--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 11:44:20 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/444/ZnT63C-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2539.19         -2550.06
2      -2539.32         -2548.11
--------------------------------------
TOTAL    -2539.25         -2549.50
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.276947    0.004088    0.173222    0.408959    0.266546    889.82    900.67    1.000
r(A<->C){all}   0.016521    0.000202    0.000022    0.044377    0.012764    738.49    931.38    1.000
r(A<->G){all}   0.215619    0.004094    0.096402    0.335531    0.209151    612.96    664.35    1.000
r(A<->T){all}   0.107634    0.001852    0.032118    0.192280    0.103215    675.70    753.69    1.000
r(C<->G){all}   0.045683    0.000392    0.007790    0.083678    0.044189    808.69    817.62    1.000
r(C<->T){all}   0.546885    0.007020    0.381586    0.708404    0.543575    518.98    584.36    1.000
r(G<->T){all}   0.067657    0.000879    0.012686    0.126211    0.064619    960.45    962.27    1.000
pi(A){all}      0.216714    0.000121    0.195536    0.237357    0.216574   1360.48   1430.74    1.000
pi(C){all}      0.281718    0.000139    0.259471    0.305634    0.281469   1340.91   1387.29    1.000
pi(G){all}      0.286630    0.000139    0.263972    0.309806    0.286217   1186.96   1282.11    1.000
pi(T){all}      0.214938    0.000115    0.194793    0.235858    0.214737   1308.71   1359.37    1.000
alpha{1,2}      0.044374    0.000874    0.000193    0.097763    0.040814   1334.28   1417.64    1.001
alpha{3}        2.396865    0.686194    1.021351    4.006378    2.273933   1200.91   1220.15    1.000
pinvar{all}     0.727195    0.001294    0.652538    0.791538    0.730199   1385.62   1411.90    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2399.268392
Model 2: PositiveSelection	-2397.840654
Model 0: one-ratio	-2405.263261
Model 3: discrete	-2397.840654
Model 7: beta	-2399.737968
Model 8: beta&w>1	-2397.857775


Model 0 vs 1	11.989738000000216

Model 2 vs 1	2.855475999999726

Model 8 vs 7	3.760385999999926
>C1
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINISGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGATGGASTGAPVAAIGATSTPKSDLV
>C2
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKPKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGASAGAPVVAIGATSTPKSDLV
>C3
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKPPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRFYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGSTAGVPATAIGVTSTPKSDLV
>C4
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKQPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKVNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGATTGAPAAAIGATSTPKSDLV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=449 

C1              MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
C2              MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
C3              MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
C4              MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
                **************************************************

C1              LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
C2              LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
C3              LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
C4              LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
                **************************************************

C1              RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
C2              RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
C3              RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
C4              RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
                **************************************************

C1              HSRLTELANMDEGEDEQNDFAYEKQKEKAPVKKSSHGHSHDPGQMNMRGA
C2              HSRLTELANMDEGEDEQNDFAYEKPKEKAPVKKSSHGHSHDPGQMNMRGA
C3              HSRLTELANMDEGEDEQNDFAYEKQKEKPPVKKSSHGHSHDPGQMNMRGA
C4              HSRLTELANMDEGEDEQNDFAYEKQKEKQPVKKSSHGHSHDPGQMNMRGA
                ************************ *** *********************

C1              FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
C2              FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
C3              FLHVLSDALGSIIVVISAVVVWKTEWKYRFYMDPALSIVLVVLILHSVWP
C4              FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
                *****************************:********************

C1              LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
C2              LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
C3              LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
C4              LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
                **************************************************

C1              ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
C2              ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
C3              ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
C4              ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
                **************************************************

C1              SSINISGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
C2              SSINMSGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
C3              SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
C4              SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKVNQLPSPTNSPYLCRQR
                ****:*************:**************:****************

C1              NAARQAGDVEAGSLLEATSSGNQGATGGASTGAPVAAIGATSTPKSDLV
C2              NAARQAGDVEAGSLLEATSSGNQGTSGGASAGAPVVAIGATSTPKSDLV
C3              NAARQAGDVEAGSLLEATSSGNQGTSGGSTAGVPATAIGVTSTPKSDLV
C4              NAARQAGDVEAGSLLEATSSGNQGTSGGATTGAPAAAIGATSTPKSDLV
                ************************::**:::*.*..***.*********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  449 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  449 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5388]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [5388]--->[5388]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/ZnT63C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.263 Mb, Max= 30.595 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINISGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGATGGASTGAPVAAIGATSTPKSDLV
>C2
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKPKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGASAGAPVVAIGATSTPKSDLV
>C3
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKPPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRFYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGSTAGVPATAIGVTSTPKSDLV
>C4
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKQPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKVNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGATTGAPAAAIGATSTPKSDLV

FORMAT of file /tmp/tmp4889698396240969295aln Not Supported[FATAL:T-COFFEE]
>C1
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINISGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGATGGASTGAPVAAIGATSTPKSDLV
>C2
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKPKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGASAGAPVVAIGATSTPKSDLV
>C3
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKPPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRFYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGSTAGVPATAIGVTSTPKSDLV
>C4
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKQPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKVNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGATTGAPAAAIGATSTPKSDLV
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:449 S:100 BS:449
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.66 C1	 C2	 98.66
TOP	    1    0	 98.66 C2	 C1	 98.66
BOT	    0    2	 97.10 C1	 C3	 97.10
TOP	    2    0	 97.10 C3	 C1	 97.10
BOT	    0    3	 98.22 C1	 C4	 98.22
TOP	    3    0	 98.22 C4	 C1	 98.22
BOT	    1    2	 97.77 C2	 C3	 97.77
TOP	    2    1	 97.77 C3	 C2	 97.77
BOT	    1    3	 98.22 C2	 C4	 98.22
TOP	    3    1	 98.22 C4	 C2	 98.22
BOT	    2    3	 98.22 C3	 C4	 98.22
TOP	    3    2	 98.22 C4	 C3	 98.22
AVG	 0	 C1	  *	 98.00
AVG	 1	 C2	  *	 98.22
AVG	 2	 C3	  *	 97.70
AVG	 3	 C4	  *	 98.22
TOT	 TOT	  *	 98.03
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCCAAGTACTCGGGCAAAAAATGCCGGCTGCTCTCGATGATGTGGCT
C2              ATGGCCAAGTACTCGGGCAAAAAATGCCGGCTGCTCTCGATGATGTGGCT
C3              ATGGCCAAGTACTCGGGCAAGAAATGCCGGCTGCTATCGATGATGTGGCT
C4              ATGGCCAAGTACTCCGGCAAAAAGTGCCGGCTGCTATCGATGATGTGGCT
                ************** *****.**.***********.**************

C1              TACGGCGTTCTTCTTCTTCGTGGAGATCATAGTGGGCTATGTGACCAATT
C2              CACGGCGTTCTTCTTCTTCGTGGAGATCATTGTTGGCTATGTGACCAATT
C3              TACGGCGTTCTTCTTCTTCGTGGAGATCATTGTGGGCTATGTGACCAATT
C4              TACGGCGTTCTTCTTCTTCGTGGAGATCATAGTGGGCTATGTGACCAATT
                 *****************************:** ****************

C1              CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATTGCGGCC
C2              CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATCGCCGCC
C3              CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATCGCGGCC
C4              CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATCGCGGCC
                ******************************************* ** ***

C1              CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
C2              CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
C3              CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
C4              CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
                **************************************************

C1              GAACACTTTTGGCTGGGCCAGGGCAGAAGTCTTGGGTGCTTTGGTCAACG
C2              GAACACCTTCGGCTGGGCCAGGGCAGAAGTCTTGGGAGCTTTGGTCAACG
C3              GAACACATTTGGCTGGGCAAGGGCAGAAGTCTTGGGAGCTTTGGTCAACG
C4              GAACACCTTCGGCTGGGCCAGGGCAGAAGTCTTGGGTGCTTTGGTTAACG
                ****** ** ********.*****************:******** ****

C1              CCGTTTTCCTGGTGGCCTTGTGCTTCAGCATCACCATCGAGGCTTGCAAA
C2              CCGTTTTCCTGGTGGCCCTGTGCTTCAGCATCACCATCGAGGCTTGCAAA
C3              CCGTGTTCCTGGTGGCCCTCTGCTTCAGCATCACCATCGAGGCTTGCAAA
C4              CCGTTTTCCTGGTGGCCCTCTGCTTCAGCATCACCATCGAGGCTTGCAAA
                **** ************ * ******************************

C1              AGATTCATTGAGGAGGAGCCGATTCACGAGCCTGAACTGCTTGTCATCGT
C2              AGATTCATTGAGGAGGAGCCGATTCACGAGCCTGAACTGCTTGTTATCGT
C3              AGATTCATTGAGGAAGAACCGATTCACGAGCCGGAACTGCTCGTTATCGT
C4              AGATTCATTGAGGAGGAACCGATTCACGAGCCTGAACTGCTTGTCATCGT
                **************.**.************** ******** ** *****

C1              GGGAGCCTTGGGTCTTCTGGTGAATGTTATTGGACTTTGTCTGCTTTACG
C2              GGGAGCCCTGGGTCTTCTGGTGAATGTGATTGGACTTTGTCTGCTTTACG
C3              GGGAGCCTTGGGCCTTCTGGTGAATGTGATTGGACTTTGTCTGCTTTACG
C4              TGGAGCCTTGGGTCTTCTGGTGAATGTGATTGGACTTTGTCTGCTTTACG
                 ****** **** ************** **********************

C1              AGCACGGCGGTCACCATGGACACTCACATGGCGGCGGACTCACCCGTAAC
C2              AGCACGGCGGTCACCATGGTCACTCACATGGCGGCGGACTCACGCGTAAC
C3              AGCACGGCGGTCATCATGGACACTCACATGGCGGCGGACTCACCCGTAAC
C4              AGCACGGCGGTCACCATGGACACTCACACGGCGGCGGACTCACCCGGAAC
                ************* *****:******** ************** ** ***

C1              CACAGCCGCCTCACTGAGTTGGCCAACATGGACGAGGGCGAGGATGAGCA
C2              CACAGCCGCCTCACTGAGTTGGCCAACATGGACGAGGGCGAGGATGAGCA
C3              CACAGCCGCCTCACTGAGTTGGCCAACATGGACGAGGGCGAGGATGAGCA
C4              CACAGCCGCCTGACTGAGTTGGCTAACATGGACGAGGGCGAGGATGAGCA
                *********** *********** **************************

C1              AAACGACTTTGCCTACGAGAAGCAGAAGGAAAAGGCACCGGTCAAGAAAT
C2              GAACGACTTTGCCTACGAGAAGCCGAAGGAAAAGGCACCGGTCAAGAAAT
C3              GAACGACTTTGCCTACGAGAAGCAGAAGGAAAAGCCACCTGTCAAGAAAT
C4              GAACGACTTTGCCTATGAGAAGCAGAAGGAAAAGCAACCGGTCAAGAAGT
                .************** *******.********** .*** ********.*

C1              CCAGCCATGGACACAGCCATGATCCCGGCCAGATGAATATGCGCGGCGCC
C2              CCAGCCATGGACACAGCCATGATCCCGGCCAGATGAATATGCGCGGCGCC
C3              CCAGCCATGGACACAGCCACGATCCCGGCCAGATGAACATGCGCGGCGCC
C4              CCAGCCATGGACACAGCCATGATCCCGGCCAGATGAACATGCGCGGCGCC
                ******************* ***************** ************

C1              TTCTTGCACGTTTTGAGCGATGCCCTTGGCAGCATCATTGTCGTAATCAG
C2              TTTTTGCACGTTTTGAGCGATGCCCTTGGCAGCATCATTGTCGTAATCAG
C3              TTCCTGCACGTTTTGAGCGATGCCCTCGGCAGCATTATTGTTGTAATCAG
C4              TTCCTGCACGTTTTGAGCGACGCCCTCGGCAGCATCATTGTCGTAATCAG
                **  **************** ***** ******** ***** ********

C1              TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGGTACTACATGGATC
C2              TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGATACTACATGGATC
C3              TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGATTCTATATGGATC
C4              TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGATACTACATGGATC
                ************************************.*:*** *******

C1              CCGCTCTGTCCATCGTTTTGGTTGTTTTGATCCTGCACTCCGTGTGGCCG
C2              CCGCTCTGTCCATCGTTCTGGTTGTCCTGATCCTGCACTCCGTGTGGCCG
C3              CCGCTCTGTCCATCGTTCTGGTTGTCCTAATCCTCCACTCCGTGTGGCCG
C4              CCGCTCTGTCCATCGTTCTGGTTGTCCTGATCCTCCACTCCGTGTGGCCG
                ***************** *******  *.***** ***************

C1              CTGCTGCGCGAGTCCGCTTTAATTCTGCTCCAAACGGTGCCCACCCACAT
C2              CTGCTACGCGAGTCCGCCTTGATTCTGCTTCAAACAGTGCCCACCCACAT
C3              CTGCTGCGCGAGTCCGCTTTGATTCTGCTGCAAACGGTACCCACCCACAT
C4              CTGCTGCGCGAGTCCGCTTTGATTCTGCTGCAAACGGTTCCCACCCACAT
                *****.*********** **.******** *****.** ***********

C1              CCAGGTGGATGCCATTCAGAAGAGGCTTCTGGAGAAAGTTGATGGCGTGC
C2              CCAGGTGGACGCCATTCAGAAGAGGCTTCTGGAGAAAGTTGATGGCGTGC
C3              CCAGGTGGACGCCATTCAGAAGAGACTTCTGGAGAAAGTTGATGGCGTGC
C4              CCAGGTGGACGCCATTCAGAAGAGGCTTCTGGAGAAAGTTGACGGCGTGC
                ********* **************.***************** *******

C1              TGGCTGTGCACGAGTTCCATGTGTGGCAACTGGCCGGCGACCGCATCATC
C2              TAGCTGTGCACGAGTTCCATGTCTGGCAACTGGCCGGCGACCGCATCATC
C3              TGGCTGTGCACGAGTTCCATGTGTGGCAACTGGCCGGCGACCGCATCATC
C4              TGGCTGTGCACGAGTTCCATGTGTGGCAATTGGCCGGCGACCGCATCATC
                *.******************** ****** ********************

C1              GCCTCTGCCCATATTAGGTGCCGTAACCTTTCGGAGTACATGAAGATTGC
C2              GCCTCTGCCCATATTAGGTGCCGCAACCTTTCGGAGTACATGAAGATTGC
C3              GCCTCTGCCCACATTAGGTGTCGCAACCTTTCAGAGTACATGAAGATTGC
C4              GCCTCTGCCCATATCAGGTGCCGCAACCTTTCAGAATACATGAAGATTGC
                *********** ** ***** ** ********.**.**************

C1              CGAAAAGGTGAAGGAGTTCTTCCACAACGAGGGTATCCACTCTACCACCA
C2              CGAAAAGGTAAAGGAGTTCTTCCACAACGAGGGTATCCACTCCACCACCA
C3              CGAAAAGGTTAAGGAGTTCTTCCACAACGAGGGCATCCACTCCACCACCA
C4              CGAAAAGGTTAAGGAGTTCTTCCACAACGAGGGTATCCACTCCACCACCA
                ********* *********************** ******** *******

C1              TTCAGCCAGAGTTCAGCGAGATCGAAGGCTGCAACATGTCCGATGGCACC
C2              TCCAGCCGGAGTTCAGCGAGATTGAAGGCTGCAACATGTCTGATGGCACC
C3              TCCAGCCGGAGTTCAGCGAGATTGAAGGCTGCAACATGTCCGATGGAACC
C4              TCCAGCCCGAGTTCAGCGAGATCGAAGGCTGCAACATGTCCGATGGGACC
                * ***** ************** ***************** ***** ***

C1              TCCAGCATCAACATCAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCTAC
C2              TCCAGCATCAACATGAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCCAC
C3              TCCAGCATCAACATGAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCCAC
C4              TCCAGCATCAACATGAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCCAC
                ************** ******************************** **

C1              CACGGAAGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAACAACAAAT
C2              CACGGAAGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAACAACAAAT
C3              TACGGATGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAACAACAAAT
C4              TACGGATGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAATAACAAAG
                 *****:*********************************** ****** 

C1              TGAACCAACTGCCCTCACCCACCAACTCGCCGTATCTGTGCCGCCAGCGG
C2              TGAACCAACTGCCCTCACCCACCAACTCGCCGTATCTGTGCCGCCAGCGG
C3              TGAATCAACTGCCCTCACCCACCAACTCGCCGTATCTGTGCCGCCAGCGA
C4              TGAACCAACTGCCCTCACCCACCAACTCGCCGTATCTATGCCGCCAGCGA
                **** ********************************.***********.

C1              AATGCCGCCCGACAGGCCGGCGATGTGGAGGCGGGTTCCCTGCTGGAGGC
C2              AATGCCGCCCGACAGGCCGGCGATGTGGAGGCGGGTTCCCTGCTGGAGGC
C3              AATGCCGCCCGACAAGCCGGCGATGTGGAGGCGGGTTCCCTGCTGGAGGC
C4              AATGCCGCCCGACAGGCCGGCGATGTGGAGGCAGGTTCCCTGCTGGAGGC
                **************.*****************.*****************

C1              CACGTCCAGTGGCAACCAGGGAGCCACTGGTGGGGCCAGCACAGGAGCGC
C2              CACGTCCAGTGGCAACCAGGGAACCTCTGGCGGTGCCAGCGCAGGAGCTC
C3              CACGTCCAGTGGCAATCAGGGAACCTCAGGCGGCTCCACCGCAGGAGTGC
C4              CACGTCCAGTGGCAACCAGGGAACCTCTGGCGGCGCCACCACAGGAGCGC
                *************** ******.**:*:** **  *** *.******  *

C1              CCGTGGCTGCGATAGGGGCCACGTCAACGCCGAAGAGCGATTTGGTT
C2              CCGTGGTTGCGATAGGGGCCACGTCAACCCCGAAAAGCGATTTGGTT
C3              CCGCGACTGCGATAGGGGTCACGTCAACGCCGAAGAGCGATTTGGTT
C4              CTGCGGCTGCGATAGGCGCCACGTCAACGCCGAAGAGCGATTTGGTT
                * * *. ********* * ********* *****.************



>C1
ATGGCCAAGTACTCGGGCAAAAAATGCCGGCTGCTCTCGATGATGTGGCT
TACGGCGTTCTTCTTCTTCGTGGAGATCATAGTGGGCTATGTGACCAATT
CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATTGCGGCC
CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
GAACACTTTTGGCTGGGCCAGGGCAGAAGTCTTGGGTGCTTTGGTCAACG
CCGTTTTCCTGGTGGCCTTGTGCTTCAGCATCACCATCGAGGCTTGCAAA
AGATTCATTGAGGAGGAGCCGATTCACGAGCCTGAACTGCTTGTCATCGT
GGGAGCCTTGGGTCTTCTGGTGAATGTTATTGGACTTTGTCTGCTTTACG
AGCACGGCGGTCACCATGGACACTCACATGGCGGCGGACTCACCCGTAAC
CACAGCCGCCTCACTGAGTTGGCCAACATGGACGAGGGCGAGGATGAGCA
AAACGACTTTGCCTACGAGAAGCAGAAGGAAAAGGCACCGGTCAAGAAAT
CCAGCCATGGACACAGCCATGATCCCGGCCAGATGAATATGCGCGGCGCC
TTCTTGCACGTTTTGAGCGATGCCCTTGGCAGCATCATTGTCGTAATCAG
TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGGTACTACATGGATC
CCGCTCTGTCCATCGTTTTGGTTGTTTTGATCCTGCACTCCGTGTGGCCG
CTGCTGCGCGAGTCCGCTTTAATTCTGCTCCAAACGGTGCCCACCCACAT
CCAGGTGGATGCCATTCAGAAGAGGCTTCTGGAGAAAGTTGATGGCGTGC
TGGCTGTGCACGAGTTCCATGTGTGGCAACTGGCCGGCGACCGCATCATC
GCCTCTGCCCATATTAGGTGCCGTAACCTTTCGGAGTACATGAAGATTGC
CGAAAAGGTGAAGGAGTTCTTCCACAACGAGGGTATCCACTCTACCACCA
TTCAGCCAGAGTTCAGCGAGATCGAAGGCTGCAACATGTCCGATGGCACC
TCCAGCATCAACATCAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCTAC
CACGGAAGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAACAACAAAT
TGAACCAACTGCCCTCACCCACCAACTCGCCGTATCTGTGCCGCCAGCGG
AATGCCGCCCGACAGGCCGGCGATGTGGAGGCGGGTTCCCTGCTGGAGGC
CACGTCCAGTGGCAACCAGGGAGCCACTGGTGGGGCCAGCACAGGAGCGC
CCGTGGCTGCGATAGGGGCCACGTCAACGCCGAAGAGCGATTTGGTT
>C2
ATGGCCAAGTACTCGGGCAAAAAATGCCGGCTGCTCTCGATGATGTGGCT
CACGGCGTTCTTCTTCTTCGTGGAGATCATTGTTGGCTATGTGACCAATT
CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATCGCCGCC
CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
GAACACCTTCGGCTGGGCCAGGGCAGAAGTCTTGGGAGCTTTGGTCAACG
CCGTTTTCCTGGTGGCCCTGTGCTTCAGCATCACCATCGAGGCTTGCAAA
AGATTCATTGAGGAGGAGCCGATTCACGAGCCTGAACTGCTTGTTATCGT
GGGAGCCCTGGGTCTTCTGGTGAATGTGATTGGACTTTGTCTGCTTTACG
AGCACGGCGGTCACCATGGTCACTCACATGGCGGCGGACTCACGCGTAAC
CACAGCCGCCTCACTGAGTTGGCCAACATGGACGAGGGCGAGGATGAGCA
GAACGACTTTGCCTACGAGAAGCCGAAGGAAAAGGCACCGGTCAAGAAAT
CCAGCCATGGACACAGCCATGATCCCGGCCAGATGAATATGCGCGGCGCC
TTTTTGCACGTTTTGAGCGATGCCCTTGGCAGCATCATTGTCGTAATCAG
TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGATACTACATGGATC
CCGCTCTGTCCATCGTTCTGGTTGTCCTGATCCTGCACTCCGTGTGGCCG
CTGCTACGCGAGTCCGCCTTGATTCTGCTTCAAACAGTGCCCACCCACAT
CCAGGTGGACGCCATTCAGAAGAGGCTTCTGGAGAAAGTTGATGGCGTGC
TAGCTGTGCACGAGTTCCATGTCTGGCAACTGGCCGGCGACCGCATCATC
GCCTCTGCCCATATTAGGTGCCGCAACCTTTCGGAGTACATGAAGATTGC
CGAAAAGGTAAAGGAGTTCTTCCACAACGAGGGTATCCACTCCACCACCA
TCCAGCCGGAGTTCAGCGAGATTGAAGGCTGCAACATGTCTGATGGCACC
TCCAGCATCAACATGAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCCAC
CACGGAAGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAACAACAAAT
TGAACCAACTGCCCTCACCCACCAACTCGCCGTATCTGTGCCGCCAGCGG
AATGCCGCCCGACAGGCCGGCGATGTGGAGGCGGGTTCCCTGCTGGAGGC
CACGTCCAGTGGCAACCAGGGAACCTCTGGCGGTGCCAGCGCAGGAGCTC
CCGTGGTTGCGATAGGGGCCACGTCAACCCCGAAAAGCGATTTGGTT
>C3
ATGGCCAAGTACTCGGGCAAGAAATGCCGGCTGCTATCGATGATGTGGCT
TACGGCGTTCTTCTTCTTCGTGGAGATCATTGTGGGCTATGTGACCAATT
CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATCGCGGCC
CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
GAACACATTTGGCTGGGCAAGGGCAGAAGTCTTGGGAGCTTTGGTCAACG
CCGTGTTCCTGGTGGCCCTCTGCTTCAGCATCACCATCGAGGCTTGCAAA
AGATTCATTGAGGAAGAACCGATTCACGAGCCGGAACTGCTCGTTATCGT
GGGAGCCTTGGGCCTTCTGGTGAATGTGATTGGACTTTGTCTGCTTTACG
AGCACGGCGGTCATCATGGACACTCACATGGCGGCGGACTCACCCGTAAC
CACAGCCGCCTCACTGAGTTGGCCAACATGGACGAGGGCGAGGATGAGCA
GAACGACTTTGCCTACGAGAAGCAGAAGGAAAAGCCACCTGTCAAGAAAT
CCAGCCATGGACACAGCCACGATCCCGGCCAGATGAACATGCGCGGCGCC
TTCCTGCACGTTTTGAGCGATGCCCTCGGCAGCATTATTGTTGTAATCAG
TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGATTCTATATGGATC
CCGCTCTGTCCATCGTTCTGGTTGTCCTAATCCTCCACTCCGTGTGGCCG
CTGCTGCGCGAGTCCGCTTTGATTCTGCTGCAAACGGTACCCACCCACAT
CCAGGTGGACGCCATTCAGAAGAGACTTCTGGAGAAAGTTGATGGCGTGC
TGGCTGTGCACGAGTTCCATGTGTGGCAACTGGCCGGCGACCGCATCATC
GCCTCTGCCCACATTAGGTGTCGCAACCTTTCAGAGTACATGAAGATTGC
CGAAAAGGTTAAGGAGTTCTTCCACAACGAGGGCATCCACTCCACCACCA
TCCAGCCGGAGTTCAGCGAGATTGAAGGCTGCAACATGTCCGATGGAACC
TCCAGCATCAACATGAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCCAC
TACGGATGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAACAACAAAT
TGAATCAACTGCCCTCACCCACCAACTCGCCGTATCTGTGCCGCCAGCGA
AATGCCGCCCGACAAGCCGGCGATGTGGAGGCGGGTTCCCTGCTGGAGGC
CACGTCCAGTGGCAATCAGGGAACCTCAGGCGGCTCCACCGCAGGAGTGC
CCGCGACTGCGATAGGGGTCACGTCAACGCCGAAGAGCGATTTGGTT
>C4
ATGGCCAAGTACTCCGGCAAAAAGTGCCGGCTGCTATCGATGATGTGGCT
TACGGCGTTCTTCTTCTTCGTGGAGATCATAGTGGGCTATGTGACCAATT
CGATGGCTCTGGTGGCGGATAGTTTCCACATGCTGGGCGACATCGCGGCC
CTGGTCATATCATTCCTGTCTGTGAAGATGTCACCGAAAAAGTGGTCAAA
GAACACCTTCGGCTGGGCCAGGGCAGAAGTCTTGGGTGCTTTGGTTAACG
CCGTTTTCCTGGTGGCCCTCTGCTTCAGCATCACCATCGAGGCTTGCAAA
AGATTCATTGAGGAGGAACCGATTCACGAGCCTGAACTGCTTGTCATCGT
TGGAGCCTTGGGTCTTCTGGTGAATGTGATTGGACTTTGTCTGCTTTACG
AGCACGGCGGTCACCATGGACACTCACACGGCGGCGGACTCACCCGGAAC
CACAGCCGCCTGACTGAGTTGGCTAACATGGACGAGGGCGAGGATGAGCA
GAACGACTTTGCCTATGAGAAGCAGAAGGAAAAGCAACCGGTCAAGAAGT
CCAGCCATGGACACAGCCATGATCCCGGCCAGATGAACATGCGCGGCGCC
TTCCTGCACGTTTTGAGCGACGCCCTCGGCAGCATCATTGTCGTAATCAG
TGCTGTGGTGGTGTGGAAGACGGAGTGGAAGTACCGATACTACATGGATC
CCGCTCTGTCCATCGTTCTGGTTGTCCTGATCCTCCACTCCGTGTGGCCG
CTGCTGCGCGAGTCCGCTTTGATTCTGCTGCAAACGGTTCCCACCCACAT
CCAGGTGGACGCCATTCAGAAGAGGCTTCTGGAGAAAGTTGACGGCGTGC
TGGCTGTGCACGAGTTCCATGTGTGGCAATTGGCCGGCGACCGCATCATC
GCCTCTGCCCATATCAGGTGCCGCAACCTTTCAGAATACATGAAGATTGC
CGAAAAGGTTAAGGAGTTCTTCCACAACGAGGGTATCCACTCCACCACCA
TCCAGCCCGAGTTCAGCGAGATCGAAGGCTGCAACATGTCCGATGGGACC
TCCAGCATCAACATGAGCGGCTCCGACTGCTGCGCGTTGGATTGTCCCAC
TACGGATGAAGGATGTGTCAAGGCCACGTGCTGCCAAAACAATAACAAAG
TGAACCAACTGCCCTCACCCACCAACTCGCCGTATCTATGCCGCCAGCGA
AATGCCGCCCGACAGGCCGGCGATGTGGAGGCAGGTTCCCTGCTGGAGGC
CACGTCCAGTGGCAACCAGGGAACCTCTGGCGGCGCCACCACAGGAGCGC
CTGCGGCTGCGATAGGCGCCACGTCAACGCCGAAGAGCGATTTGGTT
>C1
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINISGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGATGGASTGAPVAAIGATSTPKSDLV
>C2
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKPKEKAPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTEEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGASAGAPVVAIGATSTPKSDLV
>C3
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKPPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRFYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKLNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGSTAGVPATAIGVTSTPKSDLV
>C4
MAKYSGKKCRLLSMMWLTAFFFFVEIIVGYVTNSMALVADSFHMLGDIAA
LVISFLSVKMSPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACK
RFIEEEPIHEPELLVIVGALGLLVNVIGLCLLYEHGGHHGHSHGGGLTRN
HSRLTELANMDEGEDEQNDFAYEKQKEKQPVKKSSHGHSHDPGQMNMRGA
FLHVLSDALGSIIVVISAVVVWKTEWKYRYYMDPALSIVLVVLILHSVWP
LLRESALILLQTVPTHIQVDAIQKRLLEKVDGVLAVHEFHVWQLAGDRII
ASAHIRCRNLSEYMKIAEKVKEFFHNEGIHSTTIQPEFSEIEGCNMSDGT
SSINMSGSDCCALDCPTTDEGCVKATCCQNNNKVNQLPSPTNSPYLCRQR
NAARQAGDVEAGSLLEATSSGNQGTSGGATTGAPAAAIGATSTPKSDLV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 1347 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481283657
      Setting output file names to "/opt/ADOPS/444/ZnT63C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 882557976
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0896721420
      Seed = 1253102829
      Swapseed = 1481283657
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 15 unique site patterns
      Division 2 has 11 unique site patterns
      Division 3 has 49 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2963.148751 -- -26.620141
         Chain 2 -- -2924.828074 -- -26.620141
         Chain 3 -- -2952.528657 -- -26.620141
         Chain 4 -- -2952.528657 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2924.828074 -- -26.620141
         Chain 2 -- -2952.528657 -- -26.620141
         Chain 3 -- -2952.528657 -- -26.620141
         Chain 4 -- -2924.828074 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2963.149] (-2924.828) (-2952.529) (-2952.529) * [-2924.828] (-2952.529) (-2952.529) (-2924.828) 
        500 -- (-2598.896) (-2610.092) [-2596.161] (-2605.585) * (-2598.159) [-2594.969] (-2604.281) (-2603.922) -- 0:00:00
       1000 -- (-2589.200) (-2593.803) [-2581.692] (-2587.678) * (-2583.886) (-2587.650) [-2593.344] (-2592.736) -- 0:00:00
       1500 -- (-2580.057) (-2590.338) [-2568.014] (-2578.331) * [-2572.245] (-2582.744) (-2581.974) (-2580.625) -- 0:00:00
       2000 -- (-2569.484) (-2584.129) [-2563.781] (-2565.609) * (-2567.999) (-2579.092) [-2570.045] (-2580.209) -- 0:00:00
       2500 -- (-2562.116) (-2573.712) (-2573.071) [-2554.443] * (-2566.864) (-2568.599) [-2565.519] (-2567.487) -- 0:00:00
       3000 -- [-2564.647] (-2556.338) (-2569.806) (-2551.671) * [-2557.375] (-2560.620) (-2559.753) (-2558.276) -- 0:00:00
       3500 -- (-2561.166) (-2556.283) (-2565.525) [-2549.879] * (-2551.384) (-2559.004) (-2556.316) [-2564.191] -- 0:00:00
       4000 -- (-2559.014) (-2553.406) (-2564.022) [-2542.824] * (-2552.251) (-2555.281) [-2552.684] (-2561.367) -- 0:00:00
       4500 -- (-2556.540) (-2550.126) (-2565.164) [-2540.461] * (-2544.856) [-2551.297] (-2553.697) (-2559.577) -- 0:00:00
       5000 -- (-2551.337) (-2547.503) (-2567.132) [-2543.071] * (-2540.361) [-2543.242] (-2547.113) (-2566.955) -- 0:00:00

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-2546.527] (-2547.414) (-2561.102) (-2547.335) * (-2539.588) [-2545.105] (-2548.051) (-2559.586) -- 0:00:00
       6000 -- (-2552.397) [-2539.393] (-2561.303) (-2539.574) * [-2543.165] (-2543.700) (-2553.172) (-2559.963) -- 0:02:45
       6500 -- (-2539.903) [-2547.270] (-2561.121) (-2547.652) * (-2542.147) [-2539.897] (-2553.139) (-2562.512) -- 0:02:32
       7000 -- (-2542.918) (-2539.798) (-2564.093) [-2544.735] * (-2544.389) [-2544.727] (-2548.709) (-2561.737) -- 0:02:21
       7500 -- (-2542.200) (-2546.901) [-2558.770] (-2547.871) * (-2544.500) (-2545.548) [-2542.237] (-2561.553) -- 0:02:12
       8000 -- (-2540.720) [-2536.727] (-2559.135) (-2548.419) * [-2537.926] (-2540.080) (-2548.973) (-2559.625) -- 0:02:04
       8500 -- [-2544.814] (-2542.386) (-2555.471) (-2539.432) * [-2541.587] (-2539.665) (-2548.345) (-2556.741) -- 0:01:56
       9000 -- [-2543.939] (-2542.952) (-2551.281) (-2542.070) * [-2541.107] (-2543.330) (-2545.346) (-2559.695) -- 0:01:50
       9500 -- (-2545.184) [-2537.256] (-2546.483) (-2539.603) * [-2543.608] (-2552.058) (-2548.178) (-2558.758) -- 0:01:44
      10000 -- (-2541.731) (-2540.149) (-2545.189) [-2541.570] * [-2541.394] (-2544.264) (-2540.528) (-2554.546) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-2542.743) (-2538.859) (-2535.971) [-2541.010] * (-2539.489) [-2540.541] (-2546.340) (-2555.254) -- 0:01:34
      11000 -- (-2546.912) [-2541.215] (-2541.894) (-2545.197) * [-2541.776] (-2540.971) (-2542.742) (-2548.394) -- 0:01:29
      11500 -- (-2548.299) [-2543.782] (-2540.827) (-2538.664) * (-2539.978) (-2541.605) (-2540.214) [-2542.703] -- 0:01:25
      12000 -- (-2549.664) (-2541.719) [-2537.634] (-2537.306) * (-2541.267) [-2539.504] (-2543.375) (-2542.828) -- 0:01:22
      12500 -- (-2547.105) (-2544.276) (-2538.001) [-2538.671] * (-2541.153) [-2540.662] (-2541.710) (-2549.149) -- 0:01:19
      13000 -- (-2543.795) [-2539.120] (-2540.111) (-2541.323) * (-2545.179) [-2541.059] (-2549.437) (-2550.669) -- 0:02:31
      13500 -- (-2545.050) (-2542.628) [-2541.230] (-2543.384) * [-2544.938] (-2540.564) (-2549.473) (-2546.675) -- 0:02:26
      14000 -- (-2544.517) (-2539.354) (-2540.337) [-2541.983] * (-2542.578) [-2539.761] (-2553.754) (-2540.583) -- 0:02:20
      14500 -- (-2550.607) [-2544.599] (-2540.999) (-2542.530) * (-2547.543) (-2547.595) (-2555.177) [-2543.488] -- 0:02:15
      15000 -- (-2542.562) (-2540.979) (-2543.063) [-2541.842] * (-2550.412) (-2540.982) (-2549.323) [-2543.384] -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-2556.796) [-2538.207] (-2541.932) (-2544.737) * [-2540.933] (-2540.928) (-2551.929) (-2545.873) -- 0:02:07
      16000 -- (-2547.590) [-2537.899] (-2544.875) (-2545.520) * (-2541.668) (-2543.397) (-2547.061) [-2539.404] -- 0:02:03
      16500 -- (-2541.272) [-2538.984] (-2538.979) (-2537.556) * (-2541.805) (-2546.151) [-2543.427] (-2542.209) -- 0:01:59
      17000 -- [-2546.344] (-2544.268) (-2541.841) (-2544.467) * (-2544.347) (-2541.513) (-2546.758) [-2540.458] -- 0:01:55
      17500 -- (-2540.266) [-2538.190] (-2547.387) (-2543.485) * (-2544.763) (-2540.350) [-2547.836] (-2543.519) -- 0:01:52
      18000 -- (-2542.777) [-2543.617] (-2543.010) (-2543.015) * (-2544.739) [-2543.957] (-2552.002) (-2545.957) -- 0:01:49
      18500 -- [-2541.868] (-2547.374) (-2542.253) (-2538.439) * (-2544.808) [-2542.586] (-2551.254) (-2540.568) -- 0:01:46
      19000 -- (-2548.434) [-2541.366] (-2551.408) (-2542.890) * [-2545.569] (-2539.586) (-2544.253) (-2538.751) -- 0:02:34
      19500 -- (-2540.117) (-2545.788) (-2546.562) [-2540.389] * (-2540.785) (-2543.315) (-2544.096) [-2542.237] -- 0:02:30
      20000 -- (-2544.423) [-2541.347] (-2542.767) (-2549.281) * (-2547.148) [-2536.840] (-2552.025) (-2543.766) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-2538.809) (-2543.476) [-2542.720] (-2545.260) * (-2537.657) (-2541.038) [-2539.750] (-2552.520) -- 0:02:23
      21000 -- [-2537.999] (-2542.773) (-2560.203) (-2550.533) * [-2538.505] (-2540.984) (-2544.114) (-2545.222) -- 0:02:19
      21500 -- (-2547.957) [-2541.535] (-2544.497) (-2543.879) * (-2539.121) (-2544.044) [-2540.017] (-2545.448) -- 0:02:16
      22000 -- (-2546.115) (-2542.573) [-2542.228] (-2542.387) * (-2541.354) [-2541.041] (-2544.962) (-2548.347) -- 0:02:13
      22500 -- [-2544.982] (-2538.451) (-2541.407) (-2543.014) * [-2538.285] (-2544.280) (-2544.413) (-2541.948) -- 0:02:10
      23000 -- (-2547.616) (-2535.636) [-2539.421] (-2540.018) * (-2542.747) (-2538.191) (-2545.535) [-2540.575] -- 0:02:07
      23500 -- [-2543.091] (-2538.765) (-2539.854) (-2540.471) * (-2542.829) (-2548.285) [-2544.792] (-2541.137) -- 0:02:04
      24000 -- [-2541.798] (-2540.947) (-2543.777) (-2548.218) * (-2542.819) (-2550.610) (-2539.825) [-2540.091] -- 0:02:02
      24500 -- [-2540.235] (-2543.577) (-2537.713) (-2545.012) * (-2543.270) (-2539.746) (-2538.909) [-2540.717] -- 0:01:59
      25000 -- (-2543.253) [-2540.798] (-2544.725) (-2539.275) * [-2543.894] (-2538.871) (-2541.681) (-2538.057) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-2546.264] (-2550.926) (-2540.406) (-2543.466) * (-2543.411) [-2544.200] (-2544.119) (-2542.313) -- 0:02:32
      26000 -- (-2543.393) (-2545.184) [-2542.512] (-2553.497) * (-2544.010) (-2539.520) [-2545.971] (-2539.575) -- 0:02:29
      26500 -- (-2546.313) [-2541.936] (-2539.278) (-2539.618) * [-2539.348] (-2544.339) (-2542.654) (-2540.236) -- 0:02:26
      27000 -- (-2545.649) [-2540.162] (-2544.928) (-2544.321) * (-2542.306) [-2540.523] (-2545.821) (-2541.930) -- 0:02:24
      27500 -- (-2551.113) (-2543.364) [-2543.723] (-2548.390) * (-2542.507) (-2541.744) [-2541.874] (-2537.271) -- 0:02:21
      28000 -- (-2544.814) (-2546.623) [-2547.540] (-2548.136) * (-2541.981) (-2545.131) (-2542.034) [-2539.317] -- 0:02:18
      28500 -- (-2546.184) (-2548.951) [-2541.901] (-2542.359) * (-2545.911) [-2542.446] (-2550.236) (-2538.143) -- 0:02:16
      29000 -- (-2545.803) [-2539.822] (-2545.497) (-2546.296) * (-2549.113) (-2538.423) (-2544.015) [-2540.405] -- 0:02:13
      29500 -- (-2548.255) [-2539.298] (-2544.871) (-2550.548) * [-2541.169] (-2541.039) (-2545.949) (-2542.761) -- 0:02:11
      30000 -- (-2551.856) (-2542.986) [-2548.236] (-2538.732) * (-2539.076) (-2537.125) [-2539.769] (-2549.491) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-2548.681) (-2537.682) [-2542.508] (-2545.006) * (-2539.603) (-2543.721) [-2541.324] (-2545.187) -- 0:02:07
      31000 -- (-2549.702) (-2545.087) [-2543.844] (-2542.038) * (-2540.039) [-2541.722] (-2547.240) (-2540.873) -- 0:02:05
      31500 -- (-2543.119) [-2542.725] (-2543.589) (-2540.823) * [-2543.486] (-2540.615) (-2539.466) (-2543.147) -- 0:02:02
      32000 -- [-2545.269] (-2544.940) (-2541.950) (-2552.861) * (-2540.321) (-2546.189) (-2543.828) [-2540.627] -- 0:02:01
      32500 -- [-2542.245] (-2540.598) (-2543.464) (-2546.282) * (-2540.624) (-2544.426) [-2543.461] (-2542.393) -- 0:02:28
      33000 -- (-2546.143) (-2540.233) [-2544.272] (-2546.540) * (-2545.510) (-2542.109) (-2540.196) [-2538.410] -- 0:02:26
      33500 -- (-2546.708) (-2540.108) [-2542.044] (-2543.742) * (-2539.499) [-2537.072] (-2541.315) (-2544.278) -- 0:02:24
      34000 -- (-2546.698) (-2544.275) [-2540.025] (-2554.992) * [-2539.521] (-2541.374) (-2540.968) (-2545.127) -- 0:02:22
      34500 -- (-2545.155) (-2540.266) (-2544.131) [-2543.376] * (-2548.411) (-2543.974) (-2541.233) [-2542.218] -- 0:02:19
      35000 -- [-2542.228] (-2545.277) (-2547.405) (-2548.960) * (-2548.195) [-2545.058] (-2547.988) (-2545.498) -- 0:02:17

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-2543.710) [-2539.856] (-2542.676) (-2539.098) * (-2544.692) (-2540.723) [-2538.132] (-2549.949) -- 0:02:15
      36000 -- (-2550.700) (-2544.180) (-2537.821) [-2543.452] * (-2543.508) (-2542.814) (-2540.855) [-2543.777] -- 0:02:13
      36500 -- (-2546.220) (-2541.715) (-2542.485) [-2541.211] * (-2541.554) (-2544.596) [-2537.494] (-2550.595) -- 0:02:11
      37000 -- (-2541.422) (-2550.297) [-2541.171] (-2541.596) * (-2539.890) [-2543.887] (-2542.852) (-2548.088) -- 0:02:10
      37500 -- (-2542.818) [-2548.767] (-2546.940) (-2541.259) * [-2543.833] (-2539.489) (-2544.554) (-2544.601) -- 0:02:08
      38000 -- (-2539.860) (-2545.284) [-2542.360] (-2542.576) * (-2539.995) (-2547.925) (-2548.737) [-2541.299] -- 0:02:06
      38500 -- (-2543.132) [-2541.872] (-2541.455) (-2550.643) * (-2543.466) (-2544.493) [-2541.859] (-2541.891) -- 0:02:04
      39000 -- (-2543.210) [-2537.914] (-2543.422) (-2551.163) * [-2539.534] (-2543.251) (-2541.441) (-2543.648) -- 0:02:03
      39500 -- [-2543.164] (-2541.637) (-2543.870) (-2550.198) * [-2539.133] (-2546.160) (-2538.498) (-2543.770) -- 0:02:25
      40000 -- (-2553.476) (-2540.267) (-2545.189) [-2544.209] * (-2541.388) (-2545.496) (-2546.933) [-2548.452] -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-2545.189) (-2541.250) [-2544.370] (-2543.589) * (-2542.605) (-2542.858) (-2548.148) [-2542.248] -- 0:02:22
      41000 -- [-2539.946] (-2539.825) (-2546.866) (-2543.903) * [-2542.482] (-2543.703) (-2542.597) (-2539.693) -- 0:02:20
      41500 -- (-2543.991) [-2541.611] (-2539.319) (-2542.631) * (-2545.884) (-2546.249) [-2540.414] (-2541.850) -- 0:02:18
      42000 -- (-2540.449) (-2544.570) [-2540.023] (-2546.632) * (-2540.237) (-2540.866) (-2540.039) [-2539.928] -- 0:02:16
      42500 -- [-2544.033] (-2537.708) (-2539.014) (-2543.381) * (-2542.003) [-2540.860] (-2546.279) (-2543.204) -- 0:02:15
      43000 -- (-2556.537) [-2539.002] (-2544.925) (-2544.511) * [-2540.343] (-2544.487) (-2545.759) (-2538.368) -- 0:02:13
      43500 -- (-2547.503) (-2545.924) [-2544.650] (-2545.756) * (-2542.229) (-2540.171) [-2540.025] (-2538.300) -- 0:02:11
      44000 -- (-2546.241) (-2548.511) (-2543.230) [-2540.761] * (-2546.804) (-2547.462) (-2539.287) [-2537.268] -- 0:02:10
      44500 -- (-2549.896) (-2544.949) (-2548.625) [-2537.856] * (-2541.613) (-2545.981) [-2542.819] (-2541.222) -- 0:02:08
      45000 -- (-2549.017) (-2542.588) (-2542.031) [-2542.401] * (-2542.003) (-2542.769) (-2546.821) [-2547.563] -- 0:02:07

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-2544.589) (-2543.820) (-2539.924) [-2537.985] * (-2544.436) (-2544.687) [-2543.197] (-2547.524) -- 0:02:05
      46000 -- (-2540.538) (-2544.253) (-2541.975) [-2541.625] * (-2542.632) [-2545.924] (-2542.662) (-2547.305) -- 0:02:04
      46500 -- [-2539.061] (-2547.043) (-2542.993) (-2541.810) * (-2536.907) (-2542.561) [-2543.131] (-2538.751) -- 0:02:23
      47000 -- (-2541.348) (-2545.980) (-2546.736) [-2540.158] * [-2544.150] (-2540.282) (-2549.302) (-2543.241) -- 0:02:21
      47500 -- (-2544.698) (-2539.822) (-2544.767) [-2543.956] * (-2540.482) (-2548.036) (-2553.992) [-2538.357] -- 0:02:20
      48000 -- (-2541.086) (-2541.002) [-2539.662] (-2543.518) * (-2542.791) (-2546.536) (-2548.159) [-2543.462] -- 0:02:18
      48500 -- (-2540.866) (-2543.814) (-2545.351) [-2541.974] * (-2547.729) (-2540.927) (-2551.594) [-2544.112] -- 0:02:17
      49000 -- [-2544.805] (-2546.955) (-2543.047) (-2541.503) * (-2547.705) (-2543.904) [-2540.995] (-2540.950) -- 0:02:15
      49500 -- (-2545.427) [-2545.656] (-2542.820) (-2543.775) * (-2546.398) (-2545.028) [-2537.855] (-2541.694) -- 0:02:14
      50000 -- (-2551.096) [-2546.325] (-2544.037) (-2551.087) * (-2546.460) (-2545.571) [-2539.404] (-2541.672) -- 0:02:13

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-2539.889) (-2541.859) (-2545.108) [-2539.085] * (-2545.718) [-2537.415] (-2543.551) (-2540.820) -- 0:02:11
      51000 -- (-2547.543) (-2548.445) [-2543.160] (-2539.901) * (-2542.554) (-2541.023) (-2537.588) [-2538.808] -- 0:02:10
      51500 -- [-2543.670] (-2544.329) (-2540.256) (-2546.022) * (-2540.074) [-2542.578] (-2543.468) (-2545.728) -- 0:02:08
      52000 -- [-2543.787] (-2545.959) (-2542.227) (-2545.389) * (-2538.813) (-2554.677) [-2540.995] (-2540.940) -- 0:02:07
      52500 -- (-2548.535) (-2541.562) [-2540.480] (-2549.555) * [-2539.355] (-2551.065) (-2540.912) (-2543.836) -- 0:02:06
      53000 -- (-2543.698) (-2549.069) (-2539.083) [-2545.875] * (-2544.402) (-2549.821) (-2545.605) [-2543.986] -- 0:02:22
      53500 -- (-2548.238) (-2548.568) (-2548.608) [-2548.473] * (-2542.076) (-2546.516) [-2544.396] (-2540.625) -- 0:02:21
      54000 -- (-2546.660) [-2542.800] (-2540.607) (-2544.696) * (-2547.386) (-2537.786) (-2548.474) [-2538.368] -- 0:02:20
      54500 -- (-2546.674) (-2540.889) [-2545.833] (-2542.349) * (-2544.927) (-2539.233) [-2545.764] (-2544.204) -- 0:02:18
      55000 -- (-2547.780) [-2541.237] (-2548.143) (-2540.350) * (-2552.280) [-2546.119] (-2546.378) (-2544.638) -- 0:02:17

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2543.993) (-2545.126) (-2546.506) [-2540.624] * (-2544.672) (-2546.338) (-2541.432) [-2543.352] -- 0:02:16
      56000 -- (-2545.406) [-2542.698] (-2545.408) (-2544.092) * (-2543.623) [-2540.658] (-2550.953) (-2548.937) -- 0:02:14
      56500 -- (-2550.224) (-2544.857) [-2546.730] (-2542.743) * (-2544.981) [-2544.193] (-2546.877) (-2544.018) -- 0:02:13
      57000 -- (-2546.700) (-2552.162) [-2544.213] (-2544.050) * (-2555.809) (-2551.633) (-2540.633) [-2548.986] -- 0:02:12
      57500 -- (-2544.534) (-2545.501) (-2553.272) [-2538.789] * (-2545.775) [-2546.813] (-2542.646) (-2540.677) -- 0:02:11
      58000 -- (-2547.567) (-2545.864) (-2546.052) [-2544.193] * (-2547.009) (-2545.922) (-2540.510) [-2540.852] -- 0:02:09
      58500 -- (-2542.135) (-2549.453) [-2546.154] (-2543.526) * (-2549.396) [-2540.920] (-2549.531) (-2537.196) -- 0:02:08
      59000 -- [-2541.308] (-2550.599) (-2544.089) (-2552.613) * (-2545.276) [-2547.511] (-2544.514) (-2538.371) -- 0:02:07
      59500 -- (-2540.881) [-2545.419] (-2541.005) (-2552.269) * (-2538.644) (-2539.389) [-2546.927] (-2541.341) -- 0:02:06
      60000 -- (-2541.833) [-2547.843] (-2545.931) (-2545.251) * (-2544.913) [-2542.952] (-2545.351) (-2546.486) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-2544.492) (-2542.471) (-2539.130) [-2540.713] * (-2542.070) (-2541.080) (-2540.118) [-2539.896] -- 0:02:19
      61000 -- (-2544.907) (-2543.429) [-2537.539] (-2543.987) * (-2539.515) [-2538.288] (-2545.189) (-2543.662) -- 0:02:18
      61500 -- [-2542.959] (-2542.258) (-2539.708) (-2544.300) * [-2541.162] (-2540.503) (-2538.170) (-2540.790) -- 0:02:17
      62000 -- (-2539.819) [-2548.603] (-2539.703) (-2541.022) * (-2547.342) (-2539.018) (-2545.674) [-2545.475] -- 0:02:16
      62500 -- (-2542.087) (-2544.872) [-2544.475] (-2539.244) * (-2540.487) [-2540.859] (-2539.672) (-2549.615) -- 0:02:15
      63000 -- (-2545.025) (-2550.537) (-2545.321) [-2539.857] * (-2541.424) (-2545.113) [-2543.374] (-2554.409) -- 0:02:13
      63500 -- (-2563.863) (-2541.444) (-2549.204) [-2541.499] * [-2540.251] (-2542.111) (-2544.421) (-2554.213) -- 0:02:12
      64000 -- (-2549.404) (-2542.454) [-2542.914] (-2542.900) * (-2550.200) (-2542.983) (-2544.927) [-2544.320] -- 0:02:11
      64500 -- (-2546.885) (-2540.635) (-2544.922) [-2537.009] * [-2545.445] (-2551.491) (-2543.749) (-2546.613) -- 0:02:10
      65000 -- (-2543.467) (-2547.838) [-2544.583] (-2541.434) * (-2542.467) [-2547.089] (-2538.942) (-2546.675) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-2537.614) (-2544.141) [-2542.516] (-2542.201) * [-2542.714] (-2543.456) (-2543.458) (-2549.389) -- 0:02:08
      66000 -- [-2539.797] (-2539.327) (-2551.788) (-2545.021) * (-2542.292) [-2542.032] (-2543.329) (-2551.933) -- 0:02:07
      66500 -- (-2543.526) (-2542.909) [-2541.836] (-2546.549) * (-2546.257) [-2548.380] (-2540.625) (-2545.027) -- 0:02:20
      67000 -- (-2540.103) (-2546.581) (-2548.422) [-2544.175] * (-2540.035) (-2547.256) [-2541.390] (-2548.411) -- 0:02:19
      67500 -- (-2539.083) [-2540.856] (-2545.592) (-2541.683) * (-2548.885) (-2545.687) [-2539.025] (-2554.843) -- 0:02:18
      68000 -- (-2546.185) (-2537.552) (-2541.976) [-2536.427] * (-2540.925) [-2541.617] (-2544.973) (-2552.793) -- 0:02:17
      68500 -- (-2546.940) [-2540.301] (-2546.336) (-2538.625) * (-2542.083) (-2542.528) [-2541.061] (-2545.208) -- 0:02:15
      69000 -- [-2539.674] (-2552.196) (-2542.291) (-2540.261) * (-2544.571) [-2547.001] (-2542.376) (-2544.739) -- 0:02:14
      69500 -- (-2539.161) (-2545.338) [-2536.782] (-2544.807) * [-2542.581] (-2543.505) (-2547.674) (-2540.160) -- 0:02:13
      70000 -- [-2543.824] (-2543.080) (-2545.141) (-2546.200) * [-2549.874] (-2544.960) (-2548.203) (-2542.513) -- 0:02:12

      Average standard deviation of split frequencies: 0.006671

      70500 -- (-2542.105) (-2543.776) (-2546.102) [-2539.312] * (-2538.259) (-2540.282) (-2545.002) [-2539.817] -- 0:02:11
      71000 -- (-2547.001) (-2540.693) [-2539.916] (-2539.805) * (-2538.590) (-2545.872) (-2544.169) [-2538.674] -- 0:02:10
      71500 -- (-2539.575) [-2542.393] (-2541.901) (-2548.158) * [-2542.531] (-2547.681) (-2541.075) (-2543.563) -- 0:02:09
      72000 -- (-2539.797) (-2539.735) [-2544.139] (-2540.949) * (-2541.445) (-2545.787) [-2541.023] (-2541.849) -- 0:02:08
      72500 -- [-2545.089] (-2542.740) (-2543.994) (-2548.056) * [-2545.810] (-2542.044) (-2538.868) (-2542.862) -- 0:02:07
      73000 -- [-2539.702] (-2550.632) (-2542.961) (-2546.092) * (-2542.542) (-2543.232) [-2542.016] (-2543.228) -- 0:02:06
      73500 -- (-2549.029) (-2539.770) (-2537.823) [-2543.280] * (-2547.578) (-2549.455) [-2540.925] (-2545.688) -- 0:02:18
      74000 -- (-2543.274) [-2546.273] (-2547.776) (-2543.650) * [-2537.787] (-2539.404) (-2543.717) (-2543.680) -- 0:02:17
      74500 -- (-2540.221) [-2538.226] (-2541.289) (-2543.477) * (-2538.762) (-2544.755) [-2538.350] (-2537.964) -- 0:02:16
      75000 -- (-2540.056) (-2542.638) [-2541.248] (-2540.203) * (-2543.581) (-2542.294) (-2539.151) [-2544.542] -- 0:02:15

      Average standard deviation of split frequencies: 0.006203

      75500 -- (-2540.231) (-2539.333) (-2541.284) [-2542.970] * (-2544.555) (-2536.992) [-2540.678] (-2546.660) -- 0:02:14
      76000 -- (-2538.175) (-2539.671) (-2541.754) [-2540.381] * (-2549.935) [-2543.500] (-2541.189) (-2541.623) -- 0:02:13
      76500 -- (-2542.489) (-2542.503) [-2541.171] (-2538.938) * [-2542.849] (-2545.833) (-2539.822) (-2537.580) -- 0:02:12
      77000 -- (-2549.847) (-2538.274) [-2543.448] (-2540.781) * (-2543.135) (-2549.270) (-2546.107) [-2541.224] -- 0:02:11
      77500 -- (-2548.043) (-2539.272) (-2541.672) [-2544.326] * (-2548.611) (-2539.151) (-2542.458) [-2545.639] -- 0:02:10
      78000 -- (-2548.227) [-2538.536] (-2543.247) (-2544.058) * (-2540.665) [-2542.275] (-2540.861) (-2540.812) -- 0:02:10
      78500 -- (-2543.105) (-2539.928) (-2548.296) [-2544.882] * (-2547.003) [-2542.902] (-2538.644) (-2541.684) -- 0:02:09
      79000 -- [-2547.256] (-2538.327) (-2549.685) (-2548.982) * (-2542.256) (-2539.683) [-2540.779] (-2540.216) -- 0:02:08
      79500 -- (-2545.562) [-2539.632] (-2552.083) (-2552.556) * (-2544.117) (-2543.483) (-2544.305) [-2543.291] -- 0:02:07
      80000 -- (-2548.216) (-2545.165) [-2548.985] (-2538.989) * (-2540.643) (-2543.911) [-2542.551] (-2543.493) -- 0:02:18

      Average standard deviation of split frequencies: 0.005844

      80500 -- [-2545.298] (-2540.317) (-2551.719) (-2539.984) * [-2545.432] (-2540.745) (-2547.425) (-2540.923) -- 0:02:17
      81000 -- (-2547.597) (-2542.798) [-2539.860] (-2543.796) * (-2543.281) (-2543.173) (-2542.447) [-2539.583] -- 0:02:16
      81500 -- [-2543.112] (-2553.167) (-2539.245) (-2542.076) * (-2545.172) (-2549.077) (-2539.007) [-2542.156] -- 0:02:15
      82000 -- (-2540.840) (-2546.338) [-2542.465] (-2541.606) * [-2545.015] (-2544.753) (-2548.146) (-2543.444) -- 0:02:14
      82500 -- (-2539.331) (-2549.716) [-2538.449] (-2540.168) * [-2542.490] (-2544.690) (-2550.702) (-2541.569) -- 0:02:13
      83000 -- (-2541.718) (-2550.026) (-2544.978) [-2539.774] * [-2537.109] (-2546.040) (-2545.398) (-2541.872) -- 0:02:12
      83500 -- [-2545.119] (-2541.154) (-2544.508) (-2539.341) * (-2543.932) [-2543.092] (-2546.404) (-2541.169) -- 0:02:11
      84000 -- (-2547.871) (-2544.708) (-2538.585) [-2540.996] * (-2538.725) (-2547.940) [-2539.332] (-2544.597) -- 0:02:10
      84500 -- (-2555.266) [-2542.043] (-2544.133) (-2540.123) * (-2541.144) (-2552.322) (-2545.230) [-2545.274] -- 0:02:10
      85000 -- (-2538.188) (-2540.642) [-2543.343] (-2539.803) * [-2539.723] (-2560.563) (-2551.977) (-2543.932) -- 0:02:09

      Average standard deviation of split frequencies: 0.005481

      85500 -- (-2546.173) (-2540.798) [-2544.544] (-2542.009) * [-2542.012] (-2547.272) (-2549.245) (-2546.181) -- 0:02:08
      86000 -- (-2545.984) (-2540.396) [-2541.891] (-2538.657) * (-2537.554) (-2548.061) [-2541.558] (-2543.072) -- 0:02:07
      86500 -- (-2545.106) (-2544.545) (-2546.076) [-2539.073] * (-2545.084) [-2545.170] (-2542.392) (-2544.492) -- 0:02:06
      87000 -- [-2540.918] (-2542.194) (-2544.156) (-2542.751) * [-2540.817] (-2547.091) (-2547.423) (-2553.978) -- 0:02:16
      87500 -- (-2539.249) (-2550.172) (-2547.300) [-2541.738] * [-2539.064] (-2548.470) (-2543.183) (-2554.528) -- 0:02:15
      88000 -- [-2539.883] (-2538.336) (-2550.532) (-2539.035) * [-2541.858] (-2549.043) (-2548.456) (-2542.919) -- 0:02:14
      88500 -- (-2547.290) (-2543.355) [-2545.939] (-2541.195) * (-2549.556) [-2551.203] (-2545.550) (-2550.328) -- 0:02:13
      89000 -- (-2547.007) (-2543.754) (-2548.448) [-2543.314] * [-2548.944] (-2547.684) (-2548.793) (-2544.380) -- 0:02:13
      89500 -- (-2544.018) [-2542.768] (-2541.372) (-2540.376) * [-2540.710] (-2545.123) (-2542.817) (-2542.645) -- 0:02:12
      90000 -- (-2543.123) (-2542.165) (-2542.787) [-2541.952] * (-2539.930) (-2543.567) (-2539.635) [-2545.637] -- 0:02:11

      Average standard deviation of split frequencies: 0.005199

      90500 -- [-2542.285] (-2547.457) (-2548.379) (-2536.899) * (-2543.306) [-2541.534] (-2545.144) (-2540.252) -- 0:02:10
      91000 -- (-2537.015) (-2543.090) (-2544.009) [-2544.703] * (-2546.701) [-2540.390] (-2546.344) (-2540.567) -- 0:02:09
      91500 -- (-2543.492) (-2548.345) [-2540.450] (-2544.779) * [-2542.938] (-2545.461) (-2540.895) (-2547.617) -- 0:02:09
      92000 -- (-2544.384) (-2543.433) (-2542.665) [-2538.749] * [-2541.394] (-2551.242) (-2548.472) (-2542.019) -- 0:02:08
      92500 -- (-2540.032) [-2538.585] (-2540.117) (-2547.461) * [-2543.121] (-2543.794) (-2549.389) (-2543.791) -- 0:02:07
      93000 -- (-2544.666) (-2542.654) [-2541.986] (-2546.694) * [-2543.404] (-2544.673) (-2542.471) (-2544.975) -- 0:02:06
      93500 -- [-2552.559] (-2539.036) (-2542.874) (-2548.250) * (-2544.030) (-2541.629) [-2544.741] (-2551.745) -- 0:02:15
      94000 -- (-2547.818) (-2538.438) (-2543.803) [-2544.233] * (-2542.277) [-2544.461] (-2538.461) (-2543.761) -- 0:02:14
      94500 -- (-2548.690) (-2541.903) (-2543.354) [-2549.589] * [-2542.243] (-2544.630) (-2540.912) (-2544.641) -- 0:02:14
      95000 -- (-2546.390) (-2544.705) [-2541.790] (-2544.245) * (-2543.778) (-2547.986) [-2540.048] (-2540.632) -- 0:02:13

      Average standard deviation of split frequencies: 0.004910

      95500 -- (-2541.136) (-2551.609) [-2541.940] (-2547.868) * (-2541.514) (-2544.469) [-2544.096] (-2539.722) -- 0:02:12
      96000 -- (-2543.140) (-2546.126) [-2538.274] (-2545.939) * [-2539.567] (-2555.950) (-2544.966) (-2546.105) -- 0:02:11
      96500 -- (-2549.001) (-2544.920) [-2539.983] (-2547.070) * [-2537.615] (-2545.081) (-2542.772) (-2543.010) -- 0:02:11
      97000 -- (-2549.758) [-2545.160] (-2540.915) (-2541.338) * (-2545.507) (-2549.820) (-2544.045) [-2542.680] -- 0:02:10
      97500 -- (-2548.057) [-2545.837] (-2543.636) (-2544.638) * (-2541.084) (-2543.463) (-2540.354) [-2540.963] -- 0:02:09
      98000 -- [-2539.408] (-2549.606) (-2541.120) (-2543.029) * [-2539.445] (-2545.356) (-2549.654) (-2545.431) -- 0:02:08
      98500 -- (-2547.622) (-2546.915) [-2538.683] (-2540.314) * (-2543.038) [-2539.995] (-2544.687) (-2543.209) -- 0:02:08
      99000 -- (-2543.677) (-2547.895) (-2543.325) [-2541.787] * (-2544.399) (-2541.440) [-2545.262] (-2546.734) -- 0:02:07
      99500 -- (-2542.968) (-2547.035) [-2540.588] (-2543.778) * (-2542.623) [-2540.766] (-2544.831) (-2542.485) -- 0:02:06
      100000 -- (-2541.875) (-2547.709) [-2541.951] (-2549.476) * (-2539.908) (-2547.667) [-2542.521] (-2541.331) -- 0:02:05

      Average standard deviation of split frequencies: 0.004683

      100500 -- (-2541.197) [-2539.890] (-2544.373) (-2546.183) * (-2544.778) [-2537.218] (-2548.855) (-2543.100) -- 0:02:14
      101000 -- [-2544.361] (-2551.585) (-2543.523) (-2547.602) * (-2538.736) (-2536.774) [-2550.299] (-2539.699) -- 0:02:13
      101500 -- (-2543.952) (-2550.606) [-2542.844] (-2547.388) * [-2538.910] (-2542.345) (-2544.154) (-2542.472) -- 0:02:12
      102000 -- (-2544.888) (-2544.280) (-2544.745) [-2547.702] * [-2536.110] (-2544.177) (-2549.315) (-2548.914) -- 0:02:12
      102500 -- [-2540.120] (-2546.350) (-2553.520) (-2549.398) * (-2546.195) (-2541.585) (-2546.966) [-2543.183] -- 0:02:11
      103000 -- [-2546.185] (-2548.843) (-2545.419) (-2546.691) * (-2542.669) [-2542.328] (-2547.471) (-2546.916) -- 0:02:10
      103500 -- (-2539.227) (-2538.888) [-2543.901] (-2551.902) * [-2544.269] (-2539.374) (-2543.851) (-2542.006) -- 0:02:09
      104000 -- (-2540.233) (-2544.027) (-2541.535) [-2543.672] * (-2542.508) (-2544.113) [-2539.565] (-2554.267) -- 0:02:09
      104500 -- [-2538.886] (-2540.053) (-2547.826) (-2544.798) * (-2541.370) (-2544.461) [-2539.487] (-2549.074) -- 0:02:08
      105000 -- [-2540.526] (-2544.236) (-2540.209) (-2550.359) * [-2541.516] (-2537.023) (-2544.545) (-2543.710) -- 0:02:07

      Average standard deviation of split frequencies: 0.004447

      105500 -- (-2537.915) (-2546.749) [-2547.113] (-2546.736) * (-2544.238) [-2539.138] (-2538.621) (-2545.867) -- 0:02:07
      106000 -- (-2542.674) [-2541.699] (-2550.294) (-2550.653) * [-2541.872] (-2545.168) (-2544.086) (-2543.121) -- 0:02:06
      106500 -- (-2542.697) [-2548.022] (-2549.496) (-2552.615) * (-2541.336) [-2539.691] (-2540.575) (-2547.880) -- 0:02:05
      107000 -- (-2539.167) [-2543.833] (-2544.778) (-2542.734) * [-2545.170] (-2538.516) (-2545.184) (-2548.380) -- 0:02:13
      107500 -- (-2544.825) (-2544.970) [-2546.920] (-2545.745) * (-2543.570) (-2539.716) [-2548.094] (-2547.285) -- 0:02:12
      108000 -- (-2542.741) [-2545.163] (-2545.427) (-2555.318) * (-2544.581) [-2543.519] (-2551.376) (-2547.511) -- 0:02:12
      108500 -- (-2540.598) (-2546.072) [-2538.493] (-2547.746) * (-2540.752) (-2546.003) (-2538.941) [-2549.436] -- 0:02:11
      109000 -- [-2539.729] (-2550.886) (-2541.360) (-2542.469) * (-2542.452) [-2543.903] (-2540.776) (-2551.998) -- 0:02:10
      109500 -- (-2543.116) (-2547.383) (-2544.052) [-2543.916] * (-2550.952) (-2550.099) [-2543.275] (-2552.618) -- 0:02:10
      110000 -- (-2548.277) (-2540.490) [-2541.838] (-2544.010) * (-2550.428) (-2545.749) [-2540.735] (-2555.208) -- 0:02:09

      Average standard deviation of split frequencies: 0.004260

      110500 -- [-2539.197] (-2543.908) (-2541.309) (-2545.022) * (-2555.344) [-2541.322] (-2541.480) (-2553.327) -- 0:02:08
      111000 -- (-2542.251) (-2544.220) [-2542.694] (-2553.625) * (-2542.831) (-2539.747) [-2542.471] (-2546.483) -- 0:02:08
      111500 -- (-2543.102) (-2541.510) (-2540.578) [-2542.135] * [-2544.206] (-2540.613) (-2541.381) (-2548.353) -- 0:02:07
      112000 -- (-2539.719) [-2540.007] (-2544.177) (-2548.577) * [-2536.687] (-2540.513) (-2547.441) (-2551.989) -- 0:02:06
      112500 -- [-2542.710] (-2544.570) (-2539.332) (-2547.308) * (-2543.376) (-2535.571) [-2542.703] (-2548.786) -- 0:02:06
      113000 -- (-2541.652) [-2542.043] (-2541.718) (-2546.684) * (-2541.751) (-2543.831) [-2543.314] (-2547.252) -- 0:02:05
      113500 -- (-2541.745) (-2542.337) [-2546.541] (-2543.253) * (-2543.447) [-2542.175] (-2540.199) (-2544.242) -- 0:02:04
      114000 -- (-2536.603) (-2540.981) [-2540.943] (-2537.753) * [-2552.922] (-2544.290) (-2541.295) (-2543.155) -- 0:02:12
      114500 -- (-2541.587) (-2537.181) [-2540.603] (-2543.872) * (-2551.997) [-2543.461] (-2541.565) (-2544.586) -- 0:02:11
      115000 -- (-2538.977) (-2537.573) (-2540.039) [-2539.377] * (-2548.908) (-2538.922) (-2545.745) [-2544.031] -- 0:02:10

      Average standard deviation of split frequencies: 0.004064

      115500 -- [-2538.761] (-2541.518) (-2541.966) (-2544.243) * (-2547.663) [-2541.603] (-2543.628) (-2546.261) -- 0:02:10
      116000 -- [-2538.676] (-2542.371) (-2545.793) (-2547.497) * (-2541.592) (-2541.875) (-2552.110) [-2539.501] -- 0:02:09
      116500 -- (-2537.009) [-2544.467] (-2546.097) (-2546.094) * (-2544.705) [-2539.940] (-2554.102) (-2542.469) -- 0:02:08
      117000 -- (-2538.846) [-2541.748] (-2544.715) (-2550.324) * [-2545.998] (-2538.199) (-2542.290) (-2547.389) -- 0:02:08
      117500 -- (-2541.565) [-2535.950] (-2548.176) (-2551.513) * (-2540.761) (-2539.181) [-2540.005] (-2542.000) -- 0:02:07
      118000 -- (-2542.129) [-2540.150] (-2544.152) (-2544.800) * (-2544.345) (-2544.941) [-2540.563] (-2540.881) -- 0:02:07
      118500 -- (-2540.009) (-2539.082) [-2544.353] (-2549.242) * (-2542.045) (-2545.064) (-2540.174) [-2543.399] -- 0:02:06
      119000 -- [-2542.552] (-2538.541) (-2542.616) (-2543.802) * (-2541.485) [-2545.085] (-2540.502) (-2553.831) -- 0:02:05
      119500 -- (-2549.576) (-2542.644) (-2540.800) [-2539.901] * (-2546.170) [-2548.124] (-2538.801) (-2542.291) -- 0:02:05
      120000 -- (-2539.790) (-2541.790) (-2540.567) [-2543.463] * (-2543.030) (-2549.288) (-2549.056) [-2537.863] -- 0:02:04

      Average standard deviation of split frequencies: 0.003907

      120500 -- [-2544.585] (-2544.960) (-2542.503) (-2545.874) * (-2549.805) (-2547.480) [-2538.696] (-2539.868) -- 0:02:04
      121000 -- (-2542.902) (-2546.059) [-2539.455] (-2545.767) * (-2546.520) (-2541.351) (-2540.151) [-2542.090] -- 0:02:10
      121500 -- (-2542.570) (-2542.833) (-2540.099) [-2548.671] * (-2542.568) [-2545.364] (-2544.565) (-2543.294) -- 0:02:10
      122000 -- (-2540.115) [-2541.069] (-2539.432) (-2548.037) * [-2543.607] (-2542.522) (-2554.125) (-2541.895) -- 0:02:09
      122500 -- (-2543.487) (-2547.990) (-2543.287) [-2542.711] * (-2544.281) (-2548.274) (-2541.097) [-2538.885] -- 0:02:08
      123000 -- (-2541.707) (-2552.279) (-2544.639) [-2543.806] * (-2540.009) (-2547.386) [-2540.518] (-2539.191) -- 0:02:08
      123500 -- (-2541.085) (-2544.194) (-2538.253) [-2541.640] * (-2543.410) [-2543.575] (-2541.639) (-2547.850) -- 0:02:07
      124000 -- (-2544.927) [-2542.181] (-2540.605) (-2546.734) * (-2549.052) [-2543.586] (-2541.700) (-2544.922) -- 0:02:07
      124500 -- (-2537.576) (-2544.867) (-2540.476) [-2544.237] * (-2548.201) (-2539.806) [-2544.605] (-2545.908) -- 0:02:06
      125000 -- (-2542.211) (-2546.811) [-2541.460] (-2545.029) * (-2551.496) (-2542.193) [-2543.120] (-2541.932) -- 0:02:06

      Average standard deviation of split frequencies: 0.003741

      125500 -- [-2538.336] (-2548.959) (-2546.789) (-2549.855) * (-2544.495) (-2545.068) [-2544.812] (-2539.990) -- 0:02:05
      126000 -- [-2543.137] (-2552.851) (-2539.832) (-2537.847) * [-2542.048] (-2543.384) (-2540.796) (-2542.415) -- 0:02:04
      126500 -- [-2535.949] (-2540.547) (-2538.688) (-2545.985) * (-2537.947) (-2544.701) (-2540.018) [-2542.187] -- 0:02:04
      127000 -- (-2549.405) [-2539.298] (-2538.896) (-2539.994) * (-2540.908) (-2545.045) [-2539.014] (-2544.729) -- 0:02:03
      127500 -- [-2543.302] (-2540.845) (-2553.027) (-2542.258) * (-2539.178) (-2542.609) (-2544.147) [-2538.890] -- 0:02:03
      128000 -- (-2541.180) [-2539.862] (-2547.753) (-2545.833) * (-2545.921) (-2537.423) [-2540.553] (-2545.921) -- 0:02:09
      128500 -- (-2543.651) (-2541.454) [-2543.688] (-2540.954) * (-2538.686) (-2540.688) (-2539.248) [-2540.998] -- 0:02:08
      129000 -- [-2545.263] (-2545.402) (-2543.905) (-2544.574) * (-2538.634) [-2539.016] (-2541.036) (-2541.757) -- 0:02:08
      129500 -- [-2544.250] (-2544.984) (-2543.098) (-2542.296) * (-2542.481) [-2542.686] (-2544.420) (-2539.621) -- 0:02:07
      130000 -- (-2544.255) (-2537.273) [-2538.550] (-2553.007) * (-2547.045) (-2539.783) [-2539.410] (-2540.218) -- 0:02:07

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-2548.242) (-2541.480) (-2547.557) [-2543.443] * (-2542.153) (-2540.928) (-2538.866) [-2541.127] -- 0:02:06
      131000 -- (-2539.430) (-2545.430) [-2538.990] (-2541.230) * [-2542.792] (-2544.364) (-2546.805) (-2541.612) -- 0:02:06
      131500 -- (-2546.532) [-2536.984] (-2540.640) (-2553.691) * (-2540.025) (-2542.203) [-2539.712] (-2547.669) -- 0:02:05
      132000 -- (-2540.466) (-2540.100) [-2534.363] (-2555.437) * (-2544.952) [-2543.144] (-2541.109) (-2544.476) -- 0:02:04
      132500 -- (-2545.501) (-2544.832) (-2542.264) [-2549.647] * (-2546.776) (-2551.499) [-2544.302] (-2546.524) -- 0:02:04
      133000 -- (-2541.385) (-2548.040) [-2536.242] (-2546.489) * (-2540.299) (-2543.651) [-2540.977] (-2540.841) -- 0:02:03
      133500 -- (-2543.682) [-2541.758] (-2544.960) (-2539.806) * [-2542.340] (-2541.221) (-2552.359) (-2539.589) -- 0:02:03
      134000 -- (-2546.639) (-2540.756) (-2539.390) [-2539.553] * (-2542.389) (-2541.262) (-2547.000) [-2540.858] -- 0:02:02
      134500 -- (-2544.789) [-2539.217] (-2544.408) (-2542.505) * [-2540.769] (-2544.596) (-2544.279) (-2545.222) -- 0:02:08
      135000 -- (-2538.151) [-2537.771] (-2545.874) (-2543.986) * (-2546.274) (-2542.739) (-2540.676) [-2542.050] -- 0:02:08

      Average standard deviation of split frequencies: 0.003466

      135500 -- (-2543.127) (-2541.946) [-2541.822] (-2542.402) * (-2541.505) (-2540.273) [-2545.465] (-2545.579) -- 0:02:07
      136000 -- (-2536.058) (-2541.059) [-2540.037] (-2545.953) * [-2541.699] (-2545.449) (-2549.728) (-2550.977) -- 0:02:07
      136500 -- [-2542.085] (-2541.301) (-2545.115) (-2544.682) * (-2547.810) (-2546.750) (-2551.056) [-2540.892] -- 0:02:06
      137000 -- (-2541.446) [-2541.352] (-2543.458) (-2544.784) * (-2542.823) [-2541.644] (-2547.516) (-2543.264) -- 0:02:05
      137500 -- (-2543.013) [-2542.573] (-2542.644) (-2542.896) * [-2542.026] (-2545.204) (-2539.846) (-2544.035) -- 0:02:05
      138000 -- (-2542.494) (-2545.229) (-2549.049) [-2548.486] * (-2544.786) (-2547.230) [-2544.885] (-2543.633) -- 0:02:04
      138500 -- (-2551.353) (-2549.171) [-2539.509] (-2541.568) * [-2548.097] (-2540.160) (-2541.806) (-2541.272) -- 0:02:04
      139000 -- (-2540.750) (-2545.501) (-2541.978) [-2543.089] * (-2546.157) (-2541.287) [-2543.314] (-2541.914) -- 0:02:03
      139500 -- (-2539.729) (-2547.060) (-2547.307) [-2539.479] * (-2544.474) [-2540.177] (-2550.263) (-2544.953) -- 0:02:03
      140000 -- [-2539.058] (-2546.805) (-2545.181) (-2542.505) * [-2546.240] (-2547.302) (-2538.990) (-2553.545) -- 0:02:02

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-2540.991) (-2540.667) [-2538.470] (-2541.293) * (-2543.653) [-2544.565] (-2543.599) (-2540.692) -- 0:02:02
      141000 -- (-2547.427) (-2542.470) (-2539.733) [-2539.028] * [-2539.322] (-2537.788) (-2545.205) (-2544.028) -- 0:02:01
      141500 -- (-2541.891) [-2541.477] (-2539.156) (-2541.310) * (-2542.759) [-2539.504] (-2543.863) (-2546.561) -- 0:02:07
      142000 -- (-2539.762) (-2551.904) [-2540.669] (-2543.088) * [-2539.616] (-2538.042) (-2545.576) (-2548.693) -- 0:02:06
      142500 -- [-2542.151] (-2542.756) (-2541.926) (-2540.170) * (-2540.374) [-2541.505] (-2541.726) (-2549.518) -- 0:02:06
      143000 -- (-2541.557) (-2542.228) [-2542.543] (-2537.643) * (-2544.368) [-2542.988] (-2544.669) (-2549.854) -- 0:02:05
      143500 -- (-2543.194) [-2539.778] (-2538.629) (-2542.917) * (-2547.128) (-2543.307) (-2540.318) [-2547.054] -- 0:02:05
      144000 -- [-2541.745] (-2545.253) (-2543.526) (-2543.026) * (-2547.160) [-2540.659] (-2541.141) (-2543.877) -- 0:02:04
      144500 -- (-2541.373) [-2543.470] (-2541.127) (-2542.007) * (-2542.565) [-2541.128] (-2537.167) (-2542.930) -- 0:02:04
      145000 -- (-2550.765) [-2538.985] (-2548.845) (-2542.694) * (-2543.488) (-2541.409) (-2538.972) [-2541.400] -- 0:02:03

      Average standard deviation of split frequencies: 0.003229

      145500 -- (-2542.129) [-2540.775] (-2549.510) (-2544.198) * (-2550.807) (-2544.077) (-2545.726) [-2542.588] -- 0:02:03
      146000 -- (-2543.858) [-2540.325] (-2545.968) (-2541.838) * (-2543.635) [-2537.845] (-2538.597) (-2548.740) -- 0:02:02
      146500 -- (-2536.092) (-2543.444) (-2552.883) [-2545.817] * (-2554.651) (-2540.465) (-2543.902) [-2545.250] -- 0:02:02
      147000 -- [-2543.396] (-2545.844) (-2544.879) (-2552.914) * (-2549.832) (-2541.170) [-2543.670] (-2538.754) -- 0:02:01
      147500 -- (-2541.160) [-2543.712] (-2546.304) (-2545.000) * (-2547.448) (-2543.948) [-2541.633] (-2544.642) -- 0:02:01
      148000 -- (-2542.973) (-2542.795) [-2543.115] (-2545.856) * (-2545.920) [-2542.079] (-2544.028) (-2541.721) -- 0:02:06
      148500 -- (-2541.134) [-2541.933] (-2549.982) (-2551.826) * (-2538.943) (-2549.402) [-2542.599] (-2543.768) -- 0:02:06
      149000 -- [-2537.559] (-2545.183) (-2538.229) (-2551.666) * (-2541.817) [-2543.232] (-2543.415) (-2546.166) -- 0:02:05
      149500 -- (-2541.276) (-2541.168) [-2540.265] (-2545.149) * (-2545.649) (-2538.242) (-2541.257) [-2548.478] -- 0:02:05
      150000 -- (-2540.415) (-2547.402) [-2544.989] (-2549.004) * [-2537.066] (-2537.805) (-2541.190) (-2554.270) -- 0:02:04

      Average standard deviation of split frequencies: 0.003129

      150500 -- (-2544.401) (-2546.427) [-2542.958] (-2545.725) * (-2539.181) [-2541.228] (-2549.381) (-2543.653) -- 0:02:04
      151000 -- (-2546.949) (-2545.427) (-2548.510) [-2548.951] * (-2540.480) [-2541.649] (-2548.581) (-2542.890) -- 0:02:03
      151500 -- (-2540.302) (-2544.183) [-2552.452] (-2542.801) * (-2541.515) [-2538.514] (-2546.670) (-2539.561) -- 0:02:03
      152000 -- (-2550.536) (-2543.372) (-2544.588) [-2540.423] * (-2543.328) [-2541.205] (-2546.520) (-2545.120) -- 0:02:02
      152500 -- (-2546.388) (-2543.213) (-2540.062) [-2536.874] * (-2543.421) [-2538.312] (-2549.682) (-2544.288) -- 0:02:02
      153000 -- (-2537.346) (-2550.310) [-2543.450] (-2542.546) * (-2543.494) (-2542.695) [-2543.582] (-2545.856) -- 0:02:01
      153500 -- (-2541.962) [-2542.087] (-2543.113) (-2545.344) * (-2543.400) [-2539.628] (-2544.674) (-2542.594) -- 0:02:01
      154000 -- [-2540.822] (-2549.187) (-2540.478) (-2539.963) * (-2544.826) (-2546.368) [-2544.477] (-2542.737) -- 0:02:00
      154500 -- (-2540.634) (-2553.767) [-2539.019] (-2545.330) * (-2552.321) (-2543.595) [-2542.427] (-2541.528) -- 0:02:00
      155000 -- (-2549.491) (-2546.777) (-2542.275) [-2539.077] * [-2543.831] (-2544.111) (-2542.513) (-2544.655) -- 0:02:05

      Average standard deviation of split frequencies: 0.003022

      155500 -- (-2552.348) (-2553.596) (-2542.475) [-2544.094] * (-2544.875) [-2539.519] (-2542.338) (-2549.762) -- 0:02:04
      156000 -- (-2546.454) (-2545.569) (-2546.796) [-2548.418] * (-2546.445) (-2543.885) [-2541.945] (-2543.815) -- 0:02:04
      156500 -- (-2544.109) (-2541.422) (-2539.286) [-2544.055] * [-2538.493] (-2542.068) (-2544.343) (-2546.785) -- 0:02:03
      157000 -- (-2544.734) (-2540.455) [-2544.474] (-2543.356) * [-2541.626] (-2538.114) (-2541.859) (-2541.089) -- 0:02:03
      157500 -- (-2546.464) (-2541.898) (-2546.848) [-2540.995] * (-2544.706) [-2540.141] (-2542.913) (-2544.599) -- 0:02:03
      158000 -- (-2544.760) (-2540.813) [-2549.055] (-2541.740) * (-2542.717) (-2547.166) (-2545.196) [-2541.839] -- 0:02:02
      158500 -- (-2543.770) (-2544.852) (-2541.964) [-2536.531] * (-2541.932) (-2542.926) (-2545.031) [-2539.276] -- 0:02:02
      159000 -- (-2547.001) (-2544.298) (-2555.604) [-2540.837] * (-2543.995) (-2541.978) [-2548.414] (-2541.079) -- 0:02:01
      159500 -- (-2546.990) (-2540.508) (-2546.963) [-2543.132] * (-2545.495) (-2543.701) (-2540.716) [-2544.964] -- 0:02:01
      160000 -- (-2546.991) (-2542.232) (-2540.944) [-2540.247] * (-2542.757) (-2549.335) [-2539.832] (-2541.512) -- 0:02:00

      Average standard deviation of split frequencies: 0.002934

      160500 -- (-2543.781) (-2540.497) (-2540.104) [-2540.533] * (-2547.511) (-2552.965) [-2536.923] (-2541.930) -- 0:02:00
      161000 -- (-2539.686) [-2537.450] (-2537.147) (-2543.845) * (-2541.430) [-2542.673] (-2541.884) (-2543.491) -- 0:01:59
      161500 -- [-2541.166] (-2547.872) (-2540.925) (-2542.815) * [-2539.462] (-2545.652) (-2540.492) (-2554.032) -- 0:01:59
      162000 -- (-2543.305) (-2538.372) (-2538.745) [-2538.947] * [-2537.198] (-2544.272) (-2543.575) (-2549.757) -- 0:02:04
      162500 -- (-2540.215) [-2540.302] (-2540.856) (-2546.180) * (-2545.731) (-2538.556) [-2538.010] (-2549.186) -- 0:02:03
      163000 -- (-2544.479) [-2550.465] (-2545.404) (-2553.940) * (-2540.636) (-2545.085) [-2541.599] (-2545.681) -- 0:02:03
      163500 -- (-2545.927) (-2549.772) (-2543.977) [-2542.929] * (-2540.261) [-2538.575] (-2544.730) (-2542.942) -- 0:02:02
      164000 -- [-2546.086] (-2544.669) (-2541.422) (-2541.823) * (-2536.546) [-2547.621] (-2542.321) (-2545.154) -- 0:02:02
      164500 -- (-2542.447) [-2543.479] (-2542.455) (-2540.116) * (-2543.741) (-2540.942) [-2541.145] (-2546.628) -- 0:02:01
      165000 -- (-2552.613) (-2546.363) (-2543.826) [-2543.668] * (-2545.038) (-2539.096) (-2543.780) [-2543.553] -- 0:02:01

      Average standard deviation of split frequencies: 0.002840

      165500 -- (-2546.238) (-2544.569) (-2539.960) [-2541.875] * (-2547.735) (-2543.528) [-2539.729] (-2544.369) -- 0:02:01
      166000 -- (-2548.179) (-2537.184) (-2544.409) [-2544.605] * [-2545.700] (-2548.324) (-2546.712) (-2546.237) -- 0:02:00
      166500 -- (-2538.207) (-2544.954) (-2543.648) [-2538.722] * (-2541.986) (-2546.617) [-2542.146] (-2544.218) -- 0:02:00
      167000 -- [-2543.319] (-2541.183) (-2540.438) (-2540.691) * (-2537.567) [-2541.054] (-2546.066) (-2551.739) -- 0:01:59
      167500 -- [-2539.398] (-2545.781) (-2543.269) (-2541.433) * (-2540.935) (-2542.174) [-2548.443] (-2550.589) -- 0:01:59
      168000 -- (-2555.561) [-2547.126] (-2547.944) (-2545.540) * (-2545.372) (-2544.623) (-2545.969) [-2539.414] -- 0:01:58
      168500 -- [-2537.496] (-2542.043) (-2540.968) (-2546.296) * (-2539.303) (-2546.979) [-2538.454] (-2544.742) -- 0:02:03
      169000 -- [-2542.383] (-2544.975) (-2546.771) (-2538.263) * [-2541.835] (-2538.051) (-2542.530) (-2538.789) -- 0:02:02
      169500 -- (-2544.667) [-2542.250] (-2538.629) (-2541.435) * [-2539.032] (-2539.446) (-2542.367) (-2542.166) -- 0:02:02
      170000 -- [-2542.886] (-2542.884) (-2540.914) (-2539.434) * (-2541.628) (-2540.217) (-2544.871) [-2541.372] -- 0:02:02

      Average standard deviation of split frequencies: 0.002762

      170500 -- (-2542.876) [-2541.586] (-2545.103) (-2542.517) * [-2540.905] (-2544.351) (-2540.431) (-2537.114) -- 0:02:01
      171000 -- (-2553.831) (-2542.825) [-2542.201] (-2542.438) * (-2543.881) (-2542.484) (-2540.786) [-2539.120] -- 0:02:01
      171500 -- (-2552.271) [-2543.732] (-2542.952) (-2544.546) * [-2546.217] (-2545.483) (-2546.071) (-2550.367) -- 0:02:00
      172000 -- (-2543.679) (-2540.863) [-2538.311] (-2546.383) * [-2538.807] (-2547.220) (-2548.472) (-2543.146) -- 0:02:00
      172500 -- (-2540.123) (-2545.111) (-2541.710) [-2540.076] * (-2538.461) [-2541.564] (-2545.453) (-2544.896) -- 0:01:59
      173000 -- (-2548.131) (-2543.014) [-2541.956] (-2536.413) * (-2543.856) [-2548.518] (-2540.497) (-2545.077) -- 0:01:59
      173500 -- [-2541.781] (-2543.542) (-2544.477) (-2539.166) * (-2543.902) (-2543.219) (-2545.940) [-2542.044] -- 0:01:59
      174000 -- [-2542.449] (-2544.833) (-2547.202) (-2541.950) * (-2544.724) [-2545.055] (-2541.612) (-2546.277) -- 0:01:58
      174500 -- [-2539.670] (-2541.366) (-2550.564) (-2538.011) * (-2541.127) [-2543.905] (-2548.904) (-2541.877) -- 0:01:58
      175000 -- (-2541.702) [-2542.374] (-2548.533) (-2539.773) * [-2545.887] (-2542.311) (-2543.544) (-2543.468) -- 0:01:57

      Average standard deviation of split frequencies: 0.002678

      175500 -- (-2549.090) [-2544.378] (-2547.491) (-2539.822) * (-2544.045) [-2542.735] (-2544.840) (-2546.729) -- 0:02:02
      176000 -- (-2549.343) [-2543.762] (-2543.056) (-2544.320) * (-2544.863) [-2538.893] (-2549.992) (-2543.326) -- 0:02:01
      176500 -- (-2551.455) (-2542.280) [-2539.417] (-2540.634) * (-2543.042) [-2542.761] (-2543.754) (-2550.098) -- 0:02:01
      177000 -- (-2545.730) (-2549.772) (-2544.494) [-2540.207] * (-2543.272) [-2545.682] (-2540.918) (-2543.451) -- 0:02:00
      177500 -- (-2541.601) (-2552.644) [-2543.441] (-2540.507) * (-2540.476) (-2546.827) [-2539.545] (-2540.670) -- 0:02:00
      178000 -- [-2542.832] (-2543.782) (-2542.020) (-2543.816) * (-2546.783) (-2545.974) [-2543.863] (-2538.552) -- 0:02:00
      178500 -- (-2545.043) (-2541.328) (-2540.745) [-2550.684] * (-2555.069) [-2544.380] (-2546.075) (-2537.966) -- 0:01:59
      179000 -- (-2539.668) (-2542.838) (-2544.469) [-2541.113] * (-2548.425) (-2537.612) (-2541.729) [-2541.996] -- 0:01:59
      179500 -- (-2540.805) (-2541.215) [-2544.323] (-2537.587) * [-2542.904] (-2539.037) (-2540.376) (-2547.614) -- 0:01:58
      180000 -- (-2545.531) (-2545.525) (-2542.325) [-2536.851] * (-2542.543) (-2539.447) [-2542.819] (-2541.615) -- 0:01:58

      Average standard deviation of split frequencies: 0.002609

      180500 -- [-2540.654] (-2540.546) (-2542.762) (-2543.330) * [-2539.628] (-2544.652) (-2545.065) (-2541.401) -- 0:01:58
      181000 -- (-2543.626) (-2548.273) [-2541.411] (-2540.485) * (-2545.891) (-2546.088) (-2544.894) [-2542.463] -- 0:01:57
      181500 -- (-2546.185) (-2544.343) [-2545.348] (-2540.256) * (-2540.068) (-2548.243) [-2545.149] (-2542.364) -- 0:01:57
      182000 -- (-2546.637) [-2541.856] (-2541.015) (-2540.768) * (-2543.951) [-2543.190] (-2551.434) (-2543.476) -- 0:01:56
      182500 -- [-2544.098] (-2540.626) (-2545.186) (-2543.013) * (-2539.408) (-2538.016) [-2545.578] (-2542.289) -- 0:02:00
      183000 -- (-2544.643) (-2541.838) [-2541.887] (-2536.964) * [-2545.467] (-2542.229) (-2556.290) (-2542.252) -- 0:02:00
      183500 -- (-2545.980) (-2541.581) (-2541.953) [-2539.145] * [-2543.207] (-2546.056) (-2538.755) (-2542.156) -- 0:02:00
      184000 -- (-2550.215) (-2540.928) (-2542.890) [-2547.830] * (-2545.264) [-2540.587] (-2540.212) (-2547.157) -- 0:01:59
      184500 -- (-2554.834) (-2540.322) [-2550.178] (-2538.919) * [-2541.545] (-2542.681) (-2541.320) (-2546.274) -- 0:01:59
      185000 -- (-2541.304) (-2543.141) (-2542.554) [-2540.439] * [-2543.601] (-2541.351) (-2543.268) (-2547.832) -- 0:01:58

      Average standard deviation of split frequencies: 0.002534

      185500 -- (-2541.328) [-2543.247] (-2545.293) (-2543.225) * [-2541.426] (-2542.563) (-2544.852) (-2540.624) -- 0:01:58
      186000 -- [-2542.372] (-2558.196) (-2551.195) (-2541.373) * [-2539.439] (-2541.371) (-2542.811) (-2549.075) -- 0:01:58
      186500 -- [-2545.179] (-2544.102) (-2547.172) (-2536.542) * (-2544.657) [-2543.027] (-2537.693) (-2547.802) -- 0:01:57
      187000 -- [-2541.350] (-2540.663) (-2550.240) (-2541.252) * [-2536.828] (-2543.083) (-2539.260) (-2549.982) -- 0:01:57
      187500 -- (-2538.589) [-2540.567] (-2543.756) (-2539.983) * [-2542.194] (-2543.164) (-2545.327) (-2553.721) -- 0:01:57
      188000 -- (-2548.100) (-2543.941) (-2544.169) [-2539.504] * (-2543.110) [-2544.076] (-2549.438) (-2540.428) -- 0:01:56
      188500 -- [-2545.505] (-2540.176) (-2541.991) (-2538.298) * [-2539.968] (-2543.954) (-2544.933) (-2539.338) -- 0:01:56
      189000 -- (-2546.170) [-2545.296] (-2544.310) (-2543.903) * [-2543.443] (-2546.084) (-2543.442) (-2545.658) -- 0:02:00
      189500 -- [-2543.972] (-2543.063) (-2542.517) (-2545.778) * (-2547.133) (-2547.799) (-2542.739) [-2540.977] -- 0:01:59
      190000 -- (-2541.968) (-2539.706) [-2547.324] (-2548.589) * [-2542.943] (-2544.206) (-2542.966) (-2546.208) -- 0:01:59

      Average standard deviation of split frequencies: 0.002472

      190500 -- (-2546.217) (-2544.829) (-2543.835) [-2540.751] * (-2546.285) (-2549.683) [-2538.384] (-2543.390) -- 0:01:58
      191000 -- (-2541.240) (-2542.744) [-2544.478] (-2543.552) * (-2541.577) (-2546.645) [-2540.872] (-2541.775) -- 0:01:58
      191500 -- (-2547.582) (-2543.324) (-2540.911) [-2539.245] * (-2541.651) (-2543.296) (-2542.110) [-2537.854] -- 0:01:58
      192000 -- (-2543.573) [-2542.785] (-2543.769) (-2543.745) * (-2548.428) [-2541.451] (-2549.628) (-2539.401) -- 0:01:57
      192500 -- (-2547.500) [-2540.284] (-2547.896) (-2543.792) * (-2538.988) (-2549.356) (-2542.992) [-2545.367] -- 0:01:57
      193000 -- (-2538.894) (-2543.906) (-2546.641) [-2540.661] * [-2542.864] (-2540.745) (-2549.617) (-2540.610) -- 0:01:57
      193500 -- (-2540.629) (-2542.658) (-2545.140) [-2539.956] * (-2540.028) (-2539.390) [-2544.050] (-2539.773) -- 0:01:56
      194000 -- (-2543.518) [-2540.355] (-2541.627) (-2542.517) * (-2541.995) (-2538.519) [-2542.559] (-2538.970) -- 0:01:56
      194500 -- [-2543.368] (-2545.163) (-2549.431) (-2535.999) * (-2552.636) [-2539.677] (-2545.222) (-2546.729) -- 0:01:55
      195000 -- (-2539.458) (-2539.502) (-2544.207) [-2549.185] * [-2546.039] (-2542.456) (-2546.728) (-2542.062) -- 0:01:55

      Average standard deviation of split frequencies: 0.002405

      195500 -- (-2545.244) [-2546.501] (-2541.863) (-2543.291) * (-2541.283) [-2541.874] (-2543.904) (-2544.010) -- 0:01:55
      196000 -- (-2542.943) [-2546.844] (-2544.682) (-2543.550) * (-2544.629) [-2543.191] (-2547.361) (-2544.063) -- 0:01:58
      196500 -- (-2544.910) (-2544.840) [-2543.233] (-2546.267) * (-2545.219) [-2545.213] (-2551.162) (-2547.847) -- 0:01:58
      197000 -- (-2553.515) (-2544.695) (-2537.173) [-2543.010] * (-2547.747) [-2539.068] (-2555.768) (-2547.717) -- 0:01:58
      197500 -- (-2542.782) [-2540.140] (-2538.922) (-2539.773) * (-2546.804) [-2539.119] (-2544.968) (-2546.706) -- 0:01:57
      198000 -- (-2543.795) (-2544.410) (-2539.826) [-2539.692] * (-2546.734) [-2544.600] (-2547.998) (-2543.211) -- 0:01:57
      198500 -- (-2546.107) (-2538.349) (-2540.385) [-2550.094] * (-2550.273) [-2547.759] (-2538.834) (-2546.855) -- 0:01:57
      199000 -- (-2541.252) (-2541.654) [-2537.493] (-2541.505) * (-2539.902) (-2543.652) (-2543.114) [-2539.937] -- 0:01:56
      199500 -- (-2544.097) (-2548.682) (-2542.081) [-2540.133] * (-2551.798) [-2545.029] (-2542.949) (-2540.781) -- 0:01:56
      200000 -- (-2547.736) (-2550.058) [-2540.260] (-2537.564) * (-2546.859) [-2537.173] (-2546.411) (-2540.215) -- 0:01:56

      Average standard deviation of split frequencies: 0.002349

      200500 -- (-2543.611) (-2542.196) [-2543.439] (-2541.267) * (-2545.284) (-2542.129) [-2542.409] (-2539.716) -- 0:01:55
      201000 -- [-2544.376] (-2553.407) (-2542.743) (-2539.598) * (-2545.533) (-2542.735) [-2546.842] (-2538.834) -- 0:01:55
      201500 -- (-2545.922) (-2543.409) (-2543.797) [-2542.436] * (-2538.205) [-2538.556] (-2547.384) (-2541.330) -- 0:01:54
      202000 -- (-2541.866) (-2539.697) [-2545.528] (-2547.246) * (-2545.949) (-2539.436) (-2540.804) [-2537.085] -- 0:01:54
      202500 -- (-2542.625) (-2544.395) (-2543.755) [-2536.058] * (-2544.460) [-2536.090] (-2547.212) (-2539.701) -- 0:01:54
      203000 -- (-2541.042) [-2545.329] (-2541.774) (-2540.721) * (-2552.046) (-2543.240) (-2541.340) [-2541.422] -- 0:01:57
      203500 -- (-2544.183) [-2540.222] (-2549.543) (-2543.535) * (-2539.954) [-2537.424] (-2542.257) (-2540.772) -- 0:01:57
      204000 -- (-2545.817) (-2541.227) [-2541.975] (-2539.283) * [-2542.639] (-2538.934) (-2541.048) (-2542.716) -- 0:01:57
      204500 -- (-2547.834) (-2544.995) [-2543.948] (-2539.923) * (-2548.543) (-2543.488) (-2540.244) [-2546.953] -- 0:01:56
      205000 -- (-2549.419) (-2542.688) (-2541.159) [-2538.028] * [-2544.820] (-2542.395) (-2547.654) (-2542.266) -- 0:01:56

      Average standard deviation of split frequencies: 0.002288

      205500 -- (-2541.284) [-2546.752] (-2544.811) (-2537.018) * (-2539.341) (-2538.344) (-2540.751) [-2542.530] -- 0:01:55
      206000 -- (-2541.810) (-2546.399) (-2546.707) [-2540.361] * (-2537.294) (-2542.145) (-2544.218) [-2541.214] -- 0:01:55
      206500 -- (-2549.400) (-2539.779) (-2548.855) [-2545.856] * [-2539.159] (-2548.583) (-2546.498) (-2542.613) -- 0:01:55
      207000 -- (-2539.101) (-2548.175) [-2544.505] (-2547.122) * [-2542.126] (-2541.557) (-2550.369) (-2544.459) -- 0:01:54
      207500 -- (-2541.473) (-2552.067) [-2542.730] (-2543.528) * (-2539.117) [-2545.455] (-2546.881) (-2543.074) -- 0:01:54
      208000 -- (-2543.169) (-2544.078) (-2542.708) [-2537.931] * (-2543.183) (-2551.114) (-2541.233) [-2538.569] -- 0:01:54
      208500 -- (-2547.468) (-2550.518) [-2544.372] (-2545.988) * [-2539.561] (-2546.567) (-2547.474) (-2542.417) -- 0:01:53
      209000 -- (-2539.698) (-2546.038) [-2547.268] (-2545.394) * (-2545.939) (-2547.391) (-2550.769) [-2546.039] -- 0:01:53
      209500 -- (-2544.409) (-2546.199) [-2548.525] (-2548.191) * [-2544.832] (-2552.124) (-2552.026) (-2539.937) -- 0:01:53
      210000 -- (-2545.855) (-2543.292) [-2543.678] (-2550.791) * [-2539.137] (-2545.525) (-2552.689) (-2543.305) -- 0:01:56

      Average standard deviation of split frequencies: 0.002238

      210500 -- (-2540.786) (-2544.858) (-2544.666) [-2545.351] * [-2542.840] (-2546.416) (-2546.782) (-2543.153) -- 0:01:56
      211000 -- [-2541.709] (-2546.350) (-2539.868) (-2551.796) * (-2537.737) (-2551.159) (-2539.705) [-2547.496] -- 0:01:55
      211500 -- (-2547.000) (-2545.163) (-2543.349) [-2557.523] * [-2540.458] (-2545.768) (-2540.483) (-2547.496) -- 0:01:55
      212000 -- (-2550.304) [-2540.862] (-2541.864) (-2537.361) * (-2539.953) (-2543.313) [-2544.845] (-2545.182) -- 0:01:55
      212500 -- (-2543.513) (-2549.592) [-2540.996] (-2547.331) * [-2542.278] (-2541.547) (-2536.659) (-2547.026) -- 0:01:54
      213000 -- (-2545.477) (-2543.237) (-2539.551) [-2542.658] * (-2543.070) (-2544.612) [-2537.546] (-2547.746) -- 0:01:54
      213500 -- [-2542.813] (-2541.562) (-2540.170) (-2545.992) * [-2541.611] (-2546.021) (-2541.189) (-2544.885) -- 0:01:54
      214000 -- (-2548.468) [-2544.009] (-2539.522) (-2541.351) * (-2546.617) (-2545.395) (-2550.744) [-2541.820] -- 0:01:53
      214500 -- (-2547.502) (-2548.871) (-2552.702) [-2552.526] * (-2544.655) (-2544.553) (-2548.784) [-2542.975] -- 0:01:53
      215000 -- [-2543.638] (-2543.444) (-2546.441) (-2540.851) * [-2538.351] (-2547.122) (-2550.274) (-2541.797) -- 0:01:53

      Average standard deviation of split frequencies: 0.002182

      215500 -- (-2539.371) (-2552.937) [-2541.902] (-2544.362) * (-2541.012) (-2537.529) [-2536.440] (-2542.374) -- 0:01:52
      216000 -- (-2542.763) [-2539.893] (-2548.409) (-2541.402) * (-2542.205) [-2539.704] (-2540.063) (-2541.425) -- 0:01:52
      216500 -- [-2539.707] (-2541.861) (-2544.014) (-2551.856) * (-2548.394) (-2543.728) (-2548.473) [-2541.172] -- 0:01:55
      217000 -- (-2546.080) (-2546.011) [-2540.935] (-2543.883) * (-2546.566) (-2541.550) [-2544.210] (-2538.381) -- 0:01:55
      217500 -- (-2544.661) [-2544.088] (-2551.103) (-2546.401) * (-2546.073) (-2546.871) (-2544.557) [-2542.845] -- 0:01:55
      218000 -- (-2546.097) (-2542.979) [-2539.578] (-2546.392) * (-2546.345) (-2540.582) (-2548.354) [-2539.075] -- 0:01:54
      218500 -- [-2548.421] (-2546.104) (-2538.733) (-2548.595) * (-2541.768) (-2545.512) (-2539.130) [-2541.890] -- 0:01:54
      219000 -- (-2539.407) (-2545.332) (-2540.942) [-2543.210] * (-2539.457) (-2544.789) [-2542.744] (-2546.631) -- 0:01:54
      219500 -- (-2543.593) (-2546.309) (-2547.366) [-2538.239] * [-2542.101] (-2542.367) (-2543.680) (-2540.488) -- 0:01:53
      220000 -- (-2544.779) (-2540.480) (-2547.610) [-2545.814] * (-2543.810) (-2539.994) [-2543.747] (-2541.753) -- 0:01:53

      Average standard deviation of split frequencies: 0.002136

      220500 -- (-2541.159) (-2543.834) (-2538.780) [-2540.805] * (-2542.861) [-2542.361] (-2540.201) (-2543.528) -- 0:01:53
      221000 -- (-2545.036) [-2543.049] (-2540.720) (-2548.922) * [-2539.861] (-2537.817) (-2549.855) (-2544.924) -- 0:01:52
      221500 -- (-2544.288) (-2542.596) (-2547.805) [-2543.850] * (-2542.402) (-2537.378) (-2546.351) [-2546.845] -- 0:01:52
      222000 -- (-2542.897) [-2545.534] (-2544.884) (-2543.209) * (-2553.271) (-2547.571) (-2544.499) [-2541.029] -- 0:01:52
      222500 -- (-2537.164) [-2542.518] (-2538.916) (-2537.653) * [-2542.199] (-2541.127) (-2542.915) (-2540.394) -- 0:01:51
      223000 -- (-2545.646) (-2535.597) [-2542.746] (-2541.626) * [-2538.443] (-2545.427) (-2542.593) (-2549.154) -- 0:01:51
      223500 -- (-2544.797) (-2539.492) (-2538.688) [-2541.741] * [-2541.960] (-2542.716) (-2538.428) (-2541.234) -- 0:01:54
      224000 -- (-2543.405) [-2541.210] (-2543.523) (-2543.071) * [-2544.269] (-2543.679) (-2538.448) (-2550.915) -- 0:01:54
      224500 -- (-2547.384) (-2540.053) [-2543.446] (-2542.466) * (-2540.305) (-2546.694) (-2541.950) [-2540.470] -- 0:01:53
      225000 -- (-2546.844) (-2550.657) [-2541.306] (-2545.532) * [-2537.201] (-2544.602) (-2547.473) (-2542.931) -- 0:01:53

      Average standard deviation of split frequencies: 0.002086

      225500 -- (-2546.401) (-2549.544) (-2545.414) [-2544.546] * [-2539.679] (-2543.477) (-2546.642) (-2545.800) -- 0:01:53
      226000 -- [-2543.238] (-2552.407) (-2546.168) (-2542.428) * (-2542.689) (-2544.390) (-2550.144) [-2543.254] -- 0:01:53
      226500 -- [-2542.171] (-2544.178) (-2542.122) (-2548.863) * (-2554.261) (-2542.625) [-2547.361] (-2538.533) -- 0:01:52
      227000 -- [-2545.732] (-2541.645) (-2545.575) (-2540.263) * [-2539.940] (-2542.497) (-2548.124) (-2547.105) -- 0:01:52
      227500 -- (-2551.562) [-2537.278] (-2545.883) (-2543.221) * [-2542.350] (-2541.450) (-2541.945) (-2538.520) -- 0:01:52
      228000 -- [-2543.952] (-2538.969) (-2539.648) (-2538.750) * (-2542.777) (-2546.044) (-2544.104) [-2542.879] -- 0:01:51
      228500 -- (-2541.233) (-2541.312) [-2545.478] (-2545.761) * (-2538.210) (-2546.794) [-2539.290] (-2540.749) -- 0:01:51
      229000 -- (-2548.240) [-2539.397] (-2550.341) (-2540.448) * [-2539.344] (-2536.864) (-2541.869) (-2538.411) -- 0:01:51
      229500 -- (-2538.178) [-2542.933] (-2543.611) (-2540.766) * (-2544.695) (-2538.374) [-2539.595] (-2540.016) -- 0:01:50
      230000 -- (-2540.510) [-2540.245] (-2544.856) (-2539.639) * (-2541.509) [-2541.236] (-2546.161) (-2547.501) -- 0:01:50

      Average standard deviation of split frequencies: 0.002044

      230500 -- (-2539.396) (-2540.455) (-2537.846) [-2539.877] * (-2545.225) [-2537.900] (-2543.029) (-2546.669) -- 0:01:53
      231000 -- (-2539.242) (-2544.271) [-2542.139] (-2541.399) * (-2540.474) [-2542.410] (-2541.297) (-2540.914) -- 0:01:53
      231500 -- (-2542.842) (-2541.431) (-2540.777) [-2541.042] * [-2535.743] (-2541.880) (-2539.103) (-2544.823) -- 0:01:52
      232000 -- (-2544.361) (-2545.248) (-2540.132) [-2542.555] * (-2538.493) (-2544.184) (-2545.959) [-2539.185] -- 0:01:52
      232500 -- [-2551.170] (-2544.841) (-2551.324) (-2537.383) * (-2539.954) [-2547.975] (-2545.856) (-2542.299) -- 0:01:52
      233000 -- (-2541.513) [-2540.025] (-2545.301) (-2542.800) * (-2538.692) (-2548.115) (-2548.801) [-2539.178] -- 0:01:51
      233500 -- (-2546.288) (-2540.568) (-2548.756) [-2542.898] * [-2536.560] (-2544.696) (-2550.250) (-2547.897) -- 0:01:51
      234000 -- [-2542.814] (-2544.062) (-2538.568) (-2543.157) * (-2536.520) (-2546.125) (-2549.311) [-2539.984] -- 0:01:51
      234500 -- (-2541.842) [-2536.705] (-2542.916) (-2546.004) * [-2545.407] (-2550.493) (-2550.625) (-2540.267) -- 0:01:50
      235000 -- (-2541.333) [-2538.713] (-2544.432) (-2540.262) * (-2545.747) (-2541.150) [-2549.507] (-2543.378) -- 0:01:50

      Average standard deviation of split frequencies: 0.001997

      235500 -- (-2542.871) [-2540.856] (-2544.937) (-2542.905) * (-2539.579) [-2539.900] (-2545.200) (-2549.608) -- 0:01:50
      236000 -- [-2548.354] (-2542.043) (-2542.334) (-2541.688) * (-2541.802) [-2541.771] (-2547.754) (-2536.600) -- 0:01:50
      236500 -- (-2547.189) [-2545.911] (-2546.536) (-2543.139) * (-2543.133) (-2546.544) (-2554.462) [-2540.868] -- 0:01:49
      237000 -- [-2539.054] (-2546.854) (-2552.819) (-2542.205) * [-2541.065] (-2543.253) (-2554.515) (-2546.354) -- 0:01:52
      237500 -- (-2547.964) [-2540.445] (-2555.156) (-2545.231) * [-2541.515] (-2537.128) (-2549.339) (-2548.054) -- 0:01:52
      238000 -- (-2542.395) (-2540.959) (-2549.220) [-2538.456] * [-2545.217] (-2542.616) (-2547.562) (-2540.838) -- 0:01:52
      238500 -- (-2542.429) (-2554.102) (-2549.121) [-2544.808] * (-2542.478) (-2537.800) (-2542.002) [-2541.332] -- 0:01:51
      239000 -- [-2543.000] (-2547.186) (-2546.889) (-2547.346) * (-2547.466) (-2539.449) (-2541.384) [-2543.566] -- 0:01:51
      239500 -- (-2539.003) [-2537.877] (-2551.426) (-2543.359) * (-2547.717) [-2540.607] (-2550.059) (-2546.487) -- 0:01:51
      240000 -- (-2541.493) [-2545.991] (-2548.104) (-2540.814) * (-2541.840) [-2542.950] (-2544.243) (-2540.563) -- 0:01:50

      Average standard deviation of split frequencies: 0.001959

      240500 -- [-2537.333] (-2538.977) (-2549.598) (-2541.262) * [-2539.251] (-2539.092) (-2543.228) (-2546.601) -- 0:01:50
      241000 -- [-2539.453] (-2547.943) (-2550.795) (-2539.697) * (-2542.504) (-2541.486) [-2546.157] (-2552.645) -- 0:01:50
      241500 -- (-2542.751) (-2543.165) (-2555.618) [-2542.894] * [-2537.794] (-2542.976) (-2546.963) (-2547.201) -- 0:01:49
      242000 -- (-2542.407) [-2541.895] (-2541.947) (-2541.790) * [-2542.693] (-2536.706) (-2540.598) (-2545.518) -- 0:01:49
      242500 -- (-2544.386) (-2550.166) [-2548.530] (-2542.255) * (-2542.070) (-2538.793) [-2540.008] (-2545.291) -- 0:01:49
      243000 -- (-2554.845) [-2542.176] (-2544.412) (-2549.584) * (-2540.151) [-2545.707] (-2543.853) (-2548.061) -- 0:01:49
      243500 -- [-2546.003] (-2548.140) (-2546.511) (-2540.775) * [-2541.982] (-2550.820) (-2540.479) (-2540.685) -- 0:01:48
      244000 -- (-2547.616) [-2542.293] (-2550.166) (-2545.035) * (-2543.594) [-2543.100] (-2547.270) (-2544.470) -- 0:01:51
      244500 -- (-2548.683) (-2547.391) [-2541.122] (-2545.930) * (-2538.639) [-2538.123] (-2551.276) (-2544.835) -- 0:01:51
      245000 -- (-2543.811) [-2546.980] (-2541.446) (-2542.250) * (-2546.893) [-2539.886] (-2545.795) (-2543.096) -- 0:01:50

      Average standard deviation of split frequencies: 0.001916

      245500 -- [-2540.812] (-2549.285) (-2543.707) (-2538.457) * (-2545.793) (-2544.208) [-2542.824] (-2544.393) -- 0:01:50
      246000 -- (-2544.262) (-2541.415) [-2541.627] (-2541.187) * (-2541.498) (-2543.044) (-2537.698) [-2538.343] -- 0:01:50
      246500 -- [-2542.633] (-2538.599) (-2541.770) (-2547.117) * [-2541.514] (-2546.573) (-2540.093) (-2544.156) -- 0:01:50
      247000 -- (-2548.449) [-2543.516] (-2544.368) (-2547.445) * [-2543.601] (-2543.104) (-2540.515) (-2543.513) -- 0:01:49
      247500 -- [-2538.788] (-2545.640) (-2547.948) (-2542.024) * (-2544.870) (-2543.968) (-2541.930) [-2535.888] -- 0:01:49
      248000 -- [-2539.934] (-2538.140) (-2541.144) (-2544.759) * (-2544.625) (-2556.588) [-2543.265] (-2541.684) -- 0:01:49
      248500 -- [-2547.491] (-2545.461) (-2540.909) (-2540.860) * (-2546.062) (-2541.341) [-2538.625] (-2545.695) -- 0:01:48
      249000 -- (-2537.535) [-2541.866] (-2537.069) (-2543.209) * [-2545.361] (-2546.316) (-2550.718) (-2549.078) -- 0:01:48
      249500 -- [-2541.042] (-2538.958) (-2539.145) (-2542.098) * [-2543.426] (-2549.530) (-2548.968) (-2548.618) -- 0:01:48
      250000 -- [-2540.263] (-2539.678) (-2539.906) (-2540.133) * (-2542.866) [-2542.970] (-2546.596) (-2541.426) -- 0:01:48

      Average standard deviation of split frequencies: 0.001881

      250500 -- (-2542.275) [-2538.497] (-2545.306) (-2544.052) * (-2548.769) (-2541.554) (-2539.722) [-2540.757] -- 0:01:47
      251000 -- (-2541.989) [-2540.552] (-2539.953) (-2543.781) * (-2539.879) [-2538.661] (-2545.957) (-2540.995) -- 0:01:50
      251500 -- [-2537.138] (-2540.424) (-2544.954) (-2541.720) * [-2540.358] (-2538.033) (-2547.590) (-2550.930) -- 0:01:50
      252000 -- (-2541.774) (-2543.911) (-2542.028) [-2539.953] * (-2543.125) [-2536.730] (-2542.802) (-2553.545) -- 0:01:49
      252500 -- [-2538.701] (-2542.221) (-2543.371) (-2540.325) * (-2542.872) (-2540.978) [-2540.663] (-2550.133) -- 0:01:49
      253000 -- (-2540.296) (-2542.073) [-2545.856] (-2540.562) * (-2540.214) [-2538.810] (-2541.293) (-2547.778) -- 0:01:49
      253500 -- [-2539.940] (-2539.855) (-2547.339) (-2545.775) * (-2544.780) (-2551.252) [-2541.583] (-2541.780) -- 0:01:48
      254000 -- (-2538.791) [-2545.370] (-2543.300) (-2548.260) * [-2539.846] (-2547.579) (-2544.610) (-2546.298) -- 0:01:48
      254500 -- [-2540.956] (-2542.354) (-2543.016) (-2544.172) * (-2540.483) [-2545.902] (-2540.618) (-2543.847) -- 0:01:48
      255000 -- [-2545.403] (-2542.612) (-2545.950) (-2544.418) * (-2543.132) (-2542.878) (-2544.328) [-2538.108] -- 0:01:48

      Average standard deviation of split frequencies: 0.001841

      255500 -- (-2545.524) [-2544.875] (-2546.552) (-2545.413) * (-2542.442) (-2538.242) (-2543.160) [-2539.860] -- 0:01:47
      256000 -- (-2546.467) (-2541.831) (-2542.027) [-2544.423] * (-2548.912) [-2536.996] (-2542.927) (-2541.939) -- 0:01:47
      256500 -- (-2553.042) (-2544.612) [-2544.886] (-2544.681) * (-2550.808) [-2545.806] (-2542.053) (-2540.280) -- 0:01:47
      257000 -- (-2550.352) [-2541.191] (-2543.779) (-2545.350) * (-2544.984) (-2542.755) (-2540.826) [-2537.378] -- 0:01:46
      257500 -- (-2547.052) (-2538.775) (-2541.530) [-2540.957] * [-2542.890] (-2542.716) (-2542.420) (-2541.129) -- 0:01:49
      258000 -- (-2549.518) [-2539.803] (-2543.612) (-2544.140) * (-2541.618) (-2544.880) [-2542.358] (-2541.310) -- 0:01:49
      258500 -- (-2544.898) (-2540.041) (-2536.297) [-2538.363] * [-2547.082] (-2548.063) (-2546.467) (-2547.361) -- 0:01:49
      259000 -- (-2538.857) (-2544.250) [-2541.977] (-2543.870) * [-2549.194] (-2549.431) (-2544.496) (-2543.595) -- 0:01:48
      259500 -- (-2544.015) [-2540.920] (-2544.556) (-2542.319) * (-2543.242) [-2543.006] (-2543.494) (-2545.212) -- 0:01:48
      260000 -- (-2546.535) (-2540.339) [-2542.249] (-2541.418) * (-2539.964) (-2542.551) (-2544.467) [-2544.807] -- 0:01:48

      Average standard deviation of split frequencies: 0.001808

      260500 -- (-2541.929) (-2546.043) (-2542.004) [-2539.397] * (-2543.528) [-2538.648] (-2542.566) (-2553.612) -- 0:01:47
      261000 -- (-2545.583) (-2543.138) (-2546.421) [-2541.710] * (-2541.633) (-2541.729) (-2546.110) [-2544.965] -- 0:01:47
      261500 -- (-2546.017) (-2537.990) (-2537.294) [-2541.925] * (-2541.507) [-2545.715] (-2544.682) (-2550.165) -- 0:01:47
      262000 -- (-2547.793) [-2540.431] (-2538.319) (-2542.567) * (-2545.617) (-2541.849) (-2541.105) [-2539.957] -- 0:01:47
      262500 -- (-2541.726) [-2544.270] (-2540.483) (-2543.480) * (-2538.962) (-2542.356) (-2543.045) [-2544.388] -- 0:01:46
      263000 -- (-2540.378) (-2542.817) (-2541.872) [-2540.872] * (-2539.076) [-2541.441] (-2544.074) (-2541.956) -- 0:01:46
      263500 -- [-2541.658] (-2546.020) (-2544.500) (-2551.168) * (-2548.036) (-2543.220) (-2548.129) [-2539.057] -- 0:01:46
      264000 -- (-2539.148) (-2541.942) (-2539.650) [-2544.531] * [-2544.641] (-2546.228) (-2539.421) (-2542.421) -- 0:01:45
      264500 -- [-2543.867] (-2543.448) (-2545.082) (-2548.074) * (-2538.082) (-2546.692) [-2539.836] (-2544.403) -- 0:01:48
      265000 -- (-2545.039) [-2542.151] (-2543.902) (-2547.899) * (-2548.787) (-2541.698) [-2540.833] (-2539.235) -- 0:01:48

      Average standard deviation of split frequencies: 0.001772

      265500 -- (-2541.744) (-2538.035) [-2542.094] (-2545.166) * (-2539.102) (-2544.126) (-2538.035) [-2541.731] -- 0:01:47
      266000 -- (-2545.623) [-2539.294] (-2543.317) (-2546.269) * (-2545.034) (-2543.491) (-2549.590) [-2539.861] -- 0:01:47
      266500 -- [-2540.872] (-2546.958) (-2547.502) (-2543.121) * [-2542.434] (-2544.673) (-2541.970) (-2539.439) -- 0:01:47
      267000 -- (-2539.915) (-2540.800) [-2546.286] (-2543.290) * [-2542.058] (-2542.474) (-2543.315) (-2541.658) -- 0:01:47
      267500 -- [-2538.843] (-2544.268) (-2546.873) (-2556.432) * [-2540.126] (-2547.733) (-2544.262) (-2539.553) -- 0:01:46
      268000 -- (-2536.933) (-2543.894) (-2540.718) [-2541.111] * [-2542.159] (-2545.318) (-2541.715) (-2546.253) -- 0:01:46
      268500 -- (-2537.513) (-2538.326) (-2545.860) [-2538.553] * [-2538.328] (-2544.083) (-2537.432) (-2544.289) -- 0:01:46
      269000 -- (-2543.796) (-2544.862) (-2551.226) [-2541.413] * [-2536.274] (-2546.150) (-2539.149) (-2545.809) -- 0:01:45
      269500 -- (-2539.257) [-2537.206] (-2539.863) (-2538.829) * (-2537.651) [-2550.784] (-2543.888) (-2540.535) -- 0:01:45
      270000 -- (-2540.488) (-2537.048) [-2546.713] (-2544.382) * (-2539.046) [-2539.788] (-2541.530) (-2542.592) -- 0:01:45

      Average standard deviation of split frequencies: 0.001742

      270500 -- (-2544.474) [-2540.747] (-2542.496) (-2548.954) * [-2545.284] (-2540.037) (-2541.879) (-2543.061) -- 0:01:45
      271000 -- (-2543.252) (-2539.709) (-2546.683) [-2541.096] * [-2540.169] (-2554.187) (-2542.592) (-2549.121) -- 0:01:44
      271500 -- [-2543.165] (-2541.493) (-2538.932) (-2549.241) * (-2537.917) (-2550.793) (-2548.922) [-2539.374] -- 0:01:47
      272000 -- (-2544.097) [-2541.979] (-2544.681) (-2549.944) * (-2543.259) (-2545.102) (-2543.626) [-2538.468] -- 0:01:47
      272500 -- (-2546.851) (-2541.136) (-2538.621) [-2539.885] * (-2547.222) [-2542.809] (-2544.353) (-2544.808) -- 0:01:46
      273000 -- (-2538.977) (-2538.154) [-2539.211] (-2541.729) * [-2541.514] (-2540.203) (-2538.107) (-2542.316) -- 0:01:46
      273500 -- (-2543.781) (-2536.626) [-2540.896] (-2540.710) * (-2542.553) (-2548.401) (-2547.069) [-2544.559] -- 0:01:46
      274000 -- (-2544.098) (-2538.097) [-2538.975] (-2538.985) * (-2546.257) (-2547.658) [-2548.398] (-2538.672) -- 0:01:45
      274500 -- (-2542.512) [-2542.839] (-2540.833) (-2540.743) * (-2543.711) (-2546.752) [-2539.753] (-2541.926) -- 0:01:45
      275000 -- (-2543.647) [-2539.710] (-2541.548) (-2540.850) * [-2538.617] (-2546.072) (-2543.293) (-2544.244) -- 0:01:45

      Average standard deviation of split frequencies: 0.001708

      275500 -- [-2548.271] (-2540.025) (-2544.848) (-2543.200) * (-2543.631) (-2546.810) [-2543.180] (-2537.800) -- 0:01:45
      276000 -- (-2543.825) (-2546.733) [-2537.315] (-2541.657) * [-2547.844] (-2543.874) (-2544.378) (-2541.447) -- 0:01:44
      276500 -- (-2552.800) (-2539.300) (-2539.644) [-2541.742] * (-2551.848) [-2541.856] (-2544.991) (-2540.107) -- 0:01:44
      277000 -- (-2543.481) [-2542.414] (-2538.080) (-2543.164) * (-2541.428) (-2544.327) (-2546.995) [-2545.745] -- 0:01:44
      277500 -- (-2548.737) (-2548.317) (-2544.466) [-2541.302] * (-2541.672) [-2542.161] (-2540.150) (-2546.325) -- 0:01:44
      278000 -- (-2544.164) [-2538.161] (-2545.398) (-2542.308) * [-2547.992] (-2542.117) (-2542.315) (-2552.559) -- 0:01:46
      278500 -- (-2543.907) (-2537.179) [-2543.649] (-2547.386) * (-2544.717) (-2541.223) (-2546.080) [-2546.712] -- 0:01:46
      279000 -- [-2542.032] (-2547.220) (-2542.918) (-2538.242) * (-2537.393) [-2542.539] (-2542.135) (-2541.344) -- 0:01:45
      279500 -- (-2548.324) (-2540.691) [-2544.072] (-2539.804) * [-2539.841] (-2546.524) (-2543.234) (-2550.472) -- 0:01:45
      280000 -- (-2541.618) [-2541.364] (-2540.831) (-2543.009) * (-2542.421) (-2541.261) (-2549.486) [-2541.697] -- 0:01:45

      Average standard deviation of split frequencies: 0.001680

      280500 -- (-2539.841) (-2545.001) [-2539.998] (-2541.413) * [-2540.689] (-2545.451) (-2547.664) (-2541.401) -- 0:01:45
      281000 -- [-2542.206] (-2539.461) (-2545.054) (-2543.197) * (-2543.661) [-2541.822] (-2554.756) (-2539.370) -- 0:01:44
      281500 -- [-2541.559] (-2547.894) (-2548.240) (-2542.271) * (-2544.108) [-2544.874] (-2540.552) (-2542.208) -- 0:01:44
      282000 -- [-2542.812] (-2547.163) (-2541.708) (-2539.854) * (-2543.545) (-2545.378) [-2544.204] (-2544.584) -- 0:01:44
      282500 -- (-2543.832) [-2547.965] (-2542.438) (-2542.269) * (-2541.872) (-2538.590) [-2542.186] (-2540.805) -- 0:01:44
      283000 -- (-2547.589) [-2544.242] (-2545.708) (-2541.526) * (-2543.696) (-2544.042) (-2552.565) [-2543.783] -- 0:01:43
      283500 -- [-2543.653] (-2541.722) (-2548.507) (-2541.236) * (-2542.053) [-2541.231] (-2550.435) (-2547.257) -- 0:01:43
      284000 -- [-2541.885] (-2543.008) (-2542.638) (-2545.590) * (-2546.236) [-2543.281] (-2544.209) (-2542.515) -- 0:01:43
      284500 -- (-2544.281) (-2539.308) (-2541.471) [-2540.895] * [-2543.261] (-2538.649) (-2540.026) (-2547.082) -- 0:01:43
      285000 -- [-2542.942] (-2539.888) (-2544.285) (-2539.446) * [-2540.287] (-2543.643) (-2547.720) (-2544.106) -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-2546.015) (-2539.858) (-2542.565) [-2542.279] * [-2536.587] (-2542.444) (-2542.049) (-2545.482) -- 0:01:45
      286000 -- (-2545.969) [-2537.634] (-2548.898) (-2544.006) * [-2539.513] (-2541.421) (-2541.023) (-2545.241) -- 0:01:44
      286500 -- (-2546.619) [-2539.076] (-2546.267) (-2543.251) * [-2542.249] (-2544.836) (-2540.148) (-2549.133) -- 0:01:44
      287000 -- [-2546.841] (-2538.943) (-2540.854) (-2544.273) * (-2544.587) [-2537.068] (-2546.924) (-2546.047) -- 0:01:44
      287500 -- (-2540.479) [-2539.106] (-2548.766) (-2551.761) * [-2542.571] (-2539.679) (-2552.363) (-2539.806) -- 0:01:44
      288000 -- (-2548.016) (-2537.717) [-2538.392] (-2548.305) * (-2546.420) (-2541.225) (-2546.203) [-2539.137] -- 0:01:43
      288500 -- (-2537.948) [-2540.298] (-2544.034) (-2542.258) * [-2543.801] (-2546.200) (-2546.118) (-2547.102) -- 0:01:43
      289000 -- [-2540.332] (-2541.507) (-2541.951) (-2541.032) * [-2544.813] (-2540.191) (-2541.273) (-2537.872) -- 0:01:43
      289500 -- (-2536.496) (-2545.259) [-2541.477] (-2551.296) * (-2548.276) [-2540.239] (-2546.991) (-2550.816) -- 0:01:43
      290000 -- (-2538.113) [-2542.459] (-2544.107) (-2545.643) * (-2545.849) (-2547.632) [-2548.875] (-2543.597) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-2539.565) (-2539.413) [-2540.723] (-2545.827) * [-2547.052] (-2547.759) (-2548.766) (-2540.155) -- 0:01:42
      291000 -- (-2540.937) (-2541.771) [-2543.075] (-2544.665) * (-2549.602) [-2543.119] (-2550.485) (-2543.383) -- 0:01:42
      291500 -- (-2547.007) (-2540.003) (-2547.924) [-2540.963] * (-2540.536) (-2541.622) (-2548.119) [-2538.865] -- 0:01:42
      292000 -- (-2544.417) (-2540.334) (-2541.360) [-2543.573] * (-2552.137) [-2541.015] (-2543.889) (-2539.356) -- 0:01:44
      292500 -- [-2544.357] (-2541.745) (-2550.560) (-2540.457) * (-2549.436) [-2541.351] (-2547.922) (-2541.117) -- 0:01:44
      293000 -- (-2545.165) [-2541.865] (-2545.508) (-2540.458) * (-2547.545) (-2547.233) (-2545.226) [-2546.215] -- 0:01:43
      293500 -- [-2539.496] (-2544.567) (-2542.664) (-2544.176) * (-2542.004) [-2541.455] (-2548.408) (-2542.296) -- 0:01:43
      294000 -- (-2540.611) (-2540.680) (-2547.789) [-2542.072] * [-2542.563] (-2540.231) (-2542.694) (-2545.545) -- 0:01:43
      294500 -- (-2539.453) (-2545.139) [-2540.216] (-2546.681) * (-2546.682) [-2540.577] (-2542.873) (-2547.765) -- 0:01:43
      295000 -- (-2539.224) (-2540.382) [-2540.818] (-2546.898) * (-2540.098) [-2540.700] (-2546.482) (-2545.961) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-2543.886) (-2546.129) (-2541.368) [-2539.576] * (-2540.934) [-2544.366] (-2545.429) (-2547.471) -- 0:01:42
      296000 -- (-2542.150) [-2542.781] (-2538.095) (-2540.725) * (-2543.776) (-2542.339) (-2541.674) [-2540.520] -- 0:01:42
      296500 -- (-2541.766) (-2539.422) (-2547.811) [-2543.562] * (-2545.298) (-2546.741) (-2552.399) [-2544.906] -- 0:01:42
      297000 -- [-2537.405] (-2542.555) (-2545.858) (-2541.316) * (-2544.428) (-2540.849) (-2547.175) [-2548.081] -- 0:01:41
      297500 -- (-2540.261) [-2542.725] (-2545.079) (-2543.302) * (-2545.216) (-2539.186) (-2543.126) [-2538.472] -- 0:01:41
      298000 -- (-2541.359) [-2547.052] (-2541.762) (-2547.614) * (-2538.696) [-2540.081] (-2541.371) (-2541.202) -- 0:01:41
      298500 -- (-2547.113) (-2542.828) [-2544.697] (-2542.337) * (-2546.339) [-2539.320] (-2543.864) (-2548.862) -- 0:01:41
      299000 -- (-2549.253) (-2550.020) [-2544.778] (-2546.606) * [-2540.235] (-2543.612) (-2542.041) (-2543.151) -- 0:01:43
      299500 -- (-2545.469) (-2540.884) [-2544.680] (-2544.767) * (-2547.650) [-2537.834] (-2545.102) (-2544.378) -- 0:01:42
      300000 -- (-2545.046) [-2543.461] (-2549.610) (-2540.467) * (-2546.522) (-2541.701) (-2549.020) [-2543.493] -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-2541.314) [-2542.594] (-2549.325) (-2544.380) * [-2541.544] (-2544.879) (-2555.168) (-2543.162) -- 0:01:42
      301000 -- [-2546.349] (-2541.573) (-2551.731) (-2543.549) * (-2543.255) (-2541.774) (-2549.513) [-2543.314] -- 0:01:42
      301500 -- (-2549.019) (-2551.251) [-2542.252] (-2543.416) * [-2539.697] (-2545.371) (-2551.557) (-2539.399) -- 0:01:41
      302000 -- [-2543.279] (-2544.234) (-2553.081) (-2548.485) * (-2541.720) (-2541.938) (-2558.491) [-2542.737] -- 0:01:41
      302500 -- [-2543.563] (-2542.278) (-2540.511) (-2548.921) * (-2540.594) (-2544.327) (-2544.876) [-2541.606] -- 0:01:41
      303000 -- [-2546.412] (-2543.662) (-2542.813) (-2546.899) * (-2540.154) (-2546.378) [-2546.857] (-2543.704) -- 0:01:41
      303500 -- (-2546.831) (-2541.588) (-2543.926) [-2540.590] * (-2542.664) (-2542.609) (-2544.295) [-2543.275] -- 0:01:40
      304000 -- (-2543.596) [-2538.217] (-2546.844) (-2543.453) * (-2548.508) [-2544.800] (-2548.044) (-2543.604) -- 0:01:40
      304500 -- [-2543.252] (-2543.578) (-2538.814) (-2543.873) * (-2544.128) [-2544.791] (-2548.020) (-2548.443) -- 0:01:40
      305000 -- (-2543.107) (-2540.989) (-2536.018) [-2540.140] * [-2539.116] (-2540.988) (-2544.325) (-2545.001) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-2542.216) (-2539.746) [-2544.801] (-2544.600) * [-2546.597] (-2545.148) (-2550.827) (-2545.493) -- 0:01:42
      306000 -- (-2543.115) (-2541.201) [-2547.423] (-2540.832) * (-2544.497) (-2549.036) [-2544.074] (-2555.932) -- 0:01:42
      306500 -- (-2541.394) (-2543.850) [-2541.719] (-2542.484) * [-2544.653] (-2547.311) (-2551.197) (-2541.606) -- 0:01:41
      307000 -- (-2543.566) [-2544.291] (-2537.692) (-2545.473) * (-2544.475) [-2537.297] (-2544.161) (-2546.239) -- 0:01:41
      307500 -- (-2544.598) (-2548.506) (-2540.873) [-2540.624] * (-2545.425) [-2541.859] (-2544.683) (-2541.025) -- 0:01:41
      308000 -- [-2544.027] (-2553.116) (-2545.964) (-2547.713) * (-2546.381) (-2548.475) (-2545.087) [-2542.010] -- 0:01:41
      308500 -- (-2547.239) [-2544.812] (-2540.312) (-2546.547) * [-2543.208] (-2541.646) (-2546.047) (-2541.545) -- 0:01:40
      309000 -- (-2550.105) [-2540.473] (-2544.645) (-2543.961) * (-2542.515) [-2539.705] (-2544.426) (-2542.024) -- 0:01:40
      309500 -- (-2541.718) (-2541.159) [-2545.102] (-2542.071) * [-2544.503] (-2540.756) (-2547.585) (-2543.078) -- 0:01:40
      310000 -- (-2538.235) [-2543.136] (-2540.104) (-2542.898) * (-2543.438) [-2536.366] (-2543.945) (-2543.454) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-2544.694) (-2539.684) [-2546.553] (-2547.021) * (-2539.060) (-2543.958) [-2544.799] (-2542.431) -- 0:01:39
      311000 -- (-2547.516) (-2544.759) (-2543.544) [-2539.089] * [-2540.803] (-2538.107) (-2546.979) (-2544.701) -- 0:01:39
      311500 -- (-2539.010) (-2547.456) [-2549.320] (-2540.024) * (-2543.408) [-2541.371] (-2545.176) (-2543.196) -- 0:01:39
      312000 -- (-2544.134) (-2543.378) [-2540.773] (-2548.008) * (-2545.790) (-2541.419) [-2543.134] (-2546.734) -- 0:01:39
      312500 -- (-2546.963) (-2543.063) [-2535.837] (-2549.788) * [-2543.502] (-2543.813) (-2539.481) (-2548.221) -- 0:01:41
      313000 -- (-2544.998) (-2543.472) [-2541.603] (-2544.458) * [-2542.210] (-2543.000) (-2545.242) (-2545.215) -- 0:01:40
      313500 -- (-2539.412) (-2542.597) (-2545.249) [-2548.195] * (-2544.362) (-2546.767) (-2540.857) [-2547.696] -- 0:01:40
      314000 -- (-2539.913) (-2544.351) [-2545.011] (-2546.892) * (-2549.250) [-2545.029] (-2540.909) (-2544.232) -- 0:01:40
      314500 -- (-2543.716) [-2544.666] (-2549.112) (-2539.008) * (-2544.860) (-2548.649) (-2542.963) [-2537.869] -- 0:01:40
      315000 -- [-2546.315] (-2540.722) (-2544.169) (-2536.755) * (-2544.120) (-2539.410) (-2542.895) [-2540.406] -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      315500 -- [-2538.501] (-2554.793) (-2542.036) (-2542.045) * [-2548.320] (-2546.727) (-2544.228) (-2549.025) -- 0:01:39
      316000 -- (-2550.117) [-2535.737] (-2547.515) (-2544.662) * (-2545.669) (-2537.606) (-2547.291) [-2539.172] -- 0:01:39
      316500 -- (-2546.019) [-2542.521] (-2542.342) (-2546.692) * (-2547.926) [-2538.857] (-2542.987) (-2539.350) -- 0:01:39
      317000 -- (-2543.050) (-2543.123) (-2541.893) [-2549.941] * (-2552.142) [-2542.314] (-2544.116) (-2539.099) -- 0:01:39
      317500 -- (-2544.416) [-2539.572] (-2539.819) (-2541.763) * [-2538.150] (-2544.823) (-2541.822) (-2541.106) -- 0:01:38
      318000 -- [-2538.327] (-2541.230) (-2550.456) (-2541.099) * (-2546.610) (-2543.851) (-2545.393) [-2547.766] -- 0:01:38
      318500 -- (-2543.319) (-2543.276) (-2543.812) [-2543.887] * (-2545.713) [-2540.417] (-2541.028) (-2542.102) -- 0:01:38
      319000 -- (-2539.124) [-2544.432] (-2540.019) (-2547.685) * (-2541.079) [-2539.902] (-2541.239) (-2545.099) -- 0:01:38
      319500 -- (-2543.273) [-2539.983] (-2546.756) (-2550.904) * (-2542.102) (-2544.917) [-2543.984] (-2545.915) -- 0:01:40
      320000 -- (-2539.942) (-2542.284) (-2543.209) [-2544.236] * (-2548.737) (-2545.412) [-2544.324] (-2539.810) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      320500 -- [-2542.518] (-2540.403) (-2543.843) (-2549.393) * [-2545.193] (-2546.819) (-2543.658) (-2543.466) -- 0:01:39
      321000 -- [-2544.279] (-2546.225) (-2545.353) (-2544.968) * (-2554.261) (-2547.561) (-2542.654) [-2544.734] -- 0:01:39
      321500 -- (-2544.800) (-2544.177) (-2539.932) [-2540.845] * [-2540.423] (-2546.229) (-2543.230) (-2544.571) -- 0:01:39
      322000 -- (-2540.389) (-2545.158) (-2537.335) [-2539.245] * (-2541.297) (-2546.094) (-2540.461) [-2548.562] -- 0:01:38
      322500 -- (-2551.113) (-2541.317) (-2541.745) [-2537.936] * (-2538.037) [-2545.970] (-2540.045) (-2553.508) -- 0:01:38
      323000 -- (-2546.673) [-2542.738] (-2549.990) (-2548.718) * (-2546.447) (-2553.275) [-2547.291] (-2541.349) -- 0:01:38
      323500 -- [-2541.820] (-2543.332) (-2547.415) (-2551.191) * (-2539.809) (-2543.234) (-2543.325) [-2537.458] -- 0:01:38
      324000 -- (-2539.885) [-2549.658] (-2542.568) (-2544.560) * (-2539.036) (-2544.527) [-2540.059] (-2544.792) -- 0:01:38
      324500 -- (-2542.762) (-2539.516) (-2542.473) [-2540.606] * (-2543.377) (-2547.323) [-2536.720] (-2554.279) -- 0:01:37
      325000 -- (-2542.007) (-2545.204) [-2543.901] (-2539.809) * (-2540.380) [-2542.165] (-2540.247) (-2542.643) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-2544.481) (-2548.821) [-2537.524] (-2541.735) * [-2541.253] (-2547.265) (-2545.058) (-2539.023) -- 0:01:37
      326000 -- (-2546.351) (-2546.130) (-2546.052) [-2539.145] * [-2546.895] (-2541.834) (-2541.821) (-2544.810) -- 0:01:39
      326500 -- (-2539.680) [-2544.786] (-2544.050) (-2539.215) * [-2541.882] (-2547.088) (-2537.003) (-2549.954) -- 0:01:39
      327000 -- (-2541.198) [-2548.497] (-2546.417) (-2544.524) * (-2541.473) (-2544.768) [-2538.576] (-2540.765) -- 0:01:38
      327500 -- (-2540.611) (-2547.873) [-2546.773] (-2540.834) * [-2540.702] (-2544.864) (-2550.845) (-2542.466) -- 0:01:38
      328000 -- [-2551.408] (-2546.078) (-2550.706) (-2539.806) * (-2544.173) (-2549.044) [-2544.496] (-2540.510) -- 0:01:38
      328500 -- (-2546.729) (-2545.247) [-2547.935] (-2542.393) * (-2538.804) (-2544.306) [-2538.645] (-2544.129) -- 0:01:38
      329000 -- (-2547.679) [-2542.189] (-2548.629) (-2547.561) * (-2539.979) [-2547.553] (-2546.460) (-2549.209) -- 0:01:37
      329500 -- [-2551.628] (-2545.386) (-2541.107) (-2548.202) * (-2549.997) (-2541.561) [-2545.016] (-2549.149) -- 0:01:37
      330000 -- (-2558.178) [-2540.902] (-2549.082) (-2542.545) * (-2542.605) [-2539.087] (-2540.470) (-2544.509) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      330500 -- [-2545.685] (-2538.836) (-2543.454) (-2545.337) * [-2544.813] (-2546.930) (-2539.743) (-2542.327) -- 0:01:37
      331000 -- (-2546.490) (-2543.953) [-2546.076] (-2542.770) * (-2539.191) [-2544.643] (-2545.829) (-2542.393) -- 0:01:37
      331500 -- (-2546.986) [-2543.157] (-2537.192) (-2541.760) * (-2537.121) [-2541.526] (-2546.062) (-2546.116) -- 0:01:36
      332000 -- (-2547.713) (-2542.690) [-2537.712] (-2543.593) * [-2539.866] (-2546.532) (-2542.413) (-2542.083) -- 0:01:36
      332500 -- (-2552.800) (-2541.797) (-2538.398) [-2538.533] * (-2544.855) [-2549.960] (-2545.862) (-2543.685) -- 0:01:36
      333000 -- (-2544.695) (-2539.567) [-2541.352] (-2550.125) * [-2547.968] (-2541.440) (-2541.880) (-2542.904) -- 0:01:38
      333500 -- (-2555.479) (-2540.796) (-2541.633) [-2543.703] * (-2542.816) (-2540.502) [-2543.153] (-2538.118) -- 0:01:37
      334000 -- (-2552.405) (-2539.703) (-2538.750) [-2538.955] * (-2541.133) [-2540.850] (-2544.738) (-2542.751) -- 0:01:37
      334500 -- (-2553.648) (-2539.714) (-2539.064) [-2541.644] * [-2541.501] (-2543.532) (-2546.983) (-2545.994) -- 0:01:37
      335000 -- (-2547.070) [-2543.864] (-2542.806) (-2544.163) * [-2548.917] (-2545.076) (-2550.118) (-2544.060) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-2544.075) [-2541.011] (-2542.531) (-2547.609) * (-2542.878) (-2548.174) [-2543.760] (-2546.885) -- 0:01:37
      336000 -- [-2553.739] (-2546.462) (-2549.981) (-2551.116) * (-2543.683) [-2539.934] (-2541.579) (-2539.302) -- 0:01:36
      336500 -- (-2549.202) (-2540.896) [-2537.764] (-2539.765) * (-2543.390) (-2546.596) (-2544.086) [-2542.103] -- 0:01:36
      337000 -- (-2543.955) [-2548.848] (-2539.618) (-2543.868) * (-2546.027) (-2539.486) [-2542.019] (-2542.385) -- 0:01:36
      337500 -- [-2543.975] (-2549.130) (-2544.529) (-2543.601) * (-2540.687) (-2540.590) [-2538.729] (-2541.875) -- 0:01:36
      338000 -- [-2541.496] (-2544.515) (-2544.806) (-2543.792) * (-2543.242) [-2540.548] (-2540.735) (-2540.028) -- 0:01:35
      338500 -- (-2546.680) [-2542.839] (-2540.861) (-2542.236) * (-2542.747) [-2543.441] (-2542.345) (-2541.847) -- 0:01:35
      339000 -- (-2541.924) [-2540.112] (-2544.049) (-2547.248) * (-2546.050) (-2543.682) [-2543.212] (-2542.943) -- 0:01:35
      339500 -- (-2539.335) (-2548.348) (-2541.822) [-2542.631] * [-2540.996] (-2539.235) (-2539.830) (-2540.479) -- 0:01:35
      340000 -- [-2541.724] (-2546.932) (-2543.585) (-2543.920) * (-2545.104) [-2537.372] (-2537.850) (-2547.444) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      340500 -- (-2539.989) (-2546.246) (-2545.323) [-2539.497] * (-2548.400) [-2539.596] (-2543.487) (-2544.255) -- 0:01:36
      341000 -- (-2542.622) [-2544.513] (-2550.889) (-2544.764) * (-2548.528) (-2541.774) [-2541.120] (-2543.481) -- 0:01:36
      341500 -- [-2549.502] (-2542.228) (-2546.802) (-2542.535) * [-2545.629] (-2544.515) (-2545.096) (-2548.955) -- 0:01:36
      342000 -- (-2541.510) (-2543.269) [-2542.040] (-2546.803) * (-2544.846) [-2540.721] (-2544.807) (-2539.731) -- 0:01:36
      342500 -- [-2547.161] (-2538.359) (-2546.292) (-2539.782) * [-2546.717] (-2544.394) (-2540.789) (-2543.479) -- 0:01:35
      343000 -- (-2549.435) (-2539.857) [-2540.658] (-2541.130) * (-2546.677) (-2541.856) (-2542.833) [-2538.397] -- 0:01:35
      343500 -- (-2544.255) [-2539.209] (-2546.519) (-2543.550) * (-2544.376) [-2542.476] (-2545.036) (-2548.586) -- 0:01:35
      344000 -- (-2540.207) (-2537.939) [-2544.034] (-2551.904) * (-2543.789) [-2546.802] (-2545.973) (-2541.811) -- 0:01:35
      344500 -- (-2544.918) [-2540.632] (-2539.422) (-2548.301) * (-2543.866) [-2540.842] (-2555.513) (-2537.656) -- 0:01:35
      345000 -- (-2542.561) (-2541.180) (-2536.655) [-2540.434] * [-2541.862] (-2544.154) (-2547.600) (-2547.348) -- 0:01:34

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-2541.329) (-2550.064) (-2543.744) [-2539.355] * (-2546.201) [-2542.110] (-2552.649) (-2546.689) -- 0:01:34
      346000 -- [-2543.278] (-2543.571) (-2545.711) (-2540.127) * (-2545.606) (-2544.308) [-2541.764] (-2547.947) -- 0:01:34
      346500 -- (-2541.545) (-2551.621) [-2543.243] (-2548.228) * [-2540.596] (-2545.406) (-2548.108) (-2542.643) -- 0:01:34
      347000 -- [-2541.498] (-2541.535) (-2543.764) (-2545.437) * (-2545.339) (-2550.213) (-2548.389) [-2542.683] -- 0:01:35
      347500 -- (-2538.163) (-2543.697) [-2542.811] (-2547.729) * [-2541.318] (-2547.417) (-2545.020) (-2546.434) -- 0:01:35
      348000 -- (-2546.380) [-2542.356] (-2541.859) (-2545.157) * (-2546.639) (-2540.976) (-2544.465) [-2550.588] -- 0:01:35
      348500 -- (-2550.358) (-2547.514) [-2541.713] (-2548.501) * (-2538.610) [-2541.042] (-2544.866) (-2546.003) -- 0:01:35
      349000 -- (-2550.953) (-2543.919) (-2545.792) [-2543.220] * (-2541.689) [-2542.846] (-2547.058) (-2541.048) -- 0:01:35
      349500 -- (-2548.104) (-2547.842) [-2540.298] (-2538.515) * (-2538.563) (-2540.915) [-2538.112] (-2544.997) -- 0:01:34
      350000 -- (-2546.464) [-2542.234] (-2541.651) (-2537.811) * (-2538.893) (-2545.939) [-2545.233] (-2543.261) -- 0:01:34

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-2547.311) [-2542.250] (-2542.988) (-2541.129) * (-2543.762) (-2544.573) (-2542.577) [-2538.954] -- 0:01:34
      351000 -- [-2546.350] (-2546.693) (-2541.392) (-2544.278) * (-2544.844) (-2550.147) (-2540.290) [-2542.693] -- 0:01:34
      351500 -- (-2545.886) [-2546.504] (-2538.110) (-2553.309) * [-2545.269] (-2550.630) (-2540.630) (-2545.577) -- 0:01:34
      352000 -- (-2543.957) [-2544.441] (-2542.311) (-2540.485) * [-2536.720] (-2543.919) (-2537.637) (-2540.693) -- 0:01:33
      352500 -- (-2541.713) (-2546.081) (-2546.709) [-2541.194] * [-2546.460] (-2547.846) (-2538.616) (-2544.604) -- 0:01:33
      353000 -- [-2544.575] (-2546.974) (-2547.100) (-2544.483) * (-2546.152) (-2546.625) [-2542.614] (-2547.327) -- 0:01:33
      353500 -- (-2536.613) (-2544.462) (-2543.914) [-2544.707] * (-2549.306) [-2543.208] (-2541.129) (-2541.686) -- 0:01:35
      354000 -- (-2541.483) (-2539.635) (-2540.378) [-2543.871] * (-2543.387) (-2540.990) (-2543.388) [-2537.855] -- 0:01:34
      354500 -- (-2547.970) (-2538.869) (-2543.530) [-2543.582] * (-2545.022) [-2543.644] (-2550.985) (-2543.423) -- 0:01:34
      355000 -- (-2540.912) (-2540.830) (-2544.590) [-2540.300] * (-2542.135) (-2549.929) [-2542.713] (-2548.130) -- 0:01:34

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-2545.876) [-2541.102] (-2547.247) (-2545.395) * (-2541.342) [-2543.200] (-2539.847) (-2543.114) -- 0:01:34
      356000 -- (-2542.989) (-2537.166) [-2544.451] (-2541.596) * (-2546.249) [-2544.671] (-2544.430) (-2544.512) -- 0:01:34
      356500 -- (-2544.434) (-2541.776) (-2542.975) [-2541.463] * (-2542.613) (-2550.309) [-2542.931] (-2546.206) -- 0:01:33
      357000 -- (-2540.229) [-2543.484] (-2541.898) (-2541.522) * [-2546.650] (-2552.843) (-2547.209) (-2542.739) -- 0:01:33
      357500 -- (-2542.017) [-2543.072] (-2539.084) (-2544.289) * (-2539.618) (-2541.832) [-2538.933] (-2550.325) -- 0:01:33
      358000 -- [-2542.343] (-2541.870) (-2542.393) (-2540.604) * (-2540.079) (-2545.173) [-2541.815] (-2551.564) -- 0:01:33
      358500 -- (-2542.748) (-2539.901) (-2548.711) [-2539.611] * (-2544.079) (-2544.467) [-2542.144] (-2545.177) -- 0:01:33
      359000 -- (-2543.996) (-2538.295) [-2544.758] (-2540.295) * (-2543.708) (-2541.509) [-2542.071] (-2543.763) -- 0:01:32
      359500 -- (-2544.242) (-2547.356) (-2544.409) [-2541.481] * (-2540.160) (-2544.266) (-2541.299) [-2539.494] -- 0:01:32
      360000 -- (-2541.384) [-2547.296] (-2544.291) (-2543.270) * (-2542.667) [-2542.411] (-2542.472) (-2539.591) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-2547.893) [-2538.658] (-2547.571) (-2548.285) * (-2543.031) [-2543.006] (-2545.874) (-2538.922) -- 0:01:34
      361000 -- (-2544.931) (-2536.867) [-2543.080] (-2543.524) * [-2542.302] (-2542.593) (-2539.370) (-2539.992) -- 0:01:33
      361500 -- (-2542.396) (-2550.102) [-2547.358] (-2538.740) * (-2548.865) (-2542.958) (-2541.212) [-2544.730] -- 0:01:33
      362000 -- (-2544.345) (-2542.351) (-2541.415) [-2545.843] * (-2556.937) (-2541.558) (-2542.602) [-2539.926] -- 0:01:33
      362500 -- (-2543.646) (-2548.197) [-2544.949] (-2546.826) * (-2549.925) (-2544.973) [-2543.771] (-2541.375) -- 0:01:33
      363000 -- (-2543.526) (-2542.487) (-2544.587) [-2543.520] * [-2539.138] (-2544.192) (-2538.580) (-2541.687) -- 0:01:33
      363500 -- (-2548.747) (-2545.113) (-2544.250) [-2538.956] * (-2541.497) (-2543.193) [-2545.072] (-2546.974) -- 0:01:32
      364000 -- [-2543.472] (-2546.854) (-2543.009) (-2544.891) * (-2545.616) (-2540.756) [-2546.013] (-2547.124) -- 0:01:32
      364500 -- (-2544.491) (-2544.839) (-2545.204) [-2539.726] * (-2549.590) (-2540.647) [-2542.839] (-2545.934) -- 0:01:32
      365000 -- [-2542.403] (-2542.246) (-2542.823) (-2544.635) * (-2540.406) (-2541.583) (-2543.959) [-2541.075] -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-2545.104) (-2547.036) [-2540.465] (-2543.715) * (-2538.972) (-2545.381) (-2551.110) [-2539.997] -- 0:01:32
      366000 -- (-2537.673) [-2541.025] (-2542.670) (-2545.841) * [-2544.903] (-2541.796) (-2546.189) (-2539.934) -- 0:01:31
      366500 -- (-2538.246) [-2539.724] (-2536.973) (-2541.308) * [-2545.105] (-2544.125) (-2541.776) (-2542.993) -- 0:01:31
      367000 -- (-2540.053) (-2548.547) (-2541.860) [-2542.581] * [-2538.444] (-2543.002) (-2544.548) (-2552.576) -- 0:01:31
      367500 -- (-2541.485) (-2543.038) [-2551.593] (-2544.414) * (-2542.831) [-2541.594] (-2544.254) (-2547.786) -- 0:01:32
      368000 -- (-2540.910) [-2539.971] (-2550.948) (-2538.115) * [-2540.476] (-2547.069) (-2544.681) (-2537.954) -- 0:01:32
      368500 -- [-2542.925] (-2541.681) (-2542.438) (-2549.222) * (-2544.913) (-2539.841) [-2539.249] (-2546.621) -- 0:01:32
      369000 -- (-2548.105) (-2548.121) [-2539.240] (-2549.837) * (-2546.461) (-2542.986) [-2540.467] (-2541.287) -- 0:01:32
      369500 -- (-2555.260) (-2539.578) (-2546.335) [-2548.908] * (-2542.806) [-2537.265] (-2542.020) (-2547.224) -- 0:01:32
      370000 -- (-2542.771) [-2543.711] (-2544.990) (-2542.684) * [-2552.980] (-2542.308) (-2556.814) (-2544.256) -- 0:01:31

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-2543.229) [-2538.851] (-2548.894) (-2542.767) * (-2547.823) [-2539.348] (-2542.874) (-2546.044) -- 0:01:31
      371000 -- [-2540.986] (-2541.952) (-2541.649) (-2543.351) * [-2545.421] (-2538.256) (-2544.346) (-2546.586) -- 0:01:31
      371500 -- (-2541.281) (-2546.478) [-2545.486] (-2542.110) * (-2541.135) (-2541.918) (-2548.290) [-2546.627] -- 0:01:31
      372000 -- (-2538.220) [-2546.441] (-2545.346) (-2547.391) * (-2539.208) [-2543.648] (-2543.481) (-2542.963) -- 0:01:31
      372500 -- [-2539.073] (-2544.173) (-2546.703) (-2546.897) * (-2548.317) (-2540.847) (-2541.436) [-2543.347] -- 0:01:30
      373000 -- (-2543.716) (-2541.074) [-2542.435] (-2544.721) * [-2540.285] (-2551.096) (-2550.215) (-2548.530) -- 0:01:30
      373500 -- (-2544.286) (-2545.039) (-2539.883) [-2548.039] * (-2543.637) (-2541.967) (-2543.247) [-2543.082] -- 0:01:30
      374000 -- [-2544.825] (-2542.719) (-2541.312) (-2548.119) * [-2543.922] (-2542.655) (-2545.538) (-2547.198) -- 0:01:32
      374500 -- [-2541.490] (-2544.848) (-2545.670) (-2542.237) * (-2548.527) (-2544.888) [-2543.493] (-2537.503) -- 0:01:31
      375000 -- (-2542.199) (-2547.716) [-2540.794] (-2542.065) * (-2540.870) (-2544.450) (-2549.135) [-2540.768] -- 0:01:31

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-2541.892) (-2542.172) [-2543.026] (-2540.649) * [-2542.369] (-2537.822) (-2547.414) (-2542.516) -- 0:01:31
      376000 -- (-2544.949) [-2549.558] (-2542.935) (-2541.337) * (-2543.086) (-2542.556) (-2539.445) [-2544.356] -- 0:01:31
      376500 -- (-2539.051) (-2547.886) [-2538.109] (-2543.889) * (-2546.162) (-2543.767) [-2545.781] (-2544.799) -- 0:01:31
      377000 -- (-2544.086) (-2548.623) (-2545.736) [-2542.012] * (-2540.168) (-2545.638) (-2537.701) [-2542.703] -- 0:01:30
      377500 -- (-2543.645) [-2541.233] (-2539.968) (-2541.849) * (-2542.414) [-2541.476] (-2539.305) (-2546.483) -- 0:01:30
      378000 -- (-2540.951) [-2540.152] (-2542.755) (-2541.030) * [-2544.575] (-2547.535) (-2540.560) (-2545.044) -- 0:01:30
      378500 -- (-2539.362) (-2539.213) (-2542.358) [-2537.086] * (-2538.437) [-2552.992] (-2544.860) (-2553.287) -- 0:01:30
      379000 -- (-2540.635) (-2546.056) (-2545.301) [-2538.064] * (-2548.423) (-2542.274) (-2547.630) [-2545.533] -- 0:01:30
      379500 -- (-2546.175) (-2543.288) [-2541.456] (-2538.593) * (-2547.890) (-2543.519) (-2547.782) [-2544.810] -- 0:01:29
      380000 -- (-2541.422) (-2545.589) (-2543.309) [-2548.647] * (-2554.560) (-2545.699) (-2544.067) [-2542.100] -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      380500 -- (-2540.371) [-2540.883] (-2546.116) (-2541.011) * (-2549.061) (-2548.392) (-2548.764) [-2542.843] -- 0:01:29
      381000 -- [-2542.210] (-2541.210) (-2543.281) (-2548.329) * [-2543.434] (-2549.624) (-2547.955) (-2554.595) -- 0:01:30
      381500 -- [-2543.212] (-2537.693) (-2541.629) (-2544.089) * (-2546.528) (-2553.429) [-2546.024] (-2541.297) -- 0:01:30
      382000 -- (-2550.273) (-2548.063) [-2543.210] (-2538.730) * [-2541.062] (-2539.944) (-2545.935) (-2539.477) -- 0:01:30
      382500 -- [-2541.280] (-2549.079) (-2542.313) (-2544.313) * (-2543.511) (-2542.385) [-2543.673] (-2543.126) -- 0:01:30
      383000 -- [-2540.553] (-2548.241) (-2543.052) (-2540.737) * [-2548.790] (-2542.140) (-2546.745) (-2541.323) -- 0:01:30
      383500 -- (-2538.713) (-2542.561) [-2547.577] (-2542.349) * (-2541.171) (-2537.568) (-2547.360) [-2541.515] -- 0:01:30
      384000 -- [-2543.903] (-2546.936) (-2547.261) (-2542.303) * [-2545.117] (-2545.979) (-2542.404) (-2542.175) -- 0:01:29
      384500 -- [-2541.072] (-2545.289) (-2543.438) (-2539.001) * (-2537.155) (-2543.061) [-2539.790] (-2546.590) -- 0:01:29
      385000 -- (-2543.544) [-2541.489] (-2541.855) (-2544.943) * (-2549.161) [-2544.277] (-2547.060) (-2542.308) -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      385500 -- (-2542.490) (-2541.963) (-2546.623) [-2545.505] * (-2540.459) [-2546.727] (-2551.141) (-2545.851) -- 0:01:29
      386000 -- (-2544.531) (-2545.593) (-2542.533) [-2544.958] * (-2543.554) (-2540.999) (-2541.270) [-2545.700] -- 0:01:29
      386500 -- (-2555.689) (-2541.939) [-2541.545] (-2544.908) * (-2540.561) (-2550.805) (-2544.854) [-2550.097] -- 0:01:28
      387000 -- (-2553.259) [-2548.781] (-2539.956) (-2549.594) * (-2535.908) [-2542.784] (-2539.906) (-2545.479) -- 0:01:28
      387500 -- (-2543.061) (-2543.286) (-2545.264) [-2544.788] * [-2541.915] (-2540.844) (-2539.981) (-2543.561) -- 0:01:28
      388000 -- (-2542.621) (-2543.345) (-2542.834) [-2540.550] * (-2552.782) (-2540.541) (-2544.608) [-2539.638] -- 0:01:29
      388500 -- (-2540.529) (-2538.021) [-2545.286] (-2541.628) * (-2544.561) (-2540.429) (-2545.118) [-2538.553] -- 0:01:29
      389000 -- (-2547.845) (-2543.313) [-2538.220] (-2542.159) * (-2548.480) [-2542.374] (-2545.319) (-2545.609) -- 0:01:29
      389500 -- (-2541.506) (-2538.857) [-2540.842] (-2546.227) * (-2542.122) (-2547.359) [-2538.589] (-2543.204) -- 0:01:29
      390000 -- (-2545.095) (-2544.594) [-2538.940] (-2543.308) * (-2545.916) (-2542.607) (-2546.517) [-2543.572] -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      390500 -- (-2537.807) (-2543.855) [-2542.640] (-2547.295) * (-2545.190) (-2542.644) [-2545.970] (-2541.566) -- 0:01:28
      391000 -- [-2540.325] (-2540.838) (-2538.412) (-2554.365) * (-2544.546) (-2543.583) [-2539.253] (-2544.896) -- 0:01:28
      391500 -- [-2544.040] (-2543.953) (-2544.854) (-2551.125) * (-2545.092) [-2543.578] (-2538.141) (-2547.030) -- 0:01:28
      392000 -- (-2541.110) [-2539.698] (-2543.274) (-2548.475) * (-2546.283) (-2544.705) [-2550.297] (-2540.170) -- 0:01:28
      392500 -- (-2541.881) (-2542.532) (-2548.401) [-2538.641] * (-2543.927) [-2545.289] (-2551.084) (-2548.973) -- 0:01:28
      393000 -- (-2545.375) (-2543.185) [-2538.515] (-2546.982) * (-2546.142) (-2547.490) [-2539.388] (-2551.640) -- 0:01:28
      393500 -- (-2543.655) [-2537.994] (-2543.414) (-2541.933) * (-2543.618) [-2545.249] (-2542.912) (-2545.921) -- 0:01:27
      394000 -- (-2545.739) (-2542.242) (-2545.521) [-2539.436] * (-2542.062) [-2550.809] (-2540.317) (-2545.550) -- 0:01:27
      394500 -- (-2544.994) (-2537.592) [-2543.544] (-2537.525) * (-2542.549) (-2547.509) (-2541.613) [-2538.771] -- 0:01:29
      395000 -- (-2542.130) (-2542.922) [-2541.394] (-2547.274) * (-2538.854) (-2541.663) [-2539.604] (-2542.996) -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-2542.577) (-2545.354) (-2544.444) [-2539.209] * [-2539.817] (-2542.548) (-2537.103) (-2542.399) -- 0:01:28
      396000 -- (-2547.662) (-2542.492) [-2539.557] (-2539.336) * (-2538.382) [-2542.790] (-2548.529) (-2547.916) -- 0:01:28
      396500 -- (-2544.307) (-2542.710) [-2540.334] (-2543.335) * (-2540.726) [-2541.363] (-2543.279) (-2548.224) -- 0:01:28
      397000 -- (-2544.470) (-2538.155) (-2542.479) [-2538.573] * (-2540.050) [-2541.335] (-2547.202) (-2545.370) -- 0:01:28
      397500 -- (-2543.532) (-2546.797) (-2541.013) [-2536.707] * (-2541.366) [-2541.261] (-2543.189) (-2539.482) -- 0:01:27
      398000 -- (-2543.051) (-2554.797) [-2544.154] (-2547.390) * (-2546.162) (-2543.709) [-2537.638] (-2543.498) -- 0:01:27
      398500 -- (-2548.087) (-2545.131) [-2539.918] (-2541.854) * [-2543.306] (-2547.489) (-2539.585) (-2549.214) -- 0:01:27
      399000 -- (-2548.521) [-2539.769] (-2545.335) (-2539.387) * [-2542.430] (-2540.528) (-2540.109) (-2543.137) -- 0:01:27
      399500 -- (-2541.321) (-2538.403) (-2545.228) [-2540.777] * (-2544.655) (-2538.990) [-2541.398] (-2541.012) -- 0:01:27
      400000 -- (-2544.872) [-2540.092] (-2547.569) (-2546.967) * (-2540.165) (-2548.209) [-2541.013] (-2552.755) -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      400500 -- [-2546.505] (-2549.237) (-2544.767) (-2543.946) * (-2541.670) [-2541.240] (-2541.855) (-2549.134) -- 0:01:26
      401000 -- (-2547.111) (-2541.891) [-2545.081] (-2547.025) * (-2540.071) (-2543.138) (-2542.614) [-2542.952] -- 0:01:26
      401500 -- (-2549.695) [-2543.699] (-2543.169) (-2548.343) * (-2541.014) (-2547.335) [-2542.155] (-2541.749) -- 0:01:27
      402000 -- (-2547.918) [-2542.354] (-2549.044) (-2540.103) * [-2547.718] (-2546.419) (-2551.052) (-2540.023) -- 0:01:27
      402500 -- (-2548.497) (-2540.108) [-2544.455] (-2544.042) * (-2547.563) (-2546.880) (-2546.514) [-2538.997] -- 0:01:27
      403000 -- (-2549.299) [-2542.853] (-2556.004) (-2543.942) * (-2537.059) [-2540.313] (-2542.629) (-2539.472) -- 0:01:27
      403500 -- (-2545.918) (-2544.468) (-2545.510) [-2537.758] * [-2538.987] (-2543.582) (-2552.785) (-2539.616) -- 0:01:27
      404000 -- (-2545.596) (-2540.683) (-2541.406) [-2538.260] * [-2543.838] (-2537.597) (-2549.563) (-2538.067) -- 0:01:27
      404500 -- (-2544.093) (-2544.460) (-2541.549) [-2542.447] * (-2543.619) [-2539.533] (-2549.649) (-2550.307) -- 0:01:26
      405000 -- (-2545.119) (-2545.107) [-2537.464] (-2540.941) * [-2543.184] (-2536.248) (-2542.488) (-2540.500) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-2542.209) (-2540.722) [-2542.613] (-2539.920) * (-2542.820) [-2539.271] (-2541.827) (-2546.314) -- 0:01:26
      406000 -- (-2552.083) (-2540.401) [-2540.423] (-2543.950) * (-2540.265) [-2539.710] (-2536.647) (-2550.019) -- 0:01:26
      406500 -- (-2540.808) [-2538.492] (-2543.541) (-2541.286) * (-2550.611) (-2544.055) [-2541.808] (-2549.196) -- 0:01:26
      407000 -- [-2547.436] (-2539.357) (-2537.478) (-2541.443) * (-2544.451) [-2542.922] (-2540.761) (-2548.485) -- 0:01:25
      407500 -- (-2542.458) (-2541.620) (-2539.468) [-2543.616] * [-2541.989] (-2541.228) (-2545.847) (-2541.788) -- 0:01:25
      408000 -- [-2537.557] (-2540.178) (-2553.582) (-2539.659) * (-2541.498) (-2537.787) [-2540.593] (-2542.236) -- 0:01:25
      408500 -- (-2540.100) [-2539.349] (-2541.712) (-2543.982) * (-2545.327) (-2543.967) (-2549.469) [-2542.852] -- 0:01:26
      409000 -- (-2539.286) (-2539.373) [-2538.597] (-2541.490) * (-2542.580) (-2539.936) (-2540.492) [-2542.189] -- 0:01:26
      409500 -- (-2538.972) (-2544.644) (-2542.922) [-2544.030] * (-2545.106) (-2542.360) [-2546.309] (-2544.537) -- 0:01:26
      410000 -- [-2544.969] (-2543.536) (-2543.617) (-2543.282) * (-2537.333) [-2540.011] (-2540.640) (-2545.720) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-2541.424) [-2543.434] (-2549.079) (-2537.304) * (-2538.254) (-2536.740) [-2537.377] (-2541.091) -- 0:01:26
      411000 -- [-2542.316] (-2542.011) (-2541.485) (-2545.390) * (-2554.999) (-2545.385) (-2541.834) [-2543.591] -- 0:01:25
      411500 -- (-2542.158) [-2539.617] (-2541.832) (-2545.110) * [-2541.613] (-2543.693) (-2545.527) (-2542.428) -- 0:01:25
      412000 -- (-2542.332) (-2540.858) (-2545.092) [-2544.316] * [-2539.844] (-2547.831) (-2544.761) (-2546.016) -- 0:01:25
      412500 -- (-2541.212) (-2543.695) [-2539.360] (-2547.074) * (-2544.246) [-2540.166] (-2548.054) (-2541.826) -- 0:01:25
      413000 -- (-2538.970) [-2543.921] (-2543.269) (-2541.533) * (-2551.565) [-2538.717] (-2540.759) (-2545.759) -- 0:01:25
      413500 -- [-2544.271] (-2542.552) (-2551.917) (-2547.988) * (-2541.082) (-2545.180) [-2545.036] (-2543.093) -- 0:01:25
      414000 -- (-2550.401) (-2547.863) [-2545.578] (-2546.754) * (-2541.668) (-2547.023) [-2539.854] (-2546.132) -- 0:01:24
      414500 -- (-2548.563) (-2544.130) (-2558.479) [-2538.533] * (-2539.738) (-2545.208) (-2539.895) [-2538.702] -- 0:01:24
      415000 -- (-2547.548) (-2538.070) (-2547.478) [-2541.598] * [-2540.362] (-2554.348) (-2541.707) (-2542.170) -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      415500 -- (-2543.793) (-2543.512) [-2544.657] (-2544.703) * (-2550.428) (-2542.319) (-2542.362) [-2543.093] -- 0:01:25
      416000 -- (-2545.337) (-2544.550) [-2545.771] (-2543.793) * (-2547.390) (-2550.716) (-2541.701) [-2538.316] -- 0:01:25
      416500 -- (-2542.433) [-2541.596] (-2550.093) (-2547.002) * (-2555.915) (-2540.897) (-2546.893) [-2544.223] -- 0:01:25
      417000 -- (-2544.888) (-2544.129) (-2549.885) [-2540.877] * (-2541.904) (-2545.817) [-2543.641] (-2540.089) -- 0:01:25
      417500 -- [-2547.564] (-2540.907) (-2544.948) (-2539.999) * (-2543.200) (-2540.817) (-2547.331) [-2541.707] -- 0:01:25
      418000 -- (-2543.831) [-2539.096] (-2547.662) (-2543.949) * (-2545.346) (-2539.297) (-2540.625) [-2542.423] -- 0:01:24
      418500 -- (-2539.678) (-2547.253) [-2544.405] (-2541.146) * [-2539.259] (-2543.588) (-2547.116) (-2545.161) -- 0:01:24
      419000 -- (-2541.816) (-2542.688) [-2542.332] (-2541.887) * [-2539.855] (-2543.801) (-2543.771) (-2544.298) -- 0:01:24
      419500 -- (-2542.261) [-2541.863] (-2539.342) (-2543.154) * (-2538.689) (-2550.951) (-2547.530) [-2542.293] -- 0:01:24
      420000 -- (-2544.333) (-2540.922) (-2542.908) [-2541.351] * (-2539.042) (-2539.729) [-2542.316] (-2545.219) -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-2542.075) (-2550.268) (-2547.265) [-2542.809] * [-2538.724] (-2544.717) (-2541.857) (-2545.182) -- 0:01:24
      421000 -- (-2546.863) [-2545.604] (-2543.768) (-2542.693) * (-2540.301) (-2545.417) (-2543.359) [-2541.857] -- 0:01:23
      421500 -- (-2540.629) (-2546.075) [-2547.529] (-2542.347) * (-2543.625) (-2545.690) (-2540.680) [-2545.635] -- 0:01:23
      422000 -- (-2547.551) [-2542.939] (-2543.421) (-2539.672) * [-2543.729] (-2545.366) (-2542.960) (-2548.560) -- 0:01:24
      422500 -- [-2539.815] (-2539.025) (-2546.500) (-2544.079) * (-2546.308) (-2544.865) (-2550.386) [-2544.018] -- 0:01:24
      423000 -- (-2538.979) [-2538.434] (-2543.676) (-2541.306) * (-2543.601) (-2545.992) (-2543.649) [-2545.666] -- 0:01:24
      423500 -- [-2538.501] (-2542.399) (-2545.399) (-2549.022) * [-2544.510] (-2540.821) (-2544.191) (-2541.940) -- 0:01:24
      424000 -- [-2539.460] (-2544.670) (-2547.663) (-2547.211) * (-2541.254) (-2545.277) [-2540.621] (-2542.505) -- 0:01:24
      424500 -- (-2538.020) (-2541.441) [-2544.542] (-2546.331) * [-2537.920] (-2546.399) (-2542.765) (-2544.473) -- 0:01:24
      425000 -- [-2540.329] (-2543.540) (-2542.149) (-2538.369) * (-2547.023) [-2543.556] (-2541.912) (-2543.303) -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      425500 -- (-2547.411) [-2541.085] (-2544.216) (-2547.359) * (-2542.960) (-2547.357) (-2538.889) [-2541.423] -- 0:01:23
      426000 -- (-2548.345) (-2542.146) (-2554.621) [-2541.334] * [-2542.785] (-2547.634) (-2543.097) (-2546.024) -- 0:01:23
      426500 -- (-2553.820) [-2541.937] (-2546.109) (-2544.104) * (-2545.251) (-2544.963) [-2544.129] (-2546.148) -- 0:01:23
      427000 -- (-2543.303) [-2543.959] (-2545.917) (-2544.765) * (-2545.180) (-2543.446) [-2539.196] (-2544.169) -- 0:01:23
      427500 -- (-2551.191) [-2543.528] (-2539.955) (-2545.864) * (-2541.460) [-2540.619] (-2540.442) (-2542.235) -- 0:01:23
      428000 -- (-2546.560) (-2543.959) [-2542.551] (-2545.045) * [-2539.627] (-2542.815) (-2541.515) (-2551.685) -- 0:01:22
      428500 -- (-2549.783) (-2541.973) (-2544.820) [-2545.694] * (-2544.953) (-2542.043) [-2541.853] (-2550.914) -- 0:01:22
      429000 -- (-2548.253) (-2545.632) [-2539.313] (-2542.138) * (-2548.138) [-2543.327] (-2541.725) (-2544.887) -- 0:01:23
      429500 -- [-2541.262] (-2542.901) (-2541.636) (-2545.643) * (-2549.553) (-2545.165) [-2548.832] (-2547.734) -- 0:01:23
      430000 -- (-2545.604) (-2543.085) [-2538.573] (-2548.438) * (-2541.951) [-2538.938] (-2545.440) (-2541.010) -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      430500 -- (-2541.188) (-2546.101) (-2544.874) [-2545.216] * [-2544.028] (-2543.312) (-2543.787) (-2542.722) -- 0:01:23
      431000 -- (-2539.121) (-2544.802) (-2545.406) [-2540.416] * (-2536.089) (-2543.596) (-2541.296) [-2542.957] -- 0:01:23
      431500 -- (-2541.153) (-2549.288) (-2541.501) [-2540.574] * (-2539.330) (-2539.637) [-2542.080] (-2542.600) -- 0:01:23
      432000 -- (-2544.588) (-2540.530) [-2541.921] (-2542.141) * (-2542.991) [-2541.898] (-2549.200) (-2548.814) -- 0:01:22
      432500 -- [-2543.921] (-2547.212) (-2547.158) (-2548.998) * (-2542.337) (-2540.038) [-2545.642] (-2545.730) -- 0:01:22
      433000 -- [-2540.462] (-2541.386) (-2539.828) (-2552.509) * (-2545.859) (-2537.959) [-2542.363] (-2548.949) -- 0:01:22
      433500 -- (-2542.228) (-2550.017) [-2547.271] (-2544.402) * (-2546.397) (-2536.621) (-2544.581) [-2541.862] -- 0:01:22
      434000 -- (-2541.577) (-2547.596) [-2550.067] (-2539.631) * (-2545.424) (-2544.344) (-2543.011) [-2545.527] -- 0:01:22
      434500 -- (-2541.196) (-2543.968) [-2543.165] (-2541.682) * [-2541.474] (-2543.012) (-2542.050) (-2551.317) -- 0:01:21
      435000 -- [-2539.974] (-2542.592) (-2541.200) (-2544.941) * (-2545.468) [-2543.882] (-2539.069) (-2541.494) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-2538.695) [-2539.468] (-2542.779) (-2543.119) * (-2543.119) (-2543.013) (-2542.017) [-2543.020] -- 0:01:21
      436000 -- (-2546.806) (-2548.351) [-2545.333] (-2548.572) * (-2545.936) [-2544.220] (-2544.036) (-2541.844) -- 0:01:22
      436500 -- (-2545.184) (-2542.496) [-2543.920] (-2545.440) * [-2544.308] (-2547.393) (-2541.355) (-2540.474) -- 0:01:22
      437000 -- [-2542.982] (-2546.570) (-2539.256) (-2540.572) * [-2542.854] (-2544.757) (-2540.505) (-2545.540) -- 0:01:22
      437500 -- [-2541.970] (-2540.349) (-2546.394) (-2553.821) * (-2548.322) (-2545.130) (-2539.976) [-2542.169] -- 0:01:22
      438000 -- [-2540.759] (-2543.399) (-2543.619) (-2546.466) * (-2539.514) [-2540.029] (-2547.321) (-2539.438) -- 0:01:22
      438500 -- (-2546.361) [-2546.705] (-2546.266) (-2544.355) * (-2540.914) (-2544.150) (-2544.469) [-2545.760] -- 0:01:21
      439000 -- [-2538.952] (-2542.175) (-2541.448) (-2546.308) * (-2543.914) (-2544.284) (-2545.954) [-2545.801] -- 0:01:21
      439500 -- (-2537.689) [-2537.485] (-2541.897) (-2547.943) * (-2548.392) [-2544.798] (-2549.328) (-2544.934) -- 0:01:21
      440000 -- (-2538.280) [-2544.768] (-2541.961) (-2543.016) * (-2541.383) (-2547.352) [-2540.686] (-2545.783) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      440500 -- [-2540.284] (-2546.599) (-2541.845) (-2541.902) * (-2540.051) (-2540.695) [-2542.877] (-2541.980) -- 0:01:21
      441000 -- (-2541.853) (-2547.933) [-2539.495] (-2545.634) * [-2544.114] (-2542.181) (-2548.419) (-2543.796) -- 0:01:21
      441500 -- (-2549.991) [-2544.760] (-2542.495) (-2541.876) * [-2539.099] (-2545.467) (-2548.441) (-2549.627) -- 0:01:20
      442000 -- (-2548.885) [-2542.062] (-2541.961) (-2540.211) * (-2540.554) [-2540.809] (-2540.553) (-2544.879) -- 0:01:20
      442500 -- (-2547.869) (-2548.170) (-2540.041) [-2541.340] * (-2543.329) [-2539.033] (-2543.602) (-2546.323) -- 0:01:21
      443000 -- (-2545.628) (-2545.507) [-2542.429] (-2543.497) * (-2548.292) (-2551.591) (-2541.206) [-2541.459] -- 0:01:21
      443500 -- (-2541.375) (-2540.824) (-2540.849) [-2536.617] * (-2541.583) [-2540.103] (-2543.504) (-2551.523) -- 0:01:21
      444000 -- (-2543.181) [-2547.127] (-2544.196) (-2545.964) * (-2545.303) (-2537.835) (-2541.596) [-2538.727] -- 0:01:21
      444500 -- (-2542.743) (-2540.243) [-2539.792] (-2542.563) * (-2545.075) [-2545.519] (-2536.428) (-2542.862) -- 0:01:21
      445000 -- (-2543.096) (-2539.749) (-2548.880) [-2547.072] * [-2542.513] (-2544.657) (-2541.840) (-2544.238) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-2548.000) (-2547.504) (-2544.801) [-2542.673] * (-2540.299) (-2544.209) [-2545.772] (-2545.458) -- 0:01:20
      446000 -- (-2548.305) (-2544.486) [-2542.808] (-2544.588) * (-2538.126) (-2544.137) (-2545.882) [-2539.036] -- 0:01:20
      446500 -- [-2543.055] (-2546.558) (-2543.522) (-2549.754) * (-2544.222) [-2542.274] (-2541.158) (-2542.167) -- 0:01:20
      447000 -- [-2539.539] (-2543.194) (-2545.053) (-2543.500) * (-2542.122) (-2541.724) [-2545.558] (-2542.964) -- 0:01:20
      447500 -- (-2543.790) [-2549.892] (-2547.704) (-2539.441) * [-2549.189] (-2544.138) (-2543.313) (-2542.905) -- 0:01:20
      448000 -- (-2538.959) (-2547.564) [-2543.247] (-2540.226) * (-2541.748) (-2549.414) (-2546.724) [-2543.794] -- 0:01:20
      448500 -- (-2539.086) (-2547.348) [-2541.433] (-2540.268) * (-2549.722) [-2543.453] (-2546.547) (-2553.632) -- 0:01:19
      449000 -- (-2544.754) (-2555.103) [-2540.931] (-2539.858) * (-2544.106) (-2541.574) (-2537.319) [-2542.013] -- 0:01:19
      449500 -- (-2542.892) (-2553.052) (-2545.267) [-2538.726] * (-2546.482) (-2539.776) [-2538.477] (-2544.859) -- 0:01:20
      450000 -- (-2548.832) (-2552.268) [-2538.190] (-2542.311) * (-2546.850) [-2538.839] (-2545.703) (-2546.469) -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-2544.852) (-2548.536) [-2539.489] (-2545.279) * (-2550.626) (-2541.068) [-2547.545] (-2545.341) -- 0:01:20
      451000 -- [-2543.490] (-2542.271) (-2541.146) (-2540.523) * (-2548.186) [-2545.333] (-2545.369) (-2545.788) -- 0:01:20
      451500 -- [-2541.763] (-2554.030) (-2540.299) (-2540.857) * (-2547.737) (-2539.174) (-2545.292) [-2542.751] -- 0:01:20
      452000 -- (-2544.083) (-2547.626) [-2537.409] (-2543.395) * (-2544.081) [-2543.542] (-2541.066) (-2544.284) -- 0:01:20
      452500 -- (-2547.476) (-2551.929) (-2545.459) [-2542.939] * [-2540.996] (-2544.629) (-2540.366) (-2542.075) -- 0:01:19
      453000 -- (-2544.042) (-2543.522) (-2543.307) [-2543.361] * (-2551.317) (-2543.332) (-2537.084) [-2542.480] -- 0:01:19
      453500 -- (-2551.884) (-2547.250) [-2538.455] (-2540.191) * (-2542.805) [-2545.984] (-2548.052) (-2545.920) -- 0:01:19
      454000 -- (-2549.429) (-2542.326) [-2541.635] (-2535.541) * (-2545.269) [-2538.024] (-2541.384) (-2542.678) -- 0:01:19
      454500 -- (-2545.642) (-2543.374) [-2542.692] (-2540.113) * (-2541.604) (-2550.138) [-2539.641] (-2540.100) -- 0:01:19
      455000 -- [-2546.257] (-2546.926) (-2543.605) (-2546.340) * (-2542.866) (-2544.958) [-2540.385] (-2544.960) -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      455500 -- (-2543.392) [-2538.157] (-2538.863) (-2545.062) * (-2539.514) (-2548.031) [-2541.090] (-2544.630) -- 0:01:18
      456000 -- [-2541.079] (-2543.673) (-2538.778) (-2548.235) * [-2540.203] (-2542.413) (-2542.463) (-2546.506) -- 0:01:18
      456500 -- (-2542.722) (-2547.866) (-2539.306) [-2542.716] * (-2544.434) (-2541.891) [-2538.053] (-2548.948) -- 0:01:19
      457000 -- (-2541.110) (-2540.338) [-2543.321] (-2542.304) * (-2545.297) [-2550.585] (-2545.116) (-2541.469) -- 0:01:19
      457500 -- (-2538.735) (-2550.836) [-2547.267] (-2545.155) * (-2545.705) (-2550.981) (-2554.856) [-2546.822] -- 0:01:19
      458000 -- (-2542.208) [-2553.129] (-2544.564) (-2542.706) * (-2544.655) (-2543.738) [-2539.430] (-2543.075) -- 0:01:19
      458500 -- (-2548.736) (-2546.607) (-2541.125) [-2542.777] * (-2544.799) (-2544.728) [-2542.515] (-2539.119) -- 0:01:19
      459000 -- (-2541.947) (-2547.943) (-2538.546) [-2545.682] * (-2539.365) (-2542.152) (-2544.845) [-2542.020] -- 0:01:18
      459500 -- [-2543.799] (-2544.207) (-2548.336) (-2542.664) * (-2543.677) (-2546.674) [-2540.609] (-2540.456) -- 0:01:18
      460000 -- (-2548.424) (-2543.428) (-2549.036) [-2540.617] * (-2540.236) (-2544.663) [-2537.671] (-2550.902) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      460500 -- (-2542.829) (-2547.768) [-2541.300] (-2540.125) * [-2538.451] (-2543.853) (-2544.233) (-2561.462) -- 0:01:18
      461000 -- (-2540.965) (-2548.144) [-2544.863] (-2542.546) * [-2537.566] (-2541.341) (-2542.490) (-2542.925) -- 0:01:18
      461500 -- (-2544.564) (-2544.350) (-2551.881) [-2543.510] * (-2546.154) [-2546.273] (-2539.330) (-2543.467) -- 0:01:18
      462000 -- (-2540.424) [-2542.860] (-2549.701) (-2544.220) * (-2544.309) [-2544.719] (-2543.557) (-2543.952) -- 0:01:18
      462500 -- (-2539.494) (-2547.588) [-2535.848] (-2542.867) * [-2540.856] (-2543.666) (-2546.189) (-2540.333) -- 0:01:17
      463000 -- (-2546.369) (-2554.658) (-2540.780) [-2541.346] * (-2540.576) (-2539.347) (-2538.468) [-2539.792] -- 0:01:17
      463500 -- (-2548.548) (-2547.607) [-2544.512] (-2542.096) * (-2551.117) (-2539.190) (-2543.722) [-2545.191] -- 0:01:18
      464000 -- (-2551.880) [-2540.089] (-2540.318) (-2544.464) * (-2546.194) [-2538.103] (-2547.871) (-2539.159) -- 0:01:18
      464500 -- (-2541.555) (-2546.066) (-2546.162) [-2541.374] * [-2546.583] (-2545.584) (-2549.304) (-2543.718) -- 0:01:18
      465000 -- [-2541.373] (-2545.683) (-2544.028) (-2541.944) * (-2541.947) [-2545.987] (-2541.501) (-2546.640) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-2542.352) (-2545.596) [-2546.895] (-2542.209) * (-2542.868) [-2549.182] (-2545.141) (-2538.467) -- 0:01:18
      466000 -- [-2539.440] (-2544.769) (-2544.418) (-2544.898) * (-2539.578) (-2543.154) [-2538.572] (-2542.701) -- 0:01:17
      466500 -- (-2542.943) [-2542.583] (-2549.684) (-2548.344) * [-2539.784] (-2545.176) (-2542.015) (-2548.899) -- 0:01:17
      467000 -- (-2541.091) (-2542.864) (-2546.648) [-2545.957] * [-2544.115] (-2540.949) (-2546.700) (-2546.982) -- 0:01:17
      467500 -- [-2542.476] (-2543.119) (-2540.646) (-2545.191) * (-2544.428) [-2544.398] (-2546.468) (-2539.210) -- 0:01:17
      468000 -- (-2538.760) (-2538.762) (-2540.903) [-2543.072] * (-2537.717) [-2540.082] (-2540.513) (-2538.923) -- 0:01:17
      468500 -- (-2544.438) (-2540.817) (-2543.181) [-2541.829] * (-2545.256) (-2544.335) (-2542.314) [-2544.849] -- 0:01:17
      469000 -- (-2544.043) [-2539.336] (-2542.355) (-2540.759) * [-2547.387] (-2544.555) (-2544.102) (-2544.957) -- 0:01:16
      469500 -- (-2542.223) [-2540.276] (-2543.494) (-2547.800) * (-2541.978) (-2545.493) (-2545.393) [-2540.110] -- 0:01:16
      470000 -- (-2541.557) [-2539.804] (-2541.306) (-2542.729) * (-2543.497) [-2548.417] (-2547.070) (-2544.670) -- 0:01:17

      Average standard deviation of split frequencies: 0.000000

      470500 -- [-2547.079] (-2543.615) (-2544.640) (-2541.438) * [-2541.052] (-2543.846) (-2540.850) (-2546.455) -- 0:01:17
      471000 -- (-2544.948) [-2540.844] (-2549.548) (-2541.454) * (-2543.090) [-2542.793] (-2553.797) (-2541.182) -- 0:01:17
      471500 -- (-2539.939) (-2542.832) [-2543.891] (-2545.705) * [-2541.168] (-2541.402) (-2543.762) (-2546.475) -- 0:01:17
      472000 -- [-2543.089] (-2549.853) (-2540.329) (-2543.039) * (-2544.938) (-2541.153) [-2541.713] (-2547.569) -- 0:01:17
      472500 -- (-2542.921) (-2544.351) (-2546.938) [-2546.751] * (-2542.703) (-2547.199) [-2541.411] (-2548.568) -- 0:01:17
      473000 -- (-2538.937) (-2546.720) (-2544.535) [-2533.548] * [-2541.394] (-2541.854) (-2547.715) (-2547.595) -- 0:01:16
      473500 -- (-2544.565) (-2542.388) (-2543.783) [-2542.913] * (-2550.159) [-2545.994] (-2541.336) (-2544.669) -- 0:01:16
      474000 -- (-2540.659) (-2538.048) (-2543.181) [-2541.513] * [-2550.261] (-2543.447) (-2543.922) (-2545.435) -- 0:01:16
      474500 -- (-2542.030) [-2537.363] (-2542.853) (-2542.017) * (-2548.643) [-2545.630] (-2544.844) (-2549.167) -- 0:01:16
      475000 -- (-2544.719) [-2541.215] (-2551.086) (-2546.916) * [-2548.007] (-2541.901) (-2549.101) (-2542.926) -- 0:01:16

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-2542.041) (-2541.295) [-2544.850] (-2540.760) * (-2545.223) [-2547.139] (-2542.119) (-2546.403) -- 0:01:16
      476000 -- (-2545.058) (-2545.402) [-2542.876] (-2542.372) * (-2546.913) (-2552.963) [-2539.577] (-2542.993) -- 0:01:15
      476500 -- [-2547.743] (-2555.376) (-2536.598) (-2545.492) * (-2545.851) (-2552.711) [-2540.275] (-2542.591) -- 0:01:15
      477000 -- [-2543.259] (-2542.300) (-2542.877) (-2539.266) * (-2555.412) (-2548.509) [-2546.389] (-2544.346) -- 0:01:16
      477500 -- (-2546.035) (-2540.065) [-2540.349] (-2541.795) * (-2549.166) (-2548.477) [-2549.147] (-2544.170) -- 0:01:16
      478000 -- [-2545.496] (-2539.459) (-2544.767) (-2542.142) * [-2542.066] (-2548.785) (-2551.878) (-2543.707) -- 0:01:16
      478500 -- (-2552.864) [-2543.666] (-2543.113) (-2541.939) * (-2548.966) (-2547.989) [-2539.003] (-2543.880) -- 0:01:16
      479000 -- [-2544.273] (-2545.734) (-2546.253) (-2544.778) * [-2544.090] (-2542.754) (-2541.445) (-2544.664) -- 0:01:16
      479500 -- (-2541.441) [-2545.996] (-2548.887) (-2538.223) * (-2551.260) [-2539.645] (-2546.403) (-2547.541) -- 0:01:15
      480000 -- (-2543.455) (-2539.091) (-2546.462) [-2546.063] * (-2541.399) (-2541.258) (-2547.162) [-2535.814] -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-2543.497) [-2543.071] (-2551.042) (-2538.829) * (-2547.607) [-2546.851] (-2553.743) (-2543.823) -- 0:01:15
      481000 -- (-2547.297) (-2548.023) (-2541.327) [-2542.267] * (-2552.159) (-2544.393) [-2552.567] (-2542.183) -- 0:01:15
      481500 -- (-2547.689) [-2545.996] (-2541.932) (-2541.694) * [-2545.241] (-2539.087) (-2556.864) (-2543.936) -- 0:01:15
      482000 -- (-2547.140) [-2542.533] (-2544.491) (-2544.808) * [-2543.653] (-2542.857) (-2552.122) (-2545.649) -- 0:01:15
      482500 -- (-2549.477) [-2541.938] (-2548.908) (-2545.300) * [-2541.731] (-2540.442) (-2547.104) (-2543.865) -- 0:01:15
      483000 -- (-2548.293) [-2546.900] (-2545.836) (-2539.474) * (-2538.772) (-2548.188) [-2542.304] (-2543.679) -- 0:01:14
      483500 -- (-2552.107) (-2547.267) (-2541.072) [-2538.967] * (-2543.272) (-2548.707) [-2543.499] (-2542.999) -- 0:01:14
      484000 -- (-2544.932) (-2540.657) (-2544.581) [-2540.819] * (-2545.413) (-2550.116) [-2541.644] (-2544.161) -- 0:01:15
      484500 -- (-2542.915) [-2541.017] (-2553.069) (-2544.416) * (-2546.159) [-2545.304] (-2543.663) (-2544.587) -- 0:01:15
      485000 -- (-2544.723) (-2547.086) [-2545.494] (-2544.041) * (-2543.831) (-2546.436) [-2544.934] (-2545.735) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      485500 -- (-2546.527) (-2540.162) [-2546.258] (-2548.784) * (-2542.931) (-2547.037) [-2539.929] (-2554.131) -- 0:01:15
      486000 -- [-2542.906] (-2548.776) (-2548.271) (-2547.664) * (-2545.530) (-2548.164) (-2539.370) [-2544.308] -- 0:01:15
      486500 -- (-2546.043) (-2549.829) [-2544.573] (-2551.284) * (-2545.301) [-2549.186] (-2540.824) (-2544.395) -- 0:01:14
      487000 -- (-2539.812) (-2541.447) [-2544.198] (-2539.930) * (-2545.937) (-2553.875) (-2546.272) [-2540.338] -- 0:01:14
      487500 -- (-2544.688) [-2542.370] (-2541.235) (-2543.906) * (-2546.343) (-2549.356) [-2546.847] (-2543.463) -- 0:01:14
      488000 -- (-2543.279) (-2541.907) (-2545.961) [-2544.544] * (-2541.097) [-2547.179] (-2551.854) (-2544.179) -- 0:01:14
      488500 -- [-2544.634] (-2539.283) (-2543.896) (-2539.731) * (-2540.128) (-2544.192) (-2543.100) [-2541.351] -- 0:01:14
      489000 -- (-2540.443) (-2539.649) (-2545.119) [-2543.140] * [-2542.209] (-2538.929) (-2547.642) (-2540.766) -- 0:01:14
      489500 -- [-2546.847] (-2542.333) (-2541.673) (-2546.345) * (-2540.587) [-2543.948] (-2545.781) (-2550.905) -- 0:01:14
      490000 -- (-2539.530) (-2541.690) [-2539.006] (-2544.487) * (-2543.727) [-2538.563] (-2547.362) (-2537.255) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      490500 -- [-2540.871] (-2537.576) (-2541.744) (-2544.070) * (-2542.634) [-2543.376] (-2543.704) (-2542.183) -- 0:01:14
      491000 -- (-2538.962) (-2544.601) [-2542.885] (-2547.894) * (-2549.545) (-2539.263) [-2544.344] (-2544.146) -- 0:01:14
      491500 -- (-2539.081) [-2541.856] (-2543.042) (-2546.215) * (-2547.757) (-2544.635) (-2544.000) [-2539.936] -- 0:01:14
      492000 -- (-2540.102) [-2545.179] (-2539.699) (-2549.175) * [-2542.439] (-2546.241) (-2540.037) (-2543.911) -- 0:01:14
      492500 -- (-2540.856) [-2548.728] (-2546.733) (-2541.910) * [-2541.728] (-2542.235) (-2542.707) (-2546.885) -- 0:01:14
      493000 -- (-2540.553) [-2541.095] (-2545.358) (-2540.683) * (-2544.980) (-2542.808) [-2540.343] (-2545.607) -- 0:01:14
      493500 -- [-2542.397] (-2546.218) (-2537.394) (-2541.890) * (-2544.703) (-2542.034) [-2539.154] (-2542.615) -- 0:01:13
      494000 -- (-2541.863) (-2547.661) [-2541.776] (-2539.999) * (-2544.062) [-2537.748] (-2543.432) (-2546.516) -- 0:01:13
      494500 -- (-2543.245) [-2542.235] (-2547.467) (-2540.723) * (-2543.636) (-2537.679) [-2539.705] (-2546.781) -- 0:01:13
      495000 -- [-2538.502] (-2540.278) (-2539.146) (-2542.743) * (-2542.720) [-2541.471] (-2543.843) (-2546.562) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-2542.735) (-2540.859) [-2539.765] (-2539.409) * (-2546.159) (-2538.314) (-2539.741) [-2543.112] -- 0:01:13
      496000 -- (-2541.030) (-2537.402) (-2542.136) [-2541.514] * (-2544.330) (-2539.071) [-2539.090] (-2539.370) -- 0:01:13
      496500 -- (-2540.758) (-2546.185) [-2543.735] (-2542.293) * (-2541.212) (-2541.919) (-2538.180) [-2540.909] -- 0:01:13
      497000 -- (-2538.833) (-2552.277) (-2548.300) [-2543.363] * (-2541.572) (-2543.365) (-2538.876) [-2544.056] -- 0:01:12
      497500 -- (-2550.489) (-2538.444) (-2540.524) [-2543.577] * (-2542.852) [-2538.719] (-2541.363) (-2538.944) -- 0:01:13
      498000 -- (-2541.076) [-2539.748] (-2543.303) (-2546.039) * (-2544.100) (-2542.680) (-2547.232) [-2540.454] -- 0:01:13
      498500 -- (-2541.358) (-2544.642) [-2539.468] (-2547.643) * (-2545.134) (-2544.428) [-2540.066] (-2541.237) -- 0:01:13
      499000 -- (-2552.907) [-2544.117] (-2540.485) (-2542.775) * (-2543.899) (-2537.387) (-2550.501) [-2543.776] -- 0:01:13
      499500 -- (-2546.789) (-2544.757) (-2541.515) [-2543.884] * (-2540.544) [-2540.955] (-2541.971) (-2538.316) -- 0:01:13
      500000 -- (-2544.076) (-2544.875) [-2537.465] (-2542.184) * (-2543.527) (-2540.428) [-2539.903] (-2546.967) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      500500 -- [-2544.901] (-2541.518) (-2542.551) (-2547.241) * (-2550.705) (-2540.018) [-2540.658] (-2547.495) -- 0:01:12
      501000 -- (-2541.815) (-2543.058) [-2541.232] (-2551.447) * [-2545.291] (-2548.382) (-2545.927) (-2558.366) -- 0:01:12
      501500 -- [-2545.639] (-2541.882) (-2544.998) (-2541.310) * [-2542.961] (-2539.186) (-2550.189) (-2549.313) -- 0:01:12
      502000 -- (-2543.602) (-2549.615) (-2544.344) [-2541.185] * [-2546.548] (-2542.682) (-2546.187) (-2543.296) -- 0:01:12
      502500 -- [-2539.249] (-2548.187) (-2548.287) (-2543.577) * [-2546.406] (-2541.212) (-2540.618) (-2540.702) -- 0:01:12
      503000 -- (-2543.843) [-2541.929] (-2547.778) (-2544.507) * (-2540.154) [-2543.159] (-2542.567) (-2545.359) -- 0:01:12
      503500 -- [-2549.626] (-2544.543) (-2548.530) (-2544.842) * (-2545.435) (-2537.149) (-2546.941) [-2543.900] -- 0:01:11
      504000 -- (-2551.208) (-2537.465) [-2543.429] (-2550.008) * (-2545.665) (-2552.872) (-2543.748) [-2545.141] -- 0:01:11
      504500 -- (-2549.847) (-2539.007) (-2552.723) [-2539.846] * (-2546.630) (-2547.346) (-2540.646) [-2545.443] -- 0:01:12
      505000 -- (-2551.545) [-2539.128] (-2547.225) (-2541.311) * (-2549.072) [-2542.041] (-2539.786) (-2544.396) -- 0:01:12

      Average standard deviation of split frequencies: 0.000000

      505500 -- (-2548.407) [-2543.149] (-2549.917) (-2543.015) * (-2546.511) [-2539.828] (-2549.896) (-2540.921) -- 0:01:12
      506000 -- (-2549.649) [-2541.573] (-2544.320) (-2538.413) * (-2547.022) (-2546.167) [-2546.556] (-2545.141) -- 0:01:12
      506500 -- [-2542.297] (-2549.261) (-2547.411) (-2548.267) * [-2540.582] (-2540.765) (-2541.341) (-2541.110) -- 0:01:12
      507000 -- (-2541.624) [-2539.807] (-2544.171) (-2544.475) * (-2539.374) [-2539.709] (-2542.536) (-2541.444) -- 0:01:11
      507500 -- [-2541.440] (-2541.664) (-2549.092) (-2545.564) * (-2540.979) (-2546.313) [-2541.906] (-2544.779) -- 0:01:11
      508000 -- (-2539.283) [-2540.700] (-2547.830) (-2545.543) * (-2543.662) (-2540.091) (-2550.392) [-2539.028] -- 0:01:11
      508500 -- (-2546.268) (-2545.806) (-2545.805) [-2536.479] * (-2545.078) [-2538.440] (-2538.552) (-2544.182) -- 0:01:11
      509000 -- (-2549.001) [-2542.286] (-2539.804) (-2548.792) * [-2539.502] (-2542.132) (-2556.091) (-2536.656) -- 0:01:11
      509500 -- [-2548.315] (-2541.177) (-2547.044) (-2544.801) * [-2538.375] (-2546.320) (-2546.383) (-2541.390) -- 0:01:11
      510000 -- (-2548.054) (-2544.145) [-2547.219] (-2541.968) * [-2537.877] (-2549.265) (-2548.949) (-2541.234) -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      510500 -- (-2551.849) (-2543.005) [-2544.213] (-2546.882) * (-2542.661) [-2545.756] (-2546.622) (-2542.274) -- 0:01:10
      511000 -- [-2545.289] (-2541.688) (-2544.358) (-2546.826) * [-2547.176] (-2544.084) (-2547.273) (-2544.164) -- 0:01:10
      511500 -- (-2538.757) [-2540.056] (-2544.084) (-2550.410) * (-2540.830) (-2547.498) [-2544.930] (-2540.853) -- 0:01:11
      512000 -- (-2545.336) [-2539.650] (-2547.795) (-2541.663) * (-2542.113) (-2539.393) (-2543.008) [-2539.152] -- 0:01:11
      512500 -- (-2541.987) [-2543.709] (-2541.374) (-2539.673) * [-2545.099] (-2551.263) (-2543.392) (-2542.358) -- 0:01:11
      513000 -- (-2540.648) [-2542.656] (-2543.764) (-2540.895) * [-2539.370] (-2543.685) (-2539.723) (-2545.748) -- 0:01:11
      513500 -- (-2553.000) [-2540.505] (-2544.345) (-2540.398) * (-2538.150) (-2543.126) [-2546.277] (-2541.490) -- 0:01:11
      514000 -- [-2540.811] (-2542.256) (-2550.203) (-2542.681) * (-2538.425) [-2545.522] (-2539.373) (-2546.137) -- 0:01:10
      514500 -- (-2541.974) (-2541.582) [-2547.101] (-2544.312) * (-2547.549) [-2534.707] (-2542.184) (-2544.353) -- 0:01:10
      515000 -- (-2541.565) [-2541.588] (-2545.948) (-2539.642) * (-2548.566) [-2542.090] (-2546.576) (-2543.847) -- 0:01:10

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-2541.494) (-2540.118) (-2539.889) [-2543.824] * (-2541.438) (-2543.346) (-2544.609) [-2542.714] -- 0:01:10
      516000 -- (-2543.523) [-2538.357] (-2539.193) (-2545.184) * [-2541.234] (-2540.747) (-2549.139) (-2544.425) -- 0:01:10
      516500 -- (-2544.484) (-2544.547) (-2543.661) [-2546.272] * (-2542.083) [-2543.746] (-2547.601) (-2542.704) -- 0:01:10
      517000 -- [-2543.033] (-2549.576) (-2539.512) (-2548.117) * (-2541.426) [-2541.732] (-2548.900) (-2546.211) -- 0:01:10
      517500 -- (-2540.611) (-2548.289) [-2542.576] (-2547.320) * (-2540.221) (-2549.957) (-2544.137) [-2540.497] -- 0:01:09
      518000 -- (-2540.012) [-2546.369] (-2539.974) (-2548.178) * [-2537.826] (-2541.650) (-2543.336) (-2545.998) -- 0:01:10
      518500 -- (-2539.536) (-2545.538) [-2537.536] (-2546.051) * [-2540.732] (-2543.394) (-2544.799) (-2540.874) -- 0:01:10
      519000 -- (-2545.353) [-2544.518] (-2543.884) (-2541.253) * (-2537.065) (-2543.412) (-2544.115) [-2539.577] -- 0:01:10
      519500 -- [-2536.151] (-2542.884) (-2550.981) (-2546.041) * (-2540.406) (-2541.515) (-2543.998) [-2541.643] -- 0:01:10
      520000 -- [-2540.228] (-2549.419) (-2547.056) (-2545.336) * (-2549.401) [-2544.353] (-2539.775) (-2545.371) -- 0:01:10

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-2548.239) (-2543.709) [-2537.990] (-2547.268) * (-2555.173) (-2542.360) [-2543.779] (-2541.586) -- 0:01:10
      521000 -- (-2542.516) (-2545.295) (-2545.890) [-2547.195] * (-2544.738) [-2539.651] (-2543.532) (-2548.678) -- 0:01:09
      521500 -- (-2543.472) (-2544.915) (-2540.858) [-2540.761] * (-2538.899) (-2550.077) (-2544.405) [-2543.318] -- 0:01:09
      522000 -- [-2542.895] (-2545.917) (-2547.361) (-2544.696) * (-2542.742) [-2543.937] (-2541.888) (-2540.952) -- 0:01:09
      522500 -- (-2544.303) (-2549.506) [-2548.075] (-2541.163) * (-2540.160) (-2542.034) (-2545.523) [-2546.553] -- 0:01:09
      523000 -- (-2545.870) [-2537.206] (-2543.820) (-2538.205) * (-2540.722) [-2544.399] (-2561.500) (-2541.843) -- 0:01:09
      523500 -- (-2540.347) [-2545.327] (-2542.307) (-2549.326) * [-2543.529] (-2544.989) (-2548.623) (-2538.436) -- 0:01:09
      524000 -- [-2542.174] (-2547.335) (-2546.118) (-2541.761) * (-2543.621) (-2546.245) (-2547.448) [-2542.172] -- 0:01:09
      524500 -- (-2539.502) (-2549.819) (-2548.097) [-2543.246] * [-2539.253] (-2543.545) (-2541.665) (-2545.827) -- 0:01:08
      525000 -- [-2540.996] (-2549.833) (-2543.260) (-2542.178) * [-2544.080] (-2543.298) (-2545.546) (-2544.128) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-2543.555) (-2545.908) [-2543.253] (-2539.627) * (-2541.643) (-2541.877) [-2545.165] (-2547.177) -- 0:01:09
      526000 -- (-2544.288) (-2545.723) [-2542.057] (-2537.367) * [-2543.093] (-2539.731) (-2546.406) (-2550.639) -- 0:01:09
      526500 -- (-2549.542) [-2545.331] (-2544.324) (-2542.671) * (-2540.984) [-2540.563] (-2544.237) (-2543.514) -- 0:01:09
      527000 -- (-2546.117) (-2545.024) [-2545.450] (-2544.800) * (-2542.158) (-2538.750) [-2547.135] (-2546.869) -- 0:01:09
      527500 -- (-2546.134) (-2548.239) [-2537.444] (-2549.387) * (-2541.388) (-2541.925) (-2545.147) [-2543.248] -- 0:01:08
      528000 -- [-2542.251] (-2547.289) (-2539.270) (-2544.766) * (-2542.065) [-2536.601] (-2544.831) (-2540.010) -- 0:01:08
      528500 -- (-2543.729) [-2541.043] (-2543.790) (-2539.510) * (-2541.483) [-2540.970] (-2539.967) (-2552.270) -- 0:01:08
      529000 -- (-2542.463) [-2542.200] (-2544.046) (-2541.218) * (-2543.898) (-2544.746) [-2547.672] (-2548.051) -- 0:01:08
      529500 -- (-2541.585) (-2541.300) (-2546.714) [-2543.641] * (-2547.927) [-2548.721] (-2544.525) (-2547.799) -- 0:01:08
      530000 -- (-2545.719) (-2541.268) (-2548.317) [-2542.372] * [-2539.554] (-2543.845) (-2544.649) (-2545.523) -- 0:01:08

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-2542.229) (-2540.035) [-2547.265] (-2544.021) * [-2545.754] (-2547.799) (-2548.445) (-2542.832) -- 0:01:08
      531000 -- [-2541.265] (-2542.981) (-2546.340) (-2541.836) * (-2542.574) [-2541.374] (-2548.822) (-2547.498) -- 0:01:08
      531500 -- (-2545.257) (-2543.948) (-2542.221) [-2545.520] * [-2545.189] (-2543.845) (-2546.825) (-2542.549) -- 0:01:07
      532000 -- (-2542.904) [-2540.337] (-2539.957) (-2544.874) * (-2541.194) [-2538.683] (-2549.169) (-2540.553) -- 0:01:08
      532500 -- [-2542.768] (-2538.367) (-2545.172) (-2549.722) * (-2542.657) (-2543.535) (-2541.816) [-2540.053] -- 0:01:08
      533000 -- (-2546.485) (-2541.008) (-2543.668) [-2541.057] * (-2544.577) [-2545.644] (-2545.665) (-2540.965) -- 0:01:08
      533500 -- (-2543.865) (-2544.033) [-2541.877] (-2540.331) * (-2554.042) (-2542.978) [-2540.884] (-2543.127) -- 0:01:08
      534000 -- [-2544.185] (-2542.130) (-2539.877) (-2539.594) * [-2539.589] (-2546.915) (-2547.861) (-2538.486) -- 0:01:08
      534500 -- [-2540.200] (-2541.886) (-2542.880) (-2543.765) * (-2545.084) (-2545.605) [-2540.623] (-2540.658) -- 0:01:07
      535000 -- (-2541.751) (-2551.066) (-2542.469) [-2540.618] * (-2540.047) [-2539.218] (-2542.925) (-2543.170) -- 0:01:07

      Average standard deviation of split frequencies: 0.000000

      535500 -- (-2541.683) (-2548.029) (-2548.186) [-2538.696] * (-2546.861) (-2539.283) [-2539.527] (-2540.812) -- 0:01:07
      536000 -- [-2543.763] (-2548.665) (-2548.115) (-2542.259) * (-2543.570) [-2541.613] (-2544.386) (-2547.124) -- 0:01:07
      536500 -- [-2539.116] (-2543.733) (-2545.615) (-2543.764) * (-2543.786) [-2549.051] (-2544.750) (-2541.113) -- 0:01:07
      537000 -- (-2542.184) [-2543.340] (-2547.964) (-2539.184) * [-2540.711] (-2538.659) (-2543.478) (-2547.100) -- 0:01:07
      537500 -- [-2543.158] (-2548.940) (-2544.103) (-2543.987) * (-2540.524) [-2543.013] (-2540.344) (-2547.870) -- 0:01:07
      538000 -- (-2549.434) [-2542.003] (-2547.747) (-2541.247) * (-2543.168) [-2546.171] (-2546.718) (-2545.687) -- 0:01:06
      538500 -- (-2550.374) (-2543.802) [-2542.667] (-2546.938) * [-2539.837] (-2545.554) (-2542.818) (-2544.226) -- 0:01:07
      539000 -- (-2543.344) (-2542.667) [-2541.827] (-2544.178) * [-2542.362] (-2546.085) (-2544.250) (-2542.374) -- 0:01:07
      539500 -- (-2546.471) [-2540.842] (-2541.674) (-2540.924) * (-2541.097) (-2543.187) [-2539.292] (-2545.338) -- 0:01:07
      540000 -- (-2541.807) [-2542.548] (-2542.778) (-2543.621) * (-2543.574) [-2543.816] (-2539.420) (-2543.009) -- 0:01:07

      Average standard deviation of split frequencies: 0.000000

      540500 -- (-2542.804) (-2543.869) (-2544.403) [-2537.731] * (-2541.703) (-2552.392) [-2542.364] (-2541.197) -- 0:01:07
      541000 -- (-2546.535) [-2538.031] (-2543.178) (-2541.150) * (-2538.708) (-2545.715) [-2538.970] (-2543.334) -- 0:01:07
      541500 -- (-2542.261) [-2542.212] (-2538.393) (-2539.374) * [-2541.501] (-2545.532) (-2543.667) (-2541.015) -- 0:01:06
      542000 -- (-2548.050) (-2557.638) (-2540.860) [-2543.010] * (-2547.467) (-2547.536) [-2540.173] (-2540.987) -- 0:01:06
      542500 -- (-2538.063) [-2544.298] (-2549.182) (-2547.185) * [-2541.496] (-2542.270) (-2547.264) (-2550.793) -- 0:01:06
      543000 -- [-2548.373] (-2540.872) (-2541.018) (-2541.601) * [-2544.238] (-2545.388) (-2541.398) (-2544.603) -- 0:01:06
      543500 -- (-2547.204) [-2539.366] (-2541.937) (-2539.202) * (-2542.037) (-2542.820) (-2540.731) [-2540.598] -- 0:01:06
      544000 -- (-2540.057) (-2542.119) (-2550.793) [-2550.483] * (-2540.745) (-2540.979) (-2542.105) [-2538.810] -- 0:01:06
      544500 -- (-2548.370) (-2540.851) [-2544.805] (-2537.934) * (-2541.099) [-2540.183] (-2540.251) (-2542.712) -- 0:01:06
      545000 -- (-2544.007) (-2542.143) (-2539.286) [-2538.247] * [-2539.589] (-2542.194) (-2542.098) (-2538.504) -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-2549.345) (-2539.612) [-2540.024] (-2536.481) * [-2540.979] (-2542.054) (-2541.412) (-2542.611) -- 0:01:06
      546000 -- (-2547.757) (-2540.051) (-2541.097) [-2539.501] * (-2548.198) [-2545.626] (-2548.266) (-2549.247) -- 0:01:06
      546500 -- (-2548.981) (-2542.851) [-2541.764] (-2541.165) * (-2541.646) [-2540.385] (-2544.544) (-2542.435) -- 0:01:06
      547000 -- (-2544.089) (-2539.037) [-2537.782] (-2553.538) * (-2545.314) [-2539.094] (-2539.696) (-2540.609) -- 0:01:06
      547500 -- (-2542.007) (-2541.210) (-2543.631) [-2539.722] * (-2543.166) (-2538.646) (-2543.598) [-2543.033] -- 0:01:06
      548000 -- (-2538.884) [-2540.167] (-2540.527) (-2542.490) * (-2543.022) (-2538.675) [-2541.155] (-2540.958) -- 0:01:05
      548500 -- (-2540.803) [-2541.167] (-2545.543) (-2539.397) * (-2542.828) (-2541.515) (-2538.122) [-2541.900] -- 0:01:05
      549000 -- (-2547.228) (-2541.693) (-2544.239) [-2548.998] * (-2543.756) (-2541.473) (-2545.088) [-2543.834] -- 0:01:05
      549500 -- (-2546.251) (-2543.769) (-2541.696) [-2544.371] * (-2547.771) [-2544.936] (-2541.938) (-2541.352) -- 0:01:05
      550000 -- (-2537.692) (-2547.203) [-2537.990] (-2543.355) * (-2540.049) (-2546.006) (-2540.129) [-2545.088] -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      550500 -- [-2548.198] (-2545.110) (-2542.383) (-2544.512) * (-2547.116) (-2542.462) (-2539.579) [-2543.478] -- 0:01:05
      551000 -- (-2545.853) [-2548.566] (-2539.842) (-2546.864) * (-2549.403) (-2541.471) (-2542.673) [-2536.949] -- 0:01:05
      551500 -- (-2539.053) (-2539.791) [-2541.673] (-2539.522) * (-2546.953) (-2546.313) (-2547.825) [-2538.789] -- 0:01:05
      552000 -- [-2542.052] (-2544.004) (-2546.493) (-2543.539) * (-2546.304) (-2541.981) (-2543.848) [-2538.172] -- 0:01:04
      552500 -- (-2541.987) [-2538.320] (-2544.692) (-2546.081) * (-2540.086) [-2545.827] (-2546.777) (-2543.161) -- 0:01:05
      553000 -- (-2543.654) [-2539.723] (-2539.082) (-2542.023) * (-2550.013) (-2543.980) [-2543.664] (-2543.294) -- 0:01:05
      553500 -- (-2544.392) (-2546.495) (-2548.933) [-2538.989] * (-2541.858) (-2544.010) [-2540.771] (-2540.190) -- 0:01:05
      554000 -- [-2541.488] (-2551.655) (-2541.084) (-2540.211) * (-2540.228) (-2541.057) (-2545.118) [-2542.286] -- 0:01:05
      554500 -- (-2549.529) (-2543.749) [-2541.912] (-2537.265) * (-2550.081) (-2544.481) [-2540.435] (-2541.235) -- 0:01:05
      555000 -- (-2545.388) [-2543.640] (-2538.347) (-2542.806) * (-2549.221) (-2545.319) (-2544.348) [-2539.286] -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      555500 -- (-2544.236) (-2542.613) (-2543.491) [-2542.997] * (-2545.701) (-2542.250) [-2539.000] (-2540.395) -- 0:01:04
      556000 -- (-2545.305) [-2542.902] (-2542.864) (-2551.800) * (-2543.375) (-2537.135) [-2538.056] (-2543.261) -- 0:01:04
      556500 -- (-2545.114) (-2545.529) (-2547.371) [-2546.068] * [-2539.570] (-2539.679) (-2539.877) (-2548.852) -- 0:01:04
      557000 -- (-2552.027) (-2545.161) [-2542.142] (-2539.118) * (-2544.337) (-2541.716) (-2540.743) [-2546.866] -- 0:01:04
      557500 -- [-2542.116] (-2540.975) (-2539.599) (-2555.893) * (-2542.443) [-2544.919] (-2547.559) (-2548.962) -- 0:01:04
      558000 -- (-2540.662) (-2544.439) [-2544.671] (-2547.338) * (-2540.289) [-2542.318] (-2538.391) (-2549.637) -- 0:01:04
      558500 -- (-2542.597) [-2544.367] (-2543.090) (-2545.038) * [-2541.387] (-2540.352) (-2545.199) (-2543.842) -- 0:01:04
      559000 -- (-2540.959) (-2545.192) [-2541.437] (-2542.817) * [-2541.365] (-2547.370) (-2540.862) (-2540.809) -- 0:01:04
      559500 -- (-2549.416) (-2540.182) [-2539.102] (-2547.498) * (-2538.084) [-2543.664] (-2546.003) (-2542.717) -- 0:01:04
      560000 -- (-2546.781) (-2539.313) (-2538.664) [-2543.200] * [-2541.349] (-2544.891) (-2554.103) (-2558.621) -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      560500 -- (-2540.117) (-2541.778) [-2543.957] (-2541.121) * (-2544.376) [-2541.025] (-2554.210) (-2539.817) -- 0:01:04
      561000 -- (-2540.802) [-2540.839] (-2545.450) (-2541.063) * (-2546.944) [-2537.386] (-2545.157) (-2543.839) -- 0:01:04
      561500 -- (-2544.715) [-2535.584] (-2543.407) (-2550.465) * (-2548.270) [-2543.291] (-2546.348) (-2540.700) -- 0:01:04
      562000 -- (-2538.667) [-2538.106] (-2550.859) (-2541.230) * (-2543.397) (-2545.477) [-2546.773] (-2547.857) -- 0:01:03
      562500 -- (-2538.884) [-2550.827] (-2546.771) (-2543.575) * [-2548.631] (-2542.952) (-2544.310) (-2540.920) -- 0:01:03
      563000 -- [-2539.040] (-2543.489) (-2543.501) (-2540.604) * [-2548.923] (-2547.840) (-2554.897) (-2541.056) -- 0:01:03
      563500 -- (-2543.881) [-2543.980] (-2543.145) (-2546.474) * [-2541.913] (-2557.565) (-2544.418) (-2540.535) -- 0:01:03
      564000 -- (-2544.258) (-2542.725) (-2539.822) [-2542.382] * (-2545.589) (-2544.951) [-2539.134] (-2542.674) -- 0:01:03
      564500 -- (-2544.938) [-2546.651] (-2544.417) (-2549.976) * [-2541.076] (-2541.121) (-2540.363) (-2541.053) -- 0:01:03
      565000 -- (-2547.918) [-2539.490] (-2545.120) (-2544.494) * [-2543.618] (-2539.350) (-2544.019) (-2549.777) -- 0:01:03

      Average standard deviation of split frequencies: 0.000000

      565500 -- [-2540.782] (-2538.778) (-2546.287) (-2542.858) * (-2544.561) [-2538.983] (-2541.127) (-2549.240) -- 0:01:03
      566000 -- [-2538.354] (-2542.642) (-2548.593) (-2544.084) * [-2547.441] (-2543.052) (-2538.642) (-2550.394) -- 0:01:03
      566500 -- [-2543.619] (-2542.269) (-2543.677) (-2543.789) * (-2541.433) (-2541.206) [-2540.017] (-2540.862) -- 0:01:03
      567000 -- (-2540.099) (-2544.414) (-2540.640) [-2541.314] * [-2543.444] (-2553.837) (-2542.688) (-2539.727) -- 0:01:03
      567500 -- [-2537.858] (-2547.978) (-2542.315) (-2551.936) * (-2543.445) [-2543.660] (-2545.227) (-2543.814) -- 0:01:03
      568000 -- [-2539.371] (-2544.116) (-2542.702) (-2546.823) * (-2545.302) (-2543.866) [-2550.602] (-2544.084) -- 0:01:03
      568500 -- [-2542.536] (-2551.603) (-2543.153) (-2542.412) * [-2546.869] (-2544.597) (-2540.935) (-2544.525) -- 0:01:02
      569000 -- (-2540.929) (-2547.082) [-2541.339] (-2540.379) * (-2543.469) [-2537.265] (-2544.723) (-2543.060) -- 0:01:02
      569500 -- [-2543.414] (-2541.575) (-2544.670) (-2550.151) * (-2546.143) [-2538.333] (-2543.737) (-2543.898) -- 0:01:02
      570000 -- (-2542.989) (-2544.823) (-2543.884) [-2547.854] * (-2540.372) (-2541.263) [-2544.458] (-2549.836) -- 0:01:02

      Average standard deviation of split frequencies: 0.000000

      570500 -- (-2539.985) [-2547.263] (-2538.636) (-2547.330) * [-2541.730] (-2542.003) (-2542.093) (-2541.626) -- 0:01:02
      571000 -- (-2541.294) (-2545.138) (-2542.761) [-2551.049] * (-2543.386) (-2548.879) (-2547.039) [-2538.777] -- 0:01:02
      571500 -- (-2541.258) (-2543.417) [-2540.465] (-2547.737) * (-2540.907) (-2551.745) (-2543.978) [-2535.404] -- 0:01:02
      572000 -- (-2540.435) (-2547.376) (-2538.339) [-2543.041] * (-2546.567) (-2539.373) (-2542.459) [-2541.333] -- 0:01:02
      572500 -- (-2538.956) (-2543.983) (-2543.616) [-2546.061] * (-2543.336) (-2545.997) (-2542.208) [-2542.018] -- 0:01:01
      573000 -- (-2544.103) (-2544.312) [-2540.947] (-2548.854) * [-2538.456] (-2543.028) (-2547.009) (-2543.709) -- 0:01:02
      573500 -- [-2546.233] (-2544.915) (-2538.673) (-2547.922) * (-2540.910) (-2544.786) (-2539.547) [-2539.313] -- 0:01:02
      574000 -- (-2547.224) (-2543.547) (-2539.457) [-2541.253] * (-2542.294) [-2541.757] (-2540.147) (-2538.127) -- 0:01:02
      574500 -- (-2540.006) (-2548.312) (-2541.311) [-2540.923] * (-2540.015) [-2540.042] (-2546.538) (-2544.641) -- 0:01:02
      575000 -- (-2539.790) [-2547.424] (-2541.818) (-2542.453) * (-2542.038) [-2538.195] (-2552.591) (-2547.196) -- 0:01:02

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-2542.187) (-2549.503) [-2539.300] (-2545.858) * (-2540.023) [-2538.998] (-2544.343) (-2539.977) -- 0:01:01
      576000 -- (-2536.905) (-2546.108) [-2536.422] (-2542.176) * (-2540.433) (-2538.619) [-2542.802] (-2539.014) -- 0:01:01
      576500 -- (-2538.967) [-2540.166] (-2543.333) (-2548.516) * [-2544.469] (-2542.501) (-2544.063) (-2541.677) -- 0:01:01
      577000 -- [-2544.445] (-2549.580) (-2536.369) (-2541.549) * [-2538.759] (-2542.696) (-2541.472) (-2539.552) -- 0:01:01
      577500 -- (-2545.581) (-2542.896) (-2542.260) [-2538.799] * [-2544.722] (-2551.499) (-2540.210) (-2542.581) -- 0:01:01
      578000 -- (-2544.064) (-2539.136) [-2541.822] (-2544.636) * (-2541.617) (-2545.826) [-2540.859] (-2546.738) -- 0:01:01
      578500 -- (-2541.580) (-2542.587) [-2539.824] (-2548.510) * (-2547.796) (-2544.407) [-2547.611] (-2543.385) -- 0:01:01
      579000 -- (-2541.898) [-2543.106] (-2543.449) (-2545.626) * (-2543.011) (-2546.928) (-2541.296) [-2542.343] -- 0:01:01
      579500 -- [-2537.534] (-2545.154) (-2545.745) (-2547.384) * (-2545.412) [-2538.958] (-2550.586) (-2538.111) -- 0:01:01
      580000 -- (-2538.796) (-2540.783) [-2544.777] (-2539.933) * (-2550.124) [-2543.235] (-2548.114) (-2549.961) -- 0:01:01

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-2544.316) (-2544.410) [-2544.180] (-2545.609) * (-2542.119) (-2548.396) [-2540.672] (-2554.262) -- 0:01:01
      581000 -- (-2541.070) [-2543.617] (-2547.635) (-2544.701) * (-2543.557) (-2548.178) [-2538.661] (-2541.662) -- 0:01:01
      581500 -- [-2542.776] (-2542.034) (-2549.564) (-2545.527) * (-2541.885) (-2543.525) [-2535.735] (-2537.524) -- 0:01:01
      582000 -- (-2540.866) (-2542.311) [-2542.943] (-2544.735) * (-2542.074) (-2543.503) (-2541.060) [-2539.644] -- 0:01:01
      582500 -- (-2542.835) (-2544.634) (-2541.725) [-2546.764] * (-2544.883) [-2542.758] (-2546.017) (-2545.648) -- 0:01:00
      583000 -- [-2543.141] (-2549.502) (-2548.316) (-2540.303) * (-2545.772) (-2542.592) [-2547.106] (-2543.637) -- 0:01:00
      583500 -- (-2540.873) (-2546.792) (-2544.325) [-2539.908] * (-2542.114) (-2542.425) (-2544.628) [-2540.889] -- 0:01:00
      584000 -- (-2543.253) [-2541.485] (-2542.607) (-2538.294) * (-2543.463) (-2542.133) (-2551.781) [-2538.061] -- 0:01:00
      584500 -- (-2541.973) [-2538.730] (-2543.276) (-2544.038) * (-2546.188) (-2547.237) (-2548.176) [-2538.219] -- 0:01:00
      585000 -- (-2545.181) [-2538.175] (-2551.748) (-2544.403) * (-2542.760) (-2547.151) (-2542.723) [-2538.764] -- 0:01:00

      Average standard deviation of split frequencies: 0.000000

      585500 -- (-2542.260) [-2541.625] (-2547.374) (-2542.586) * (-2544.373) (-2541.445) (-2546.205) [-2543.439] -- 0:01:00
      586000 -- (-2554.090) (-2539.366) [-2543.492] (-2543.178) * (-2544.928) [-2535.333] (-2545.065) (-2543.500) -- 0:01:00
      586500 -- (-2540.511) [-2543.760] (-2539.650) (-2545.558) * (-2540.837) (-2547.112) [-2542.729] (-2542.074) -- 0:01:00
      587000 -- [-2545.647] (-2540.174) (-2543.931) (-2551.397) * [-2545.438] (-2537.103) (-2546.845) (-2543.503) -- 0:01:00
      587500 -- (-2544.124) (-2541.839) [-2539.115] (-2544.055) * [-2536.850] (-2544.525) (-2549.395) (-2543.439) -- 0:01:00
      588000 -- (-2552.130) (-2547.217) [-2543.019] (-2545.006) * (-2539.856) [-2539.761] (-2540.335) (-2544.819) -- 0:01:00
      588500 -- (-2540.833) (-2539.861) [-2548.186] (-2543.108) * (-2545.712) (-2546.507) (-2540.949) [-2545.426] -- 0:01:00
      589000 -- (-2549.371) [-2540.479] (-2543.125) (-2541.894) * [-2542.107] (-2544.209) (-2547.813) (-2542.365) -- 0:01:00
      589500 -- [-2542.202] (-2542.694) (-2543.970) (-2541.436) * [-2540.824] (-2544.355) (-2556.329) (-2550.114) -- 0:00:59
      590000 -- (-2543.437) [-2545.528] (-2540.620) (-2544.773) * (-2542.274) (-2544.484) [-2544.798] (-2543.011) -- 0:00:59

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-2539.992) (-2548.805) [-2537.857] (-2547.520) * [-2547.645] (-2537.692) (-2539.513) (-2541.614) -- 0:00:59
      591000 -- (-2546.914) (-2542.781) [-2537.846] (-2539.604) * (-2541.668) (-2542.251) [-2546.494] (-2543.501) -- 0:00:59
      591500 -- (-2547.278) (-2543.110) (-2542.373) [-2544.737] * (-2550.016) [-2541.367] (-2541.340) (-2541.459) -- 0:00:59
      592000 -- (-2545.429) [-2540.260] (-2543.766) (-2541.733) * (-2544.409) (-2540.381) [-2541.876] (-2543.664) -- 0:00:59
      592500 -- (-2542.629) [-2539.707] (-2544.972) (-2541.494) * (-2538.432) [-2540.990] (-2542.361) (-2546.207) -- 0:00:59
      593000 -- (-2545.454) (-2540.517) [-2541.084] (-2546.546) * (-2541.432) (-2549.559) (-2541.714) [-2546.806] -- 0:00:59
      593500 -- (-2548.813) (-2544.024) [-2539.836] (-2543.603) * (-2540.794) (-2545.063) [-2548.191] (-2540.558) -- 0:00:59
      594000 -- (-2544.999) [-2540.890] (-2540.812) (-2546.019) * (-2546.379) (-2541.980) (-2542.432) [-2539.641] -- 0:00:59
      594500 -- (-2545.777) (-2540.635) [-2542.961] (-2542.786) * [-2540.446] (-2541.682) (-2539.375) (-2540.134) -- 0:00:59
      595000 -- (-2554.450) (-2541.502) [-2539.937] (-2544.999) * [-2540.652] (-2547.529) (-2546.399) (-2540.211) -- 0:00:59

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-2543.065) [-2542.746] (-2544.794) (-2553.862) * (-2546.530) (-2545.513) (-2542.334) [-2541.291] -- 0:00:59
      596000 -- (-2541.285) (-2545.508) (-2546.425) [-2538.822] * (-2547.815) [-2539.322] (-2537.291) (-2540.786) -- 0:00:58
      596500 -- [-2541.131] (-2542.439) (-2543.388) (-2541.109) * (-2546.300) [-2541.670] (-2540.895) (-2539.309) -- 0:00:58
      597000 -- (-2543.476) (-2539.446) (-2541.760) [-2541.550] * [-2545.491] (-2538.901) (-2552.376) (-2537.574) -- 0:00:58
      597500 -- [-2539.406] (-2546.299) (-2538.052) (-2542.514) * (-2544.067) (-2549.616) [-2543.577] (-2539.168) -- 0:00:58
      598000 -- (-2548.672) (-2540.438) (-2544.108) [-2539.641] * (-2543.679) (-2538.276) [-2542.671] (-2550.271) -- 0:00:58
      598500 -- (-2548.089) (-2544.806) [-2544.490] (-2537.855) * (-2542.535) (-2542.244) [-2544.283] (-2543.228) -- 0:00:58
      599000 -- (-2543.297) (-2539.994) (-2548.428) [-2540.141] * (-2542.033) [-2541.749] (-2539.842) (-2545.941) -- 0:00:58
      599500 -- (-2540.114) (-2546.105) (-2541.655) [-2537.618] * (-2542.475) (-2540.741) [-2539.203] (-2546.455) -- 0:00:58
      600000 -- [-2545.337] (-2548.848) (-2546.696) (-2536.684) * (-2540.144) [-2542.250] (-2546.855) (-2543.971) -- 0:00:58

      Average standard deviation of split frequencies: 0.000000

      600500 -- [-2544.109] (-2542.630) (-2546.835) (-2544.960) * [-2543.833] (-2545.835) (-2547.258) (-2549.531) -- 0:00:58
      601000 -- (-2552.437) [-2540.940] (-2543.096) (-2539.684) * [-2541.434] (-2544.291) (-2549.469) (-2550.721) -- 0:00:58
      601500 -- [-2543.962] (-2537.387) (-2546.313) (-2542.743) * (-2543.719) (-2541.128) [-2543.670] (-2545.297) -- 0:00:58
      602000 -- (-2545.743) (-2541.545) (-2546.656) [-2540.061] * (-2543.170) (-2542.462) [-2541.979] (-2544.063) -- 0:00:58
      602500 -- [-2546.421] (-2539.322) (-2552.055) (-2543.642) * (-2537.388) (-2543.254) [-2545.527] (-2542.789) -- 0:00:58
      603000 -- (-2545.526) [-2541.300] (-2547.433) (-2542.675) * (-2541.243) [-2541.006] (-2540.506) (-2540.673) -- 0:00:57
      603500 -- [-2540.915] (-2548.594) (-2542.659) (-2545.814) * (-2545.873) (-2536.232) [-2543.491] (-2543.277) -- 0:00:57
      604000 -- (-2540.804) (-2542.711) (-2542.189) [-2541.278] * (-2547.955) (-2540.460) (-2539.740) [-2536.296] -- 0:00:57
      604500 -- [-2542.625] (-2547.388) (-2549.111) (-2541.105) * [-2538.883] (-2546.657) (-2543.550) (-2546.068) -- 0:00:57
      605000 -- (-2536.907) (-2550.124) (-2542.018) [-2539.374] * (-2543.404) (-2547.522) (-2545.987) [-2539.907] -- 0:00:57

      Average standard deviation of split frequencies: 0.000000

      605500 -- [-2536.984] (-2548.525) (-2547.664) (-2538.865) * (-2537.773) (-2555.995) [-2542.856] (-2540.027) -- 0:00:57
      606000 -- (-2544.006) (-2542.361) (-2550.203) [-2541.656] * [-2542.976] (-2541.720) (-2541.158) (-2546.763) -- 0:00:57
      606500 -- (-2543.965) (-2546.537) (-2541.815) [-2544.143] * (-2550.103) (-2540.391) [-2541.487] (-2543.593) -- 0:00:57
      607000 -- [-2544.914] (-2541.983) (-2540.670) (-2546.332) * [-2546.309] (-2542.074) (-2538.932) (-2549.341) -- 0:00:57
      607500 -- (-2544.459) (-2540.217) [-2538.016] (-2544.973) * (-2546.368) [-2542.035] (-2537.712) (-2544.345) -- 0:00:57
      608000 -- (-2539.028) [-2543.309] (-2539.933) (-2543.605) * [-2538.742] (-2542.027) (-2554.342) (-2548.957) -- 0:00:57
      608500 -- (-2542.535) (-2550.545) [-2538.558] (-2543.984) * (-2548.283) (-2544.701) (-2553.383) [-2542.464] -- 0:00:57
      609000 -- (-2547.238) (-2549.764) [-2537.998] (-2539.942) * (-2544.359) (-2545.490) (-2549.316) [-2542.843] -- 0:00:57
      609500 -- (-2543.080) (-2549.826) (-2545.126) [-2541.317] * (-2541.141) [-2536.971] (-2545.120) (-2549.763) -- 0:00:57
      610000 -- [-2543.992] (-2541.701) (-2545.382) (-2544.211) * [-2538.722] (-2540.873) (-2545.603) (-2542.771) -- 0:00:56

      Average standard deviation of split frequencies: 0.000000

      610500 -- (-2544.694) [-2536.629] (-2547.546) (-2544.529) * [-2544.155] (-2544.934) (-2543.429) (-2540.517) -- 0:00:56
      611000 -- [-2546.498] (-2540.975) (-2552.091) (-2541.659) * (-2542.985) (-2542.110) (-2542.298) [-2541.956] -- 0:00:56
      611500 -- (-2546.286) [-2539.803] (-2543.914) (-2544.204) * (-2540.184) [-2540.962] (-2541.317) (-2540.760) -- 0:00:56
      612000 -- (-2548.853) [-2545.232] (-2544.410) (-2542.045) * [-2539.108] (-2542.679) (-2539.559) (-2543.667) -- 0:00:56
      612500 -- (-2543.933) (-2550.847) (-2543.505) [-2546.315] * (-2545.636) (-2538.656) [-2542.451] (-2544.648) -- 0:00:56
      613000 -- (-2542.287) [-2550.010] (-2544.433) (-2541.110) * [-2542.009] (-2540.510) (-2546.614) (-2543.068) -- 0:00:56
      613500 -- (-2543.721) [-2539.407] (-2546.320) (-2538.640) * (-2555.550) (-2538.638) (-2538.630) [-2539.344] -- 0:00:56
      614000 -- [-2542.857] (-2543.934) (-2550.930) (-2544.914) * (-2545.927) (-2543.722) (-2543.507) [-2540.505] -- 0:00:56
      614500 -- (-2546.644) [-2543.978] (-2550.675) (-2543.903) * (-2549.486) (-2550.491) (-2545.759) [-2540.516] -- 0:00:56
      615000 -- (-2547.570) (-2550.567) (-2542.260) [-2541.084] * [-2543.988] (-2539.193) (-2543.919) (-2540.391) -- 0:00:56

      Average standard deviation of split frequencies: 0.000000

      615500 -- [-2540.607] (-2548.346) (-2548.461) (-2540.504) * (-2542.522) [-2540.045] (-2544.227) (-2546.019) -- 0:00:56
      616000 -- (-2539.287) (-2547.468) (-2540.870) [-2542.773] * (-2542.173) [-2539.465] (-2543.285) (-2550.047) -- 0:00:56
      616500 -- (-2548.893) (-2551.115) (-2542.849) [-2544.585] * (-2543.337) (-2545.512) (-2542.768) [-2545.700] -- 0:00:55
      617000 -- (-2544.583) (-2549.923) [-2541.163] (-2546.181) * (-2545.609) [-2547.227] (-2539.978) (-2539.204) -- 0:00:55
      617500 -- (-2541.375) (-2542.667) (-2545.417) [-2539.275] * (-2539.655) (-2545.426) (-2541.458) [-2546.359] -- 0:00:55
      618000 -- (-2537.034) (-2545.694) (-2549.478) [-2544.407] * (-2544.543) [-2544.495] (-2548.667) (-2539.553) -- 0:00:55
      618500 -- (-2541.502) (-2542.829) [-2545.268] (-2564.277) * (-2545.228) [-2545.137] (-2540.969) (-2548.288) -- 0:00:55
      619000 -- (-2537.866) (-2538.773) [-2543.489] (-2543.584) * (-2543.431) (-2549.848) [-2547.991] (-2539.914) -- 0:00:55
      619500 -- (-2539.630) (-2547.043) (-2540.058) [-2537.457] * [-2539.907] (-2543.414) (-2542.901) (-2545.813) -- 0:00:55
      620000 -- (-2541.137) (-2542.339) [-2538.596] (-2538.268) * (-2546.743) [-2538.631] (-2543.493) (-2538.293) -- 0:00:55

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-2542.759) (-2546.881) [-2535.601] (-2546.745) * [-2544.814] (-2542.752) (-2542.075) (-2545.691) -- 0:00:55
      621000 -- (-2545.989) (-2545.119) (-2539.661) [-2539.317] * (-2545.582) (-2544.216) [-2541.604] (-2551.379) -- 0:00:55
      621500 -- (-2547.790) [-2546.672] (-2549.550) (-2540.006) * [-2539.991] (-2546.847) (-2550.232) (-2554.361) -- 0:00:55
      622000 -- [-2540.573] (-2544.854) (-2544.034) (-2541.143) * (-2540.752) (-2547.876) (-2543.227) [-2540.141] -- 0:00:55
      622500 -- [-2537.914] (-2550.935) (-2543.413) (-2556.665) * (-2537.924) (-2541.851) [-2547.981] (-2543.121) -- 0:00:55
      623000 -- (-2542.927) (-2544.119) (-2540.225) [-2542.126] * [-2544.359] (-2538.315) (-2544.593) (-2546.196) -- 0:00:55
      623500 -- (-2542.911) (-2544.848) [-2540.401] (-2542.561) * [-2549.051] (-2538.560) (-2546.216) (-2543.183) -- 0:00:54
      624000 -- [-2543.591] (-2541.006) (-2542.896) (-2541.495) * (-2547.063) (-2545.759) (-2545.775) [-2542.131] -- 0:00:54
      624500 -- (-2541.910) (-2544.463) [-2543.104] (-2541.473) * [-2541.919] (-2546.068) (-2537.792) (-2550.695) -- 0:00:54
      625000 -- (-2541.288) (-2538.565) [-2545.953] (-2551.775) * (-2540.842) (-2541.741) [-2537.845] (-2542.212) -- 0:00:54

      Average standard deviation of split frequencies: 0.000000

      625500 -- [-2541.544] (-2553.227) (-2539.524) (-2556.277) * (-2541.641) (-2539.797) (-2545.694) [-2543.443] -- 0:00:54
      626000 -- (-2537.427) (-2543.962) (-2543.063) [-2540.213] * (-2547.180) [-2546.513] (-2538.532) (-2546.744) -- 0:00:54
      626500 -- [-2544.679] (-2543.949) (-2546.747) (-2539.635) * (-2546.596) [-2543.523] (-2543.082) (-2540.709) -- 0:00:54
      627000 -- (-2541.883) (-2546.095) (-2554.837) [-2540.085] * (-2543.980) (-2540.474) [-2547.532] (-2547.308) -- 0:00:54
      627500 -- (-2538.146) [-2542.249] (-2539.764) (-2539.727) * (-2548.263) [-2542.287] (-2541.010) (-2551.023) -- 0:00:54
      628000 -- [-2541.320] (-2542.528) (-2539.579) (-2547.617) * (-2541.093) [-2542.112] (-2538.334) (-2540.865) -- 0:00:54
      628500 -- (-2543.176) (-2547.054) [-2542.541] (-2542.689) * (-2542.413) (-2540.487) [-2548.302] (-2542.211) -- 0:00:54
      629000 -- (-2545.152) (-2541.871) (-2542.203) [-2539.945] * (-2538.832) (-2541.466) [-2542.172] (-2544.341) -- 0:00:54
      629500 -- (-2543.986) (-2543.416) (-2539.141) [-2541.927] * (-2550.350) (-2540.417) [-2543.148] (-2546.605) -- 0:00:54
      630000 -- (-2546.394) [-2542.223] (-2539.776) (-2540.513) * (-2541.107) (-2542.449) [-2542.954] (-2541.908) -- 0:00:54

      Average standard deviation of split frequencies: 0.000000

      630500 -- (-2547.951) (-2541.911) [-2544.301] (-2539.493) * (-2538.781) (-2544.656) (-2542.654) [-2542.263] -- 0:00:53
      631000 -- (-2545.245) (-2541.321) [-2543.475] (-2544.132) * (-2540.113) (-2543.892) [-2541.848] (-2551.145) -- 0:00:53
      631500 -- (-2544.122) (-2552.207) (-2546.932) [-2538.499] * [-2537.440] (-2541.052) (-2543.358) (-2543.679) -- 0:00:53
      632000 -- (-2538.989) (-2541.077) (-2542.316) [-2539.886] * (-2541.822) [-2537.816] (-2540.376) (-2545.376) -- 0:00:53
      632500 -- [-2540.888] (-2542.565) (-2547.118) (-2546.602) * [-2539.385] (-2538.573) (-2538.551) (-2544.955) -- 0:00:53
      633000 -- (-2541.753) (-2543.641) (-2541.040) [-2546.077] * (-2541.333) (-2541.499) [-2541.344] (-2547.830) -- 0:00:53
      633500 -- (-2539.294) [-2543.294] (-2541.356) (-2546.908) * [-2540.635] (-2538.938) (-2546.432) (-2546.406) -- 0:00:53
      634000 -- (-2544.092) (-2548.746) (-2544.435) [-2540.247] * [-2539.193] (-2547.004) (-2547.131) (-2543.031) -- 0:00:53
      634500 -- [-2537.812] (-2550.111) (-2540.702) (-2540.703) * (-2548.000) [-2545.526] (-2542.614) (-2543.920) -- 0:00:53
      635000 -- [-2542.943] (-2542.300) (-2547.666) (-2539.543) * (-2549.037) [-2540.479] (-2542.237) (-2543.723) -- 0:00:53

      Average standard deviation of split frequencies: 0.000000

      635500 -- (-2544.583) (-2545.800) (-2543.016) [-2536.043] * (-2547.332) (-2544.238) (-2539.079) [-2543.613] -- 0:00:53
      636000 -- (-2540.973) (-2549.454) (-2544.596) [-2540.782] * (-2542.317) (-2539.028) [-2538.944] (-2541.782) -- 0:00:53
      636500 -- (-2547.826) (-2547.632) [-2541.228] (-2544.510) * (-2544.068) (-2544.549) (-2549.583) [-2541.460] -- 0:00:53
      637000 -- (-2546.292) (-2540.301) (-2545.115) [-2537.542] * (-2542.478) (-2546.756) (-2542.818) [-2545.080] -- 0:00:52
      637500 -- (-2545.957) (-2538.085) [-2543.747] (-2541.585) * (-2547.051) (-2545.834) [-2543.468] (-2539.687) -- 0:00:52
      638000 -- (-2543.360) (-2543.223) [-2540.374] (-2545.493) * (-2543.505) (-2550.169) [-2541.137] (-2547.455) -- 0:00:52
      638500 -- (-2538.836) (-2547.877) (-2547.042) [-2551.585] * [-2536.524] (-2545.151) (-2542.307) (-2541.676) -- 0:00:52
      639000 -- [-2538.666] (-2550.227) (-2549.998) (-2537.808) * (-2545.729) (-2544.692) (-2551.024) [-2541.441] -- 0:00:52
      639500 -- [-2543.517] (-2542.524) (-2541.159) (-2540.291) * (-2542.920) (-2543.214) (-2554.603) [-2543.542] -- 0:00:52
      640000 -- (-2539.352) [-2541.599] (-2544.827) (-2541.817) * (-2548.875) [-2540.681] (-2538.373) (-2539.568) -- 0:00:52

      Average standard deviation of split frequencies: 0.000000

      640500 -- (-2550.071) (-2546.084) (-2547.150) [-2548.239] * [-2546.883] (-2540.011) (-2541.045) (-2541.425) -- 0:00:52
      641000 -- (-2538.647) (-2544.870) (-2542.047) [-2539.181] * (-2550.208) [-2545.994] (-2543.703) (-2542.538) -- 0:00:52
      641500 -- (-2542.079) (-2546.803) [-2546.021] (-2544.505) * (-2549.342) [-2546.863] (-2541.480) (-2541.652) -- 0:00:52
      642000 -- (-2542.638) [-2547.778] (-2545.267) (-2544.016) * (-2548.240) (-2543.495) (-2542.980) [-2541.263] -- 0:00:52
      642500 -- [-2538.215] (-2542.112) (-2540.719) (-2555.394) * (-2544.902) (-2542.729) (-2543.934) [-2539.356] -- 0:00:52
      643000 -- (-2538.324) (-2542.476) (-2542.379) [-2543.693] * (-2548.629) (-2544.959) (-2540.511) [-2535.708] -- 0:00:52
      643500 -- [-2540.434] (-2538.165) (-2546.655) (-2541.519) * (-2544.376) (-2544.351) [-2541.847] (-2543.065) -- 0:00:52
      644000 -- [-2540.391] (-2545.646) (-2545.050) (-2545.658) * [-2537.788] (-2542.071) (-2544.430) (-2541.746) -- 0:00:51
      644500 -- (-2542.937) (-2542.027) (-2543.154) [-2542.890] * (-2539.866) (-2545.201) [-2538.846] (-2544.905) -- 0:00:51
      645000 -- (-2541.530) [-2538.361] (-2543.111) (-2540.477) * [-2540.925] (-2538.772) (-2545.676) (-2551.572) -- 0:00:51

      Average standard deviation of split frequencies: 0.000000

      645500 -- [-2542.147] (-2540.776) (-2540.758) (-2547.365) * [-2540.062] (-2540.955) (-2542.578) (-2551.106) -- 0:00:51
      646000 -- (-2546.698) (-2538.554) (-2546.841) [-2544.469] * [-2546.490] (-2543.580) (-2545.892) (-2549.721) -- 0:00:51
      646500 -- (-2542.614) [-2539.096] (-2547.238) (-2543.728) * [-2544.275] (-2543.720) (-2539.536) (-2540.494) -- 0:00:51
      647000 -- [-2544.359] (-2542.453) (-2538.896) (-2546.311) * (-2546.624) (-2540.557) (-2546.573) [-2540.799] -- 0:00:51
      647500 -- [-2538.784] (-2551.852) (-2540.589) (-2547.114) * (-2545.017) [-2540.161] (-2546.431) (-2542.337) -- 0:00:51
      648000 -- (-2538.184) [-2544.490] (-2542.171) (-2548.380) * (-2548.223) (-2540.880) [-2545.876] (-2539.801) -- 0:00:51
      648500 -- (-2539.837) [-2539.903] (-2539.579) (-2553.727) * [-2540.988] (-2544.343) (-2545.315) (-2539.802) -- 0:00:51
      649000 -- [-2543.768] (-2542.603) (-2549.334) (-2548.539) * [-2541.728] (-2543.516) (-2543.910) (-2542.065) -- 0:00:51
      649500 -- (-2549.153) (-2545.251) (-2546.625) [-2544.328] * (-2545.948) [-2537.925] (-2539.825) (-2544.977) -- 0:00:51
      650000 -- (-2546.415) (-2548.991) (-2540.328) [-2545.934] * [-2539.792] (-2542.948) (-2548.121) (-2545.857) -- 0:00:51

      Average standard deviation of split frequencies: 0.000000

      650500 -- (-2544.842) [-2538.403] (-2542.790) (-2539.500) * [-2541.452] (-2544.308) (-2543.283) (-2538.067) -- 0:00:51
      651000 -- (-2544.484) (-2541.390) (-2543.273) [-2546.417] * (-2542.297) (-2549.500) (-2538.937) [-2540.048] -- 0:00:50
      651500 -- (-2545.624) [-2544.294] (-2543.845) (-2541.180) * (-2539.836) (-2548.363) (-2536.603) [-2544.563] -- 0:00:50
      652000 -- (-2542.856) (-2540.089) [-2539.664] (-2539.708) * (-2541.449) (-2542.155) (-2539.276) [-2538.849] -- 0:00:50
      652500 -- (-2544.385) (-2542.198) (-2546.508) [-2542.019] * (-2550.128) (-2539.709) [-2537.964] (-2545.030) -- 0:00:50
      653000 -- (-2539.671) [-2540.027] (-2544.349) (-2536.180) * (-2541.037) [-2549.642] (-2541.664) (-2541.094) -- 0:00:50
      653500 -- (-2543.619) (-2543.453) [-2541.303] (-2539.100) * (-2541.789) (-2551.965) (-2543.284) [-2540.968] -- 0:00:50
      654000 -- (-2543.285) (-2539.788) (-2548.403) [-2539.418] * [-2540.487] (-2541.081) (-2543.564) (-2540.842) -- 0:00:50
      654500 -- (-2545.256) [-2544.507] (-2545.619) (-2544.488) * (-2535.991) [-2543.220] (-2549.169) (-2544.504) -- 0:00:50
      655000 -- [-2541.117] (-2545.218) (-2546.918) (-2544.345) * (-2544.340) (-2545.474) [-2539.266] (-2547.230) -- 0:00:50

      Average standard deviation of split frequencies: 0.000000

      655500 -- [-2539.691] (-2549.679) (-2550.671) (-2547.620) * [-2541.918] (-2544.723) (-2541.640) (-2545.568) -- 0:00:50
      656000 -- (-2543.593) (-2546.216) [-2544.363] (-2545.161) * [-2539.050] (-2538.837) (-2544.034) (-2558.397) -- 0:00:50
      656500 -- [-2549.888] (-2546.883) (-2542.205) (-2553.769) * (-2549.145) (-2541.744) (-2542.061) [-2549.741] -- 0:00:50
      657000 -- (-2540.291) [-2541.358] (-2541.726) (-2547.846) * (-2544.049) (-2543.516) (-2546.643) [-2542.566] -- 0:00:50
      657500 -- (-2544.987) (-2538.892) (-2539.362) [-2543.780] * (-2546.715) [-2551.330] (-2545.849) (-2547.835) -- 0:00:50
      658000 -- (-2548.511) (-2538.950) [-2539.763] (-2549.677) * (-2544.975) [-2543.305] (-2544.752) (-2542.391) -- 0:00:49
      658500 -- (-2543.173) (-2541.879) (-2542.296) [-2542.939] * [-2540.384] (-2544.860) (-2541.430) (-2547.628) -- 0:00:49
      659000 -- (-2542.189) (-2540.897) [-2536.624] (-2541.324) * [-2544.972] (-2541.163) (-2541.429) (-2547.150) -- 0:00:49
      659500 -- (-2539.146) (-2549.761) (-2546.136) [-2539.468] * (-2538.658) (-2549.772) [-2542.287] (-2549.984) -- 0:00:49
      660000 -- (-2542.890) (-2546.523) (-2548.402) [-2543.084] * (-2541.885) [-2541.577] (-2541.316) (-2542.153) -- 0:00:49

      Average standard deviation of split frequencies: 0.000000

      660500 -- [-2544.117] (-2542.782) (-2543.943) (-2546.803) * (-2541.465) (-2540.592) [-2540.922] (-2549.839) -- 0:00:49
      661000 -- (-2541.530) (-2542.794) (-2552.275) [-2546.883] * (-2538.329) (-2541.999) (-2540.890) [-2545.076] -- 0:00:49
      661500 -- [-2541.264] (-2539.481) (-2545.398) (-2550.251) * [-2541.364] (-2542.408) (-2540.444) (-2547.715) -- 0:00:49
      662000 -- [-2541.111] (-2542.863) (-2546.846) (-2542.886) * (-2540.070) (-2542.594) [-2540.498] (-2551.636) -- 0:00:49
      662500 -- [-2547.676] (-2547.972) (-2546.325) (-2558.528) * (-2543.452) [-2542.224] (-2546.105) (-2547.867) -- 0:00:49
      663000 -- (-2547.181) (-2547.041) [-2546.298] (-2542.311) * (-2540.987) (-2541.497) (-2543.873) [-2541.854] -- 0:00:49
      663500 -- (-2546.946) (-2543.882) [-2544.479] (-2542.679) * (-2540.986) (-2549.940) [-2539.941] (-2535.646) -- 0:00:49
      664000 -- (-2541.862) (-2543.156) (-2543.442) [-2541.768] * (-2541.101) (-2548.009) (-2544.788) [-2539.028] -- 0:00:49
      664500 -- (-2541.894) (-2542.832) (-2542.068) [-2547.291] * [-2548.254] (-2544.150) (-2540.886) (-2541.138) -- 0:00:48
      665000 -- [-2541.108] (-2550.175) (-2537.573) (-2545.742) * [-2544.595] (-2541.711) (-2544.855) (-2549.333) -- 0:00:48

      Average standard deviation of split frequencies: 0.000000

      665500 -- (-2541.539) [-2541.598] (-2542.488) (-2542.649) * [-2540.705] (-2542.536) (-2541.921) (-2540.152) -- 0:00:48
      666000 -- (-2541.811) (-2542.555) [-2543.201] (-2541.668) * (-2540.751) [-2546.215] (-2545.700) (-2545.852) -- 0:00:48
      666500 -- (-2541.950) (-2543.171) (-2543.345) [-2539.904] * [-2543.264] (-2542.716) (-2542.806) (-2537.963) -- 0:00:48
      667000 -- (-2544.212) (-2540.766) [-2543.069] (-2544.840) * (-2555.883) (-2540.617) (-2541.642) [-2540.756] -- 0:00:48
      667500 -- (-2542.016) (-2543.415) (-2540.880) [-2545.654] * [-2543.769] (-2541.156) (-2540.547) (-2545.109) -- 0:00:48
      668000 -- (-2541.036) (-2542.719) [-2537.814] (-2542.187) * (-2545.615) (-2550.250) (-2541.771) [-2540.064] -- 0:00:48
      668500 -- (-2542.810) (-2536.587) [-2543.170] (-2544.151) * (-2539.901) (-2544.220) (-2542.012) [-2544.383] -- 0:00:48
      669000 -- [-2551.346] (-2538.049) (-2541.036) (-2545.364) * (-2541.351) (-2556.747) (-2539.071) [-2539.271] -- 0:00:48
      669500 -- (-2546.812) (-2545.370) (-2539.911) [-2543.983] * (-2549.282) (-2542.510) [-2541.033] (-2542.102) -- 0:00:48
      670000 -- (-2544.280) (-2545.762) [-2543.153] (-2544.529) * (-2543.439) [-2541.889] (-2542.551) (-2542.304) -- 0:00:48

      Average standard deviation of split frequencies: 0.000000

      670500 -- (-2544.121) (-2549.776) (-2544.069) [-2543.095] * [-2544.026] (-2538.715) (-2542.379) (-2539.105) -- 0:00:48
      671000 -- (-2547.331) [-2545.819] (-2547.607) (-2541.261) * (-2541.470) [-2539.285] (-2539.177) (-2541.692) -- 0:00:48
      671500 -- (-2544.576) (-2542.063) [-2542.754] (-2549.703) * [-2540.661] (-2544.359) (-2540.546) (-2541.935) -- 0:00:47
      672000 -- (-2545.179) [-2542.544] (-2545.477) (-2545.084) * (-2540.386) [-2539.802] (-2541.002) (-2542.126) -- 0:00:47
      672500 -- (-2544.820) (-2541.381) [-2547.003] (-2545.062) * (-2549.148) [-2545.933] (-2544.065) (-2541.932) -- 0:00:47
      673000 -- [-2543.173] (-2549.175) (-2546.991) (-2540.084) * (-2549.638) (-2545.754) [-2546.352] (-2541.908) -- 0:00:47
      673500 -- (-2545.290) (-2541.879) (-2552.707) [-2540.486] * (-2539.147) [-2542.954] (-2541.874) (-2544.211) -- 0:00:47
      674000 -- (-2545.556) [-2542.911] (-2549.561) (-2546.002) * (-2553.823) (-2554.134) [-2545.140] (-2540.434) -- 0:00:47
      674500 -- (-2544.871) (-2540.257) (-2544.029) [-2542.516] * (-2549.618) (-2545.095) [-2537.338] (-2539.912) -- 0:00:47
      675000 -- (-2549.865) [-2545.352] (-2536.759) (-2545.305) * (-2547.424) (-2553.493) (-2541.751) [-2535.769] -- 0:00:47

      Average standard deviation of split frequencies: 0.000000

      675500 -- [-2540.953] (-2536.679) (-2546.016) (-2546.229) * [-2540.170] (-2542.692) (-2540.269) (-2537.251) -- 0:00:47
      676000 -- (-2540.148) (-2547.762) [-2541.270] (-2543.860) * (-2535.176) [-2544.809] (-2540.287) (-2536.489) -- 0:00:47
      676500 -- (-2545.825) (-2548.796) (-2544.262) [-2544.440] * [-2541.327] (-2539.092) (-2538.691) (-2544.798) -- 0:00:47
      677000 -- (-2543.662) (-2548.060) (-2543.192) [-2540.308] * (-2542.216) [-2536.348] (-2545.979) (-2542.143) -- 0:00:47
      677500 -- (-2549.045) (-2550.141) (-2545.212) [-2542.427] * (-2538.523) [-2543.198] (-2545.073) (-2537.455) -- 0:00:47
      678000 -- [-2549.754] (-2545.164) (-2545.872) (-2540.567) * [-2540.308] (-2544.987) (-2539.043) (-2544.934) -- 0:00:47
      678500 -- (-2544.571) (-2552.742) [-2538.859] (-2544.524) * (-2545.653) [-2545.848] (-2536.477) (-2548.123) -- 0:00:46
      679000 -- (-2552.203) [-2541.115] (-2542.945) (-2547.314) * (-2546.525) (-2544.297) (-2546.216) [-2544.771] -- 0:00:46
      679500 -- (-2544.505) (-2541.021) (-2538.784) [-2540.356] * [-2542.077] (-2542.410) (-2539.955) (-2542.321) -- 0:00:46
      680000 -- (-2559.148) [-2546.315] (-2543.311) (-2544.997) * [-2543.429] (-2569.129) (-2543.863) (-2543.269) -- 0:00:46

      Average standard deviation of split frequencies: 0.000000

      680500 -- [-2543.483] (-2538.373) (-2542.160) (-2543.575) * (-2543.893) (-2543.491) (-2545.370) [-2545.312] -- 0:00:46
      681000 -- (-2547.297) [-2538.641] (-2546.146) (-2544.474) * (-2541.650) (-2547.621) [-2546.651] (-2546.309) -- 0:00:46
      681500 -- [-2539.058] (-2537.894) (-2548.101) (-2542.774) * (-2543.141) (-2544.926) (-2547.942) [-2542.251] -- 0:00:46
      682000 -- [-2539.789] (-2541.442) (-2545.264) (-2543.727) * [-2538.358] (-2544.789) (-2542.482) (-2548.644) -- 0:00:46
      682500 -- (-2539.695) [-2538.335] (-2544.962) (-2543.311) * [-2544.424] (-2540.224) (-2548.089) (-2546.201) -- 0:00:46
      683000 -- (-2538.516) (-2540.394) (-2544.192) [-2539.389] * (-2544.478) (-2540.069) (-2543.926) [-2546.734] -- 0:00:46
      683500 -- [-2541.549] (-2545.147) (-2540.372) (-2544.306) * [-2544.097] (-2544.274) (-2544.805) (-2537.354) -- 0:00:46
      684000 -- [-2539.671] (-2546.124) (-2538.197) (-2544.886) * (-2541.734) (-2545.656) (-2542.274) [-2544.167] -- 0:00:46
      684500 -- (-2546.810) (-2537.850) (-2542.926) [-2542.416] * (-2545.093) (-2543.836) [-2540.502] (-2539.943) -- 0:00:46
      685000 -- (-2544.691) [-2540.374] (-2545.901) (-2536.773) * [-2546.892] (-2547.508) (-2542.151) (-2541.351) -- 0:00:45

      Average standard deviation of split frequencies: 0.000000

      685500 -- [-2541.204] (-2546.619) (-2539.115) (-2539.871) * (-2544.283) (-2544.754) [-2540.188] (-2545.963) -- 0:00:45
      686000 -- (-2546.997) [-2544.385] (-2545.706) (-2542.381) * (-2543.739) (-2545.220) [-2541.968] (-2542.621) -- 0:00:45
      686500 -- (-2538.780) (-2546.781) (-2543.160) [-2543.117] * [-2542.015] (-2543.504) (-2542.085) (-2543.546) -- 0:00:45
      687000 -- [-2535.873] (-2540.191) (-2538.572) (-2544.577) * (-2544.114) (-2536.973) [-2548.700] (-2543.529) -- 0:00:45
      687500 -- [-2543.491] (-2542.693) (-2538.248) (-2548.000) * (-2545.043) (-2542.803) [-2546.473] (-2536.673) -- 0:00:45
      688000 -- (-2539.455) (-2539.714) [-2542.750] (-2545.085) * (-2539.433) (-2538.857) (-2541.405) [-2540.939] -- 0:00:45
      688500 -- (-2547.285) (-2542.889) (-2541.063) [-2540.916] * (-2547.061) (-2541.774) [-2544.061] (-2541.307) -- 0:00:45
      689000 -- (-2544.004) [-2542.528] (-2541.580) (-2538.061) * [-2540.151] (-2539.039) (-2547.548) (-2544.206) -- 0:00:45
      689500 -- (-2539.793) (-2541.079) (-2538.495) [-2543.229] * (-2540.254) (-2539.712) [-2541.171] (-2540.950) -- 0:00:45
      690000 -- (-2544.565) [-2539.706] (-2543.676) (-2547.003) * (-2546.265) (-2540.409) [-2545.276] (-2548.881) -- 0:00:45

      Average standard deviation of split frequencies: 0.000000

      690500 -- (-2544.416) (-2542.433) [-2552.427] (-2546.473) * (-2546.791) (-2543.651) (-2543.093) [-2541.248] -- 0:00:45
      691000 -- (-2543.605) [-2544.888] (-2553.670) (-2545.152) * (-2542.028) (-2552.204) (-2543.962) [-2540.730] -- 0:00:45
      691500 -- (-2543.071) (-2554.652) (-2551.261) [-2544.032] * (-2543.233) (-2543.556) [-2542.635] (-2544.558) -- 0:00:45
      692000 -- (-2549.765) (-2545.841) [-2552.337] (-2545.918) * (-2539.946) (-2544.367) [-2541.410] (-2556.472) -- 0:00:44
      692500 -- (-2549.597) (-2544.602) (-2543.993) [-2542.965] * (-2546.926) (-2541.032) (-2538.787) [-2548.511] -- 0:00:44
      693000 -- [-2540.796] (-2547.853) (-2545.088) (-2545.167) * (-2542.502) (-2543.211) (-2547.391) [-2542.280] -- 0:00:44
      693500 -- (-2543.180) [-2542.832] (-2546.443) (-2547.447) * (-2545.974) (-2548.453) (-2543.154) [-2548.563] -- 0:00:44
      694000 -- [-2543.451] (-2555.113) (-2539.208) (-2548.834) * (-2540.553) [-2542.149] (-2547.979) (-2557.558) -- 0:00:44
      694500 -- (-2545.303) (-2546.104) [-2540.470] (-2544.724) * (-2545.472) (-2540.374) [-2544.670] (-2545.618) -- 0:00:44
      695000 -- [-2542.921] (-2542.235) (-2540.118) (-2545.214) * (-2541.339) [-2550.063] (-2544.254) (-2543.654) -- 0:00:44

      Average standard deviation of split frequencies: 0.000000

      695500 -- (-2546.312) (-2539.698) (-2546.567) [-2541.729] * (-2540.584) [-2542.934] (-2538.089) (-2544.860) -- 0:00:44
      696000 -- (-2540.624) (-2540.235) (-2544.385) [-2541.706] * (-2543.272) [-2538.983] (-2539.831) (-2544.712) -- 0:00:44
      696500 -- (-2547.498) (-2537.361) [-2541.456] (-2541.677) * (-2543.936) (-2541.304) [-2542.644] (-2544.941) -- 0:00:44
      697000 -- [-2540.111] (-2539.908) (-2544.084) (-2542.531) * (-2542.342) (-2543.381) [-2543.865] (-2545.184) -- 0:00:44
      697500 -- (-2548.977) (-2542.447) (-2554.299) [-2538.416] * (-2541.121) (-2545.197) (-2547.953) [-2542.993] -- 0:00:44
      698000 -- [-2542.070] (-2542.357) (-2542.029) (-2544.870) * (-2539.588) [-2541.793] (-2541.103) (-2547.074) -- 0:00:44
      698500 -- (-2549.626) (-2543.317) [-2547.166] (-2543.907) * (-2546.261) (-2549.960) [-2540.101] (-2546.844) -- 0:00:44
      699000 -- (-2541.992) (-2540.736) (-2541.725) [-2540.714] * (-2544.370) [-2546.095] (-2542.833) (-2546.624) -- 0:00:43
      699500 -- (-2543.552) [-2537.524] (-2542.052) (-2549.836) * (-2552.294) [-2542.404] (-2544.977) (-2548.142) -- 0:00:43
      700000 -- (-2543.005) (-2542.012) (-2543.765) [-2538.976] * (-2545.976) [-2541.530] (-2551.843) (-2549.542) -- 0:00:43

      Average standard deviation of split frequencies: 0.000000

      700500 -- (-2542.016) (-2545.864) (-2551.698) [-2544.520] * [-2544.607] (-2543.966) (-2551.996) (-2546.313) -- 0:00:43
      701000 -- (-2541.695) (-2542.595) (-2548.576) [-2541.411] * (-2543.091) (-2543.840) [-2542.743] (-2546.139) -- 0:00:43
      701500 -- [-2537.954] (-2540.552) (-2545.826) (-2537.612) * (-2541.528) (-2540.618) [-2540.598] (-2539.858) -- 0:00:43
      702000 -- (-2542.789) [-2540.195] (-2540.776) (-2549.733) * (-2539.506) (-2540.322) [-2542.656] (-2549.040) -- 0:00:43
      702500 -- (-2540.006) (-2544.410) [-2536.220] (-2544.186) * (-2541.285) (-2546.609) (-2537.405) [-2540.473] -- 0:00:43
      703000 -- [-2539.959] (-2540.900) (-2544.382) (-2546.881) * (-2542.511) [-2542.161] (-2539.128) (-2547.362) -- 0:00:43
      703500 -- (-2539.804) (-2539.107) (-2544.487) [-2547.149] * (-2544.416) [-2542.974] (-2545.157) (-2545.725) -- 0:00:43
      704000 -- (-2543.398) (-2538.456) (-2544.925) [-2543.769] * (-2542.846) (-2542.196) (-2541.520) [-2542.609] -- 0:00:43
      704500 -- (-2538.816) (-2544.241) (-2543.672) [-2542.528] * [-2543.345] (-2543.061) (-2540.882) (-2541.940) -- 0:00:43
      705000 -- (-2541.581) (-2538.763) [-2544.225] (-2546.315) * (-2540.919) [-2547.937] (-2546.669) (-2543.581) -- 0:00:43

      Average standard deviation of split frequencies: 0.000000

      705500 -- (-2545.648) (-2542.159) (-2544.547) [-2543.992] * (-2538.769) (-2543.136) [-2546.316] (-2547.904) -- 0:00:42
      706000 -- [-2545.677] (-2540.113) (-2547.382) (-2546.657) * (-2550.989) (-2542.705) (-2544.368) [-2553.242] -- 0:00:42
      706500 -- (-2549.594) [-2543.350] (-2543.690) (-2542.807) * (-2542.094) [-2540.615] (-2537.847) (-2542.457) -- 0:00:42
      707000 -- (-2550.366) [-2548.954] (-2546.767) (-2538.119) * [-2539.670] (-2541.605) (-2541.658) (-2540.449) -- 0:00:42
      707500 -- (-2538.042) (-2542.450) (-2539.761) [-2541.595] * (-2546.224) [-2540.951] (-2541.971) (-2546.126) -- 0:00:42
      708000 -- (-2543.563) (-2545.367) (-2541.541) [-2541.212] * (-2539.702) (-2539.795) (-2548.789) [-2539.812] -- 0:00:42
      708500 -- (-2549.166) [-2546.573] (-2546.564) (-2540.693) * (-2540.807) [-2543.103] (-2542.528) (-2539.342) -- 0:00:42
      709000 -- (-2550.305) (-2539.691) (-2561.658) [-2541.883] * (-2543.601) (-2538.738) [-2542.671] (-2538.474) -- 0:00:42
      709500 -- (-2538.716) [-2541.123] (-2539.402) (-2541.911) * [-2548.028] (-2541.748) (-2556.128) (-2546.234) -- 0:00:42
      710000 -- (-2542.782) [-2537.509] (-2538.999) (-2540.323) * [-2544.692] (-2546.161) (-2542.751) (-2545.750) -- 0:00:42

      Average standard deviation of split frequencies: 0.000000

      710500 -- (-2540.296) (-2539.997) [-2539.687] (-2540.065) * (-2543.085) (-2557.135) [-2544.559] (-2544.015) -- 0:00:42
      711000 -- (-2545.493) (-2542.262) [-2541.712] (-2543.049) * (-2541.028) (-2541.018) [-2542.648] (-2543.520) -- 0:00:42
      711500 -- (-2540.996) (-2545.888) [-2537.413] (-2543.954) * [-2541.389] (-2546.870) (-2537.910) (-2538.657) -- 0:00:42
      712000 -- (-2538.612) [-2545.575] (-2547.988) (-2543.254) * (-2541.761) (-2542.669) [-2539.652] (-2545.415) -- 0:00:42
      712500 -- (-2541.468) (-2548.847) (-2540.984) [-2540.950] * [-2541.505] (-2542.825) (-2541.505) (-2548.595) -- 0:00:41
      713000 -- (-2546.196) [-2544.415] (-2546.646) (-2547.579) * (-2537.705) (-2544.555) (-2544.692) [-2548.179] -- 0:00:41
      713500 -- [-2543.350] (-2548.197) (-2540.692) (-2543.611) * [-2540.305] (-2543.837) (-2539.357) (-2542.864) -- 0:00:41
      714000 -- (-2545.326) (-2541.623) (-2539.168) [-2545.579] * (-2540.594) (-2545.918) (-2544.365) [-2542.617] -- 0:00:41
      714500 -- [-2544.491] (-2543.083) (-2544.903) (-2547.533) * (-2540.203) (-2546.252) [-2541.085] (-2552.919) -- 0:00:41
      715000 -- [-2543.815] (-2544.115) (-2540.223) (-2539.590) * [-2543.593] (-2547.165) (-2544.255) (-2549.653) -- 0:00:41

      Average standard deviation of split frequencies: 0.000000

      715500 -- (-2544.206) (-2544.184) (-2545.208) [-2541.048] * [-2541.492] (-2547.578) (-2546.750) (-2547.336) -- 0:00:41
      716000 -- (-2542.741) [-2545.029] (-2539.201) (-2549.761) * [-2540.918] (-2543.370) (-2540.177) (-2547.014) -- 0:00:41
      716500 -- (-2543.810) (-2544.990) [-2542.545] (-2543.943) * (-2547.184) (-2548.053) [-2540.624] (-2538.681) -- 0:00:41
      717000 -- [-2540.079] (-2539.493) (-2543.807) (-2541.917) * [-2542.652] (-2546.527) (-2541.457) (-2544.783) -- 0:00:41
      717500 -- [-2541.616] (-2546.897) (-2544.291) (-2538.964) * [-2539.489] (-2545.801) (-2543.812) (-2544.201) -- 0:00:41
      718000 -- (-2545.625) [-2542.130] (-2546.201) (-2541.782) * (-2539.494) (-2548.505) (-2538.160) [-2544.452] -- 0:00:41
      718500 -- (-2543.113) [-2544.829] (-2541.733) (-2538.430) * (-2543.584) (-2545.688) [-2540.059] (-2538.289) -- 0:00:41
      719000 -- (-2548.848) (-2542.681) (-2545.141) [-2539.923] * [-2546.924] (-2548.475) (-2542.732) (-2539.641) -- 0:00:41
      719500 -- (-2542.743) (-2543.514) [-2542.547] (-2548.375) * (-2544.509) [-2553.730] (-2537.840) (-2538.911) -- 0:00:40
      720000 -- (-2542.954) (-2544.591) (-2537.856) [-2546.149] * (-2544.538) (-2542.067) (-2539.709) [-2543.423] -- 0:00:40

      Average standard deviation of split frequencies: 0.000000

      720500 -- (-2541.575) (-2541.249) (-2543.664) [-2545.167] * [-2547.213] (-2537.775) (-2542.375) (-2541.929) -- 0:00:40
      721000 -- (-2538.857) (-2538.007) [-2541.936] (-2548.858) * (-2548.389) [-2545.137] (-2548.308) (-2544.884) -- 0:00:40
      721500 -- (-2537.460) [-2539.022] (-2539.700) (-2541.692) * (-2543.598) [-2543.194] (-2545.051) (-2539.100) -- 0:00:40
      722000 -- (-2551.858) (-2544.512) [-2541.886] (-2546.234) * [-2543.476] (-2546.051) (-2540.282) (-2539.594) -- 0:00:40
      722500 -- (-2548.015) (-2547.909) (-2540.242) [-2541.619] * [-2542.979] (-2542.464) (-2541.630) (-2540.620) -- 0:00:40
      723000 -- (-2542.619) [-2540.103] (-2539.039) (-2551.011) * (-2541.183) (-2545.142) (-2541.896) [-2542.530] -- 0:00:40
      723500 -- (-2543.924) (-2546.310) (-2544.329) [-2545.141] * (-2540.923) (-2547.178) (-2546.034) [-2540.628] -- 0:00:40
      724000 -- (-2542.574) [-2539.725] (-2543.513) (-2544.362) * (-2545.851) (-2541.477) [-2545.822] (-2541.903) -- 0:00:40
      724500 -- (-2539.798) (-2540.399) [-2541.663] (-2542.519) * (-2542.363) (-2548.389) (-2546.984) [-2544.401] -- 0:00:40
      725000 -- (-2544.781) [-2542.946] (-2545.204) (-2546.111) * (-2555.438) (-2544.457) [-2538.425] (-2539.841) -- 0:00:40

      Average standard deviation of split frequencies: 0.000000

      725500 -- [-2541.341] (-2545.769) (-2545.664) (-2541.624) * [-2543.070] (-2539.854) (-2549.869) (-2544.762) -- 0:00:40
      726000 -- (-2541.209) (-2544.032) (-2541.895) [-2543.374] * (-2540.116) (-2541.341) [-2538.081] (-2543.957) -- 0:00:40
      726500 -- (-2544.207) (-2544.266) [-2545.358] (-2544.736) * (-2544.762) (-2540.405) [-2540.972] (-2550.162) -- 0:00:39
      727000 -- (-2538.562) (-2542.164) (-2547.178) [-2548.840] * (-2544.862) (-2540.779) [-2545.272] (-2545.715) -- 0:00:39
      727500 -- [-2543.297] (-2537.286) (-2539.767) (-2545.530) * [-2541.676] (-2544.305) (-2545.442) (-2535.132) -- 0:00:39
      728000 -- [-2535.802] (-2552.087) (-2547.908) (-2544.784) * [-2537.531] (-2544.865) (-2543.080) (-2542.678) -- 0:00:39
      728500 -- (-2546.499) (-2541.449) [-2540.634] (-2539.566) * (-2541.138) (-2541.245) [-2544.899] (-2556.347) -- 0:00:39
      729000 -- (-2545.877) [-2546.305] (-2538.444) (-2548.967) * [-2539.364] (-2546.221) (-2547.503) (-2543.524) -- 0:00:39
      729500 -- (-2545.012) [-2537.847] (-2541.891) (-2550.317) * [-2537.941] (-2543.180) (-2548.309) (-2541.330) -- 0:00:39
      730000 -- (-2552.240) (-2543.960) (-2546.700) [-2543.215] * [-2540.359] (-2542.773) (-2548.631) (-2538.902) -- 0:00:39

      Average standard deviation of split frequencies: 0.000000

      730500 -- (-2549.523) (-2541.076) (-2547.613) [-2542.676] * (-2544.664) [-2543.787] (-2546.413) (-2543.324) -- 0:00:39
      731000 -- (-2549.530) (-2550.655) [-2545.924] (-2543.982) * (-2549.177) (-2540.344) (-2541.520) [-2544.560] -- 0:00:39
      731500 -- (-2551.353) [-2547.453] (-2545.141) (-2551.481) * (-2548.588) (-2543.352) [-2541.894] (-2548.746) -- 0:00:39
      732000 -- [-2545.947] (-2546.869) (-2549.776) (-2542.158) * [-2547.505] (-2554.910) (-2544.490) (-2551.318) -- 0:00:39
      732500 -- (-2547.671) (-2537.865) (-2543.919) [-2543.276] * (-2543.550) (-2543.522) (-2547.032) [-2544.262] -- 0:00:39
      733000 -- (-2540.680) [-2540.553] (-2554.185) (-2538.427) * (-2538.707) (-2547.706) [-2536.627] (-2544.373) -- 0:00:38
      733500 -- [-2543.307] (-2543.073) (-2537.831) (-2542.545) * [-2541.163] (-2547.752) (-2542.981) (-2546.885) -- 0:00:38
      734000 -- [-2545.915] (-2541.346) (-2538.463) (-2543.051) * (-2546.957) (-2547.148) (-2540.228) [-2544.085] -- 0:00:38
      734500 -- (-2549.920) (-2539.379) (-2540.554) [-2540.342] * (-2551.315) (-2549.801) [-2541.948] (-2542.216) -- 0:00:38
      735000 -- (-2552.587) (-2546.544) (-2540.720) [-2541.564] * (-2547.407) (-2543.633) [-2539.544] (-2546.742) -- 0:00:38

      Average