAGGGAAAACCATTCTATGCATTAGACGGCAAACC GTATTGCGAATATGATTATTTACAAACACTGGAAAAATGCTCTGTTTGTA TGGAACCTATTTTAGAGAGAATTCTTAGAGCTACTGGAAAACCATATCAT CCGCAATGTTTTACATGTGTTGTATGCGGAAAAAGCTTAGATGGGCTATT ATTTACAGTTGATGCTACTAATCAAAACTATTGCATAACAGATTTTCATA AAAAATTTGCCCCTCGCTGTTGTGTCTGCAAGCAACCAATTATGCCAGAT CCAGGACAAGAAGAAACGATCAGAGTAGTGGCCCTAGATCGAAGTTTTCA CCTAGAATGTTATAAGTGTGAGGACTGTGGGCTCTTACTATCATCTGAAG CTGAGGGCCGCGGATGTTATCCCCTGGATGATCACGTTCTATGTAAAAGC TGTAATGCACAACGAGTTCAGGCTTTAACGAAGCGCATGACGTCAGAACA T---------
>D_melanogaster_Zyx-PA MESVAQQLRELSLPKGDTG--SPLVCIGHGKVAKLVAKISNNQNASVKRR LDIPPKPPIKYNEMPQVPSSRQVLCSREPLYSQPLIGVEKTMRGHMPFRK YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVQAK PTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYS NVNETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTTN P-LQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEH >D_sechellia_Zyx-PA MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAEISKKQNASLNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIEISELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRESCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNAKTTFYDVNTIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRASGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEH >D_simulans_Zyx-PA MESVAQQLRGLSLPKGDTG--SPPVCIGHGKVAEIVAKISKKQNASVNRR LDIPPKPPIKYNEMPQVPSSRQVSCSREPLYSQPLIGVEK-MRGHMPFRK YLSSEFGVADTQMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGVKAK PTQPLKSFTKPLSKTLSKSLIYSNLGFEHNKIETSELATDETKRSASTYS NVHETDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQTSN P-LQIYANQYALQHDATGKSSYTYDSIYEPINPRPCVVDTLPRENCNLHN SYVNDNNPNICHEYNISNSIDANQTLYIHGNARTTFYDVNSIHRNDKEGL KNYISIPTEPVQEFENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAKRVQALTNRMTSEH >D_yakuba_Zyx-PA MESVAQQIREMSLSKDEILKSSPPVCIGHGKVAELVGKISQKQNESVYRR SDTPPKLPIKYNEMPQVPSSRQVSCSREPLYSQPLIGAEKTISVHMPFRK YHTSEFGVADTEINRKSTLDNPAILEQQLEALAYHKLQMEKKGLLGVPAK PTQSFNSFSEPLSKTLSKSLIYCNLDSVHKSENRSELLTEETPIAANTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDQTSN PSLQIYANQYSLQHDPISKSSSTYDSIYEPINPRPS-ADMFPRESCNMYN SYVNDNTPSISNKLNILNSIEANQTLYIHGNARTKFYKGSTDHRNDKEGL KNYISITTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHISCFTCTD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMKPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPF PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH >D_erecta_Zyx-PA MESVAQQLKELSLSKDETLNSSPPVCIGHGKVAELVGKISQRQNDSVYKR LDTPPKPPIKYKEMPQVPSSRQVLCSREPLYSQPLIGVEKTISGHMPFRK YLSSEFGAADTEMNRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGLQAK PTQSVNSFSEPLSKTLSKSLIYCNLDSVHKSAERSELFTETTKITASTYA NVHEADNEIDDLPPPPSPESAVSSSYSELRRATSEFNKPIDYLQNDETSN PSLQIYANQYALQHDAISKSTSTYDSIYEPINPRPS-ADMLPRETCNLYN SYVSDSIPSISNELNILNSIEANQTAYIHGNAKTKFYNLNTVHRNDNEGL KNFVSIPTDPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHITCFTCAD CQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCMEPILERILRATGKPYH PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPD PGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS CNAQRVQALTKRMTSEH
#NEXUS [ID: 0913485815] begin taxa; dimensions ntax=5; taxlabels D_melanogaster_Zyx-PA D_sechellia_Zyx-PA D_simulans_Zyx-PA D_yakuba_Zyx-PA D_erecta_Zyx-PA ; end; begin trees; translate 1 D_melanogaster_Zyx-PA, 2 D_sechellia_Zyx-PA, 3 D_simulans_Zyx-PA, 4 D_yakuba_Zyx-PA, 5 D_erecta_Zyx-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01861444,(2:0.00336787,3:0.002926214)1.000:0.02125651,(4:0.04582903,5:0.03370319)1.000:0.06105413); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01861444,(2:0.00336787,3:0.002926214):0.02125651,(4:0.04582903,5:0.03370319):0.06105413); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3719.64 -3730.11 2 -3719.51 -3729.33 -------------------------------------- TOTAL -3719.58 -3729.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/Zyx-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.189077 0.000257 0.159200 0.222165 0.188174 1398.94 1449.97 1.001 r(A<->C){all} 0.097242 0.000380 0.060532 0.135450 0.096057 1173.53 1200.98 1.000 r(A<->G){all} 0.258165 0.001002 0.196821 0.318386 0.256882 845.78 849.69 1.000 r(A<->T){all} 0.106706 0.000340 0.070165 0.142745 0.106066 1122.21 1133.18 1.000 r(C<->G){all} 0.108685 0.000685 0.057809 0.158378 0.107646 990.69 1152.01 1.000 r(C<->T){all} 0.317615 0.001242 0.251182 0.389749 0.316655 720.05 913.54 1.000 r(G<->T){all} 0.111587 0.000581 0.068112 0.159611 0.110006 979.26 1054.62 1.000 pi(A){all} 0.347158 0.000123 0.325303 0.368486 0.347037 955.78 1069.91 1.000 pi(C){all} 0.197939 0.000085 0.179615 0.215731 0.197720 1186.62 1198.37 1.000 pi(G){all} 0.190215 0.000080 0.173522 0.208727 0.190064 948.74 1126.14 1.000 pi(T){all} 0.264688 0.000107 0.246279 0.286423 0.264693 1061.93 1175.99 1.000 alpha{1,2} 0.330111 0.056640 0.000106 0.776169 0.278501 1293.65 1338.83 1.000 alpha{3} 1.306965 0.422380 0.352092 2.605617 1.162313 902.98 1201.99 1.000 pinvar{all} 0.146599 0.011462 0.000009 0.348673 0.125051 970.68 1077.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/444/Zyx-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 5 ls = 562 Codon usage in sequences ---------------------------------------------------------------------------------------------------------------------- Phe TTT 9 11 11 12 10 | Ser TCT 10 9 8 10 8 | Tyr TAT 19 19 19 18 19 | Cys TGT 15 16 16 14 18 TTC 4 3 3 3 4 | TCC 1 0 1 1 2 | TAC 9 9 9 10 8 | TGC 10 11 11 12 8 Leu TTA 18 14 13 18 18 | TCA 13 16 16 17 15 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 6 8 8 5 9 | TCG 4 5 5 8 5 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 10 10 10 9 10 | Pro CCT 13 13 13 14 12 | His CAT 13 13 13 11 10 | Arg CGT 3 3 3 2 3 CTC 3 3 3 0 1 | CCC 5 5 5 3 2 | CAC 2 4 4 4 4 | CGC 4 3 3 4 3 CTA 10 9 9 8 8 | CCA 14 15 15 17 14 | Gln CAA 20 19 19 20 21 | CGA 2 2 2 4 3 CTG 6 5 5 7 7 | CCG 7 7 7 5 10 | CAG 8 8 8 8 7 | CGG 1 1 1 1 2 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 13 11 11 13 12 | Thr ACT 9 7 8 10 12 | Asn AAT 22 20 21 19 18 | Ser AGT 9 8 7 8 11 ATC 2 1 1 2 1 | ACC 1 4 3 3 1 | AAC 15 15 15 13 12 | AGC 10 10 10 13 12 ATA 14 17 16 16 15 | ACA 20 18 19 14 17 | Lys AAA 23 29 28 25 24 | Arg AGA 10 10 12 9 9 Met ATG 10 10 10 11 10 | ACG 4 3 3 3 3 | AAG 13 9 10 11 12 | AGG 4 4 3 4 2 ---------------------------------------------------------------------------------------------------------------------- Val GTT 13 11 11 9 11 | Ala GCT 11 11 11 11 11 | Asp GAT 19 20 20 22 23 | Gly GGT 6 5 5 4 5 GTC 4 5 5 5 6 | GCC 6 6 6 6 6 | GAC 7 7 7 6 6 | GGC 4 4 4 3 3 GTA 6 6 7 6 7 | GCA 7 7 7 9 13 | Glu GAA 30 29 29 29 29 | GGA 12 12 13 12 11 GTG 4 4 4 6 3 | GCG 3 3 3 1 1 | GAG 9 10 9 11 12 | GGG 3 5 4 3 3 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Zyx-PA position 1: T:0.20996 C:0.21530 A:0.31851 G:0.25623 position 2: T:0.23488 C:0.22776 A:0.37189 G:0.16548 position 3: T:0.34520 C:0.15480 A:0.35409 G:0.14591 Average T:0.26335 C:0.19929 A:0.34816 G:0.18921 #2: D_sechellia_Zyx-PA position 1: T:0.21530 C:0.21352 A:0.31317 G:0.25801 position 2: T:0.22776 C:0.22954 A:0.37544 G:0.16726 position 3: T:0.33274 C:0.16014 A:0.36121 G:0.14591 Average T:0.25860 C:0.20107 A:0.34994 G:0.19039 #3: D_simulans_Zyx-PA position 1: T:0.21352 C:0.21352 A:0.31495 G:0.25801 position 2: T:0.22598 C:0.23132 A:0.37544 G:0.16726 position 3: T:0.33274 C:0.16014 A:0.36477 G:0.14235 Average T:0.25741 C:0.20166 A:0.35172 G:0.18921 #4: D_yakuba_Zyx-PA position 1: T:0.22776 C:0.20819 A:0.30961 G:0.25445 position 2: T:0.23132 C:0.23488 A:0.36833 G:0.16548 position 3: T:0.33096 C:0.15658 A:0.36299 G:0.14947 Average T:0.26335 C:0.19988 A:0.34698 G:0.18980 #5: D_erecta_Zyx-PA position 1: T:0.22064 C:0.20819 A:0.30427 G:0.26690 position 2: T:0.23488 C:0.23488 A:0.36477 G:0.16548 position 3: T:0.34342 C:0.14057 A:0.36299 G:0.15302 Average T:0.26631 C:0.19454 A:0.34401 G:0.19514 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 53 | Ser S TCT 45 | Tyr Y TAT 94 | Cys C TGT 79 TTC 17 | TCC 5 | TAC 45 | TGC 52 Leu L TTA 81 | TCA 77 | *** * TAA 0 | *** * TGA 0 TTG 36 | TCG 27 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 49 | Pro P CCT 65 | His H CAT 60 | Arg R CGT 14 CTC 10 | CCC 20 | CAC 18 | CGC 17 CTA 44 | CCA 75 | Gln Q CAA 99 | CGA 13 CTG 30 | CCG 36 | CAG 39 | CGG 6 ------------------------------------------------------------------------------ Ile I ATT 60 | Thr T ACT 46 | Asn N AAT 100 | Ser S AGT 43 ATC 7 | ACC 12 | AAC 70 | AGC 55 ATA 78 | ACA 88 | Lys K AAA 129 | Arg R AGA 50 Met M ATG 51 | ACG 16 | AAG 55 | AGG 17 ------------------------------------------------------------------------------ Val V GTT 55 | Ala A GCT 55 | Asp D GAT 104 | Gly G GGT 25 GTC 25 | GCC 30 | GAC 33 | GGC 18 GTA 32 | GCA 43 | Glu E GAA 146 | GGA 60 GTG 21 | GCG 11 | GAG 51 | GGG 18 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.21744 C:0.21174 A:0.31210 G:0.25872 position 2: T:0.23096 C:0.23167 A:0.37117 G:0.16619 position 3: T:0.33701 C:0.15445 A:0.36121 G:0.14733 Average T:0.26180 C:0.19929 A:0.34816 G:0.19075 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Zyx-PA D_sechellia_Zyx-PA 0.3847 (0.0288 0.0750) D_simulans_Zyx-PA 0.3280 (0.0265 0.0807) 1.0105 (0.0054 0.0053) D_yakuba_Zyx-PA 0.3597 (0.0759 0.2110) 0.4010 (0.0819 0.2042) 0.3804 (0.0802 0.2109) D_erecta_Zyx-PA 0.4004 (0.0713 0.1780) 0.3963 (0.0742 0.1871) 0.3788 (0.0733 0.1936) 0.3130 (0.0470 0.1500) Model 0: one-ratio TREE # 1: (1, (2, 3), (4, 5)); MP score: 243 lnL(ntime: 7 np: 9): -3625.019945 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.053703 0.057746 0.009103 0.007292 0.159008 0.123500 0.092794 1.930873 0.320070 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.50315 (1: 0.053703, (2: 0.009103, 3: 0.007292): 0.057746, (4: 0.123500, 5: 0.092794): 0.159008); (D_melanogaster_Zyx-PA: 0.053703, (D_sechellia_Zyx-PA: 0.009103, D_simulans_Zyx-PA: 0.007292): 0.057746, (D_yakuba_Zyx-PA: 0.123500, D_erecta_Zyx-PA: 0.092794): 0.159008); Detailed output identifying parameters kappa (ts/tv) = 1.93087 omega (dN/dS) = 0.32007 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.054 1321.7 364.3 0.3201 0.0123 0.0383 16.2 14.0 6..7 0.058 1321.7 364.3 0.3201 0.0132 0.0412 17.4 15.0 7..2 0.009 1321.7 364.3 0.3201 0.0021 0.0065 2.7 2.4 7..3 0.007 1321.7 364.3 0.3201 0.0017 0.0052 2.2 1.9 6..8 0.159 1321.7 364.3 0.3201 0.0363 0.1135 48.0 41.3 8..4 0.124 1321.7 364.3 0.3201 0.0282 0.0882 37.3 32.1 8..5 0.093 1321.7 364.3 0.3201 0.0212 0.0662 28.0 24.1 tree length for dN: 0.1150 tree length for dS: 0.3592 Time used: 0:02 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 243 check convergence.. lnL(ntime: 7 np: 10): -3608.849137 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056653 0.060018 0.009267 0.007601 0.173587 0.132039 0.097250 1.990657 0.629272 0.005474 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.53641 (1: 0.056653, (2: 0.009267, 3: 0.007601): 0.060018, (4: 0.132039, 5: 0.097250): 0.173587); (D_melanogaster_Zyx-PA: 0.056653, (D_sechellia_Zyx-PA: 0.009267, D_simulans_Zyx-PA: 0.007601): 0.060018, (D_yakuba_Zyx-PA: 0.132039, D_erecta_Zyx-PA: 0.097250): 0.173587); Detailed output identifying parameters kappa (ts/tv) = 1.99066 dN/dS (w) for site classes (K=2) p: 0.62927 0.37073 w: 0.00547 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1319.8 366.2 0.3742 0.0139 0.0370 18.3 13.6 6..7 0.060 1319.8 366.2 0.3742 0.0147 0.0392 19.4 14.4 7..2 0.009 1319.8 366.2 0.3742 0.0023 0.0061 3.0 2.2 7..3 0.008 1319.8 366.2 0.3742 0.0019 0.0050 2.5 1.8 6..8 0.174 1319.8 366.2 0.3742 0.0424 0.1134 56.0 41.5 8..4 0.132 1319.8 366.2 0.3742 0.0323 0.0863 42.6 31.6 8..5 0.097 1319.8 366.2 0.3742 0.0238 0.0635 31.4 23.3 Time used: 0:05 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 243 check convergence.. lnL(ntime: 7 np: 12): -3608.849137 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056653 0.060018 0.009267 0.007601 0.173587 0.132039 0.097250 1.990657 0.629273 0.271267 0.005474 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.53641 (1: 0.056653, (2: 0.009267, 3: 0.007601): 0.060018, (4: 0.132039, 5: 0.097250): 0.173587); (D_melanogaster_Zyx-PA: 0.056653, (D_sechellia_Zyx-PA: 0.009267, D_simulans_Zyx-PA: 0.007601): 0.060018, (D_yakuba_Zyx-PA: 0.132039, D_erecta_Zyx-PA: 0.097250): 0.173587); Detailed output identifying parameters kappa (ts/tv) = 1.99066 dN/dS (w) for site classes (K=3) p: 0.62927 0.27127 0.09946 w: 0.00547 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1319.8 366.2 0.3742 0.0139 0.0370 18.3 13.6 6..7 0.060 1319.8 366.2 0.3742 0.0147 0.0392 19.4 14.4 7..2 0.009 1319.8 366.2 0.3742 0.0023 0.0061 3.0 2.2 7..3 0.008 1319.8 366.2 0.3742 0.0019 0.0050 2.5 1.8 6..8 0.174 1319.8 366.2 0.3742 0.0424 0.1134 56.0 41.5 8..4 0.132 1319.8 366.2 0.3742 0.0323 0.0863 42.6 31.6 8..5 0.097 1319.8 366.2 0.3742 0.0238 0.0635 31.4 23.3 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zyx-PA) Pr(w>1) post mean +- SE for w 19 G 0.515 1.391 +- 0.614 152 L 0.521 1.397 +- 0.611 178 E 0.510 1.373 +- 0.547 179 I 0.524 1.392 +- 0.567 185 L 0.582 1.469 +- 0.631 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.806 0.192 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.778 0.171 0.040 0.008 0.002 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.133 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.016 0.201 0.170 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.045 0.139 0.056 0.036 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.064 0.057 0.059 0.019 0.001 sum of density on p0-p1 = 1.000000 Time used: 0:15 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 243 lnL(ntime: 7 np: 13): -3608.809899 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056559 0.059937 0.009266 0.007590 0.173039 0.131731 0.097096 1.977626 0.496292 0.117254 0.000001 0.000001 0.944621 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.53522 (1: 0.056559, (2: 0.009266, 3: 0.007590): 0.059937, (4: 0.131731, 5: 0.097096): 0.173039); (D_melanogaster_Zyx-PA: 0.056559, (D_sechellia_Zyx-PA: 0.009266, D_simulans_Zyx-PA: 0.007590): 0.059937, (D_yakuba_Zyx-PA: 0.131731, D_erecta_Zyx-PA: 0.097096): 0.173039); Detailed output identifying parameters kappa (ts/tv) = 1.97763 dN/dS (w) for site classes (K=3) p: 0.49629 0.11725 0.38645 w: 0.00000 0.00000 0.94462 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1320.2 365.8 0.3651 0.0137 0.0375 18.1 13.7 6..7 0.060 1320.2 365.8 0.3651 0.0145 0.0397 19.1 14.5 7..2 0.009 1320.2 365.8 0.3651 0.0022 0.0061 3.0 2.2 7..3 0.008 1320.2 365.8 0.3651 0.0018 0.0050 2.4 1.8 6..8 0.173 1320.2 365.8 0.3651 0.0419 0.1147 55.3 42.0 8..4 0.132 1320.2 365.8 0.3651 0.0319 0.0873 42.1 31.9 8..5 0.097 1320.2 365.8 0.3651 0.0235 0.0644 31.0 23.5 Naive Empirical Bayes (NEB) analysis Time used: 0:25 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 243 lnL(ntime: 7 np: 10): -3608.845265 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056596 0.060028 0.009280 0.007598 0.173107 0.131800 0.097223 1.977982 0.019231 0.034462 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.53563 (1: 0.056596, (2: 0.009280, 3: 0.007598): 0.060028, (4: 0.131800, 5: 0.097223): 0.173107); (D_melanogaster_Zyx-PA: 0.056596, (D_sechellia_Zyx-PA: 0.009280, D_simulans_Zyx-PA: 0.007598): 0.060028, (D_yakuba_Zyx-PA: 0.131800, D_erecta_Zyx-PA: 0.097223): 0.173107); Detailed output identifying parameters kappa (ts/tv) = 1.97798 Parameters in M7 (beta): p = 0.01923 q = 0.03446 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00031 0.66281 0.99997 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1320.2 365.8 0.3663 0.0137 0.0374 18.1 13.7 6..7 0.060 1320.2 365.8 0.3663 0.0145 0.0397 19.2 14.5 7..2 0.009 1320.2 365.8 0.3663 0.0022 0.0061 3.0 2.2 7..3 0.008 1320.2 365.8 0.3663 0.0018 0.0050 2.4 1.8 6..8 0.173 1320.2 365.8 0.3663 0.0420 0.1145 55.4 41.9 8..4 0.132 1320.2 365.8 0.3663 0.0319 0.0872 42.2 31.9 8..5 0.097 1320.2 365.8 0.3663 0.0236 0.0643 31.1 23.5 Time used: 0:51 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 243 lnL(ntime: 7 np: 12): -3608.823375 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.056603 0.059972 0.009266 0.007595 0.173284 0.131875 0.097165 1.983392 0.768858 0.014259 0.071992 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.53576 (1: 0.056603, (2: 0.009266, 3: 0.007595): 0.059972, (4: 0.131875, 5: 0.097165): 0.173284); (D_melanogaster_Zyx-PA: 0.056603, (D_sechellia_Zyx-PA: 0.009266, D_simulans_Zyx-PA: 0.007595): 0.059972, (D_yakuba_Zyx-PA: 0.131875, D_erecta_Zyx-PA: 0.097165): 0.173284); Detailed output identifying parameters kappa (ts/tv) = 1.98339 Parameters in M8 (beta&w>1): p0 = 0.76886 p = 0.01426 q = 0.07199 (p1 = 0.23114) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.07689 0.07689 0.07689 0.07689 0.07689 0.07689 0.07689 0.07689 0.07689 0.07689 0.23114 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00049 0.79461 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.057 1320.0 366.0 0.3692 0.0138 0.0373 18.2 13.6 6..7 0.060 1320.0 366.0 0.3692 0.0146 0.0395 19.2 14.5 7..2 0.009 1320.0 366.0 0.3692 0.0023 0.0061 3.0 2.2 7..3 0.008 1320.0 366.0 0.3692 0.0018 0.0050 2.4 1.8 6..8 0.173 1320.0 366.0 0.3692 0.0421 0.1141 55.6 41.8 8..4 0.132 1320.0 366.0 0.3692 0.0321 0.0869 42.3 31.8 8..5 0.097 1320.0 366.0 0.3692 0.0236 0.0640 31.2 23.4 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zyx-PA) Pr(w>1) post mean +- SE for w 19 G 0.740 1.450 +- 0.631 39 N 0.595 1.233 +- 0.591 40 N 0.659 1.329 +- 0.614 43 A 0.584 1.218 +- 0.589 46 K 0.671 1.346 +- 0.617 72 L 0.697 1.387 +- 0.626 110 I 0.595 1.232 +- 0.588 145 Q 0.622 1.273 +- 0.603 152 L 0.750 1.462 +- 0.627 178 E 0.760 1.470 +- 0.589 179 I 0.775 1.492 +- 0.593 180 E 0.563 1.187 +- 0.580 181 T 0.614 1.261 +- 0.598 185 L 0.829 1.567 +- 0.595 188 E 0.606 1.251 +- 0.599 190 K 0.667 1.341 +- 0.618 192 S 0.628 1.282 +- 0.603 290 S 0.594 1.233 +- 0.593 302 N 0.572 1.200 +- 0.583 309 Y 0.685 1.367 +- 0.622 321 L 0.673 1.350 +- 0.618 328 R 0.593 1.230 +- 0.589 333 D 0.627 1.280 +- 0.601 334 V 0.714 1.411 +- 0.628 336 S 0.647 1.312 +- 0.613 337 I 0.680 1.362 +- 0.624 389 F 0.647 1.310 +- 0.611 495 D 0.586 1.222 +- 0.596 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.117 0.557 0.326 p : 0.452 0.406 0.115 0.026 0.001 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.115 0.094 0.101 0.093 0.074 0.102 0.132 0.143 0.147 ws: 0.796 0.170 0.031 0.003 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:25
Model 1: NearlyNeutral -3608.849137 Model 2: PositiveSelection -3608.849137 Model 0: one-ratio -3625.019945 Model 3: discrete -3608.809899 Model 7: beta -3608.845265 Model 8: beta&w>1 -3608.823375 Model 0 vs 1 32.3416159999997 Model 2 vs 1 0.0 Model 8 vs 7 0.04377999999996973