--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 11:37:26 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/444/ZnT49B-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4385.51         -4399.48
2      -4385.53         -4396.75
--------------------------------------
TOTAL    -4385.52         -4398.85
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.284156    0.000796    0.232136    0.342749    0.281584   1094.63   1246.73    1.000
r(A<->C){all}   0.081431    0.000344    0.048656    0.120095    0.080413   1079.64   1120.70    1.000
r(A<->G){all}   0.279815    0.001337    0.213603    0.353006    0.278403    934.28    995.91    1.002
r(A<->T){all}   0.090277    0.000465    0.052410    0.135288    0.088815   1054.74   1092.64    1.000
r(C<->G){all}   0.047966    0.000211    0.022701    0.077552    0.046593   1173.59   1199.95    1.000
r(C<->T){all}   0.425464    0.001734    0.343121    0.505085    0.424703    691.76    767.62    1.001
r(G<->T){all}   0.075047    0.000320    0.042005    0.109537    0.074232    907.13   1076.45    1.000
pi(A){all}      0.249501    0.000089    0.229292    0.266576    0.249513    878.96   1110.79    1.000
pi(C){all}      0.239476    0.000086    0.221698    0.257454    0.239174   1198.86   1269.10    1.000
pi(G){all}      0.273494    0.000093    0.253775    0.291558    0.273501   1089.39   1238.38    1.000
pi(T){all}      0.237529    0.000081    0.220200    0.254929    0.237655   1067.37   1158.53    1.000
alpha{1,2}      0.047437    0.001117    0.000154    0.108844    0.042116   1183.00   1245.68    1.000
alpha{3}        2.856479    0.788052    1.281778    4.621647    2.730484   1466.39   1483.70    1.000
pinvar{all}     0.473126    0.002496    0.381943    0.580677    0.476065   1346.70   1423.85    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4174.868394
Model 2: PositiveSelection	-4174.868394
Model 0: one-ratio	-4196.430541
Model 3: discrete	-4174.486051
Model 7: beta	-4174.68504
Model 8: beta&w>1	-4174.584257


Model 0 vs 1	43.12429399999928

Model 2 vs 1	0.0

Model 8 vs 7	0.20156599999972968
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAVGL
GESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAPVI
PLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQEP
PMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLFTV
KRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGW
LYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYV
SSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGA
TLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAA
ACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASER
LEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDK
QDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFP
EIRHVDLEILoo
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKYDLPPVTKVAASAINLRSTSTGVATGAVGLGESSG
SVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAPVIPLKRP
RFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQEPPMTVY
WRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQIYDSADLFTVKRRLR
DYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYSGS
HSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSLIS
GVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLVVA
INELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACMGL
SSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEKIN
SALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDLAK
LLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIRHV
DLEILooooooo
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAVGL
GESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAPVI
PIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQEP
PMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLFTV
KRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGW
LYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYV
SSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGA
TLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAA
ACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASER
LEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDK
QDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFP
EIRHVDLEILoo
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDSKKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAVGL
GSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAPVI
PPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQEP
PMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQIYDSADLFTV
KRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGW
LYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYV
SSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGA
TLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAG
ACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASER
LEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDK
QDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFP
EIRHVDLEILoo
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=669 

C1              MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
C2              MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
C3              MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
C4              MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
C5              MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
                *************:*:*******:**:*.  .*:*:** :** ******.

C1              TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKE--TKNFEVKTTKGILS
C2              MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKE--TKNFEVKTTKGILS
C3              MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRE--TKNFEVKTTKGILS
C4              TFLQFRCSANDS--KKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
C5              MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
                 *********.*  *:::*:*:*:*:*.****:*  **************

C1              ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
C2              ISTTIEDSKINEIVFEKYDLPPVTKV-----AASAINLRSTSTGVATGAV
C3              ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
C4              ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
C5              ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
                ***************** ****::**     .*.******:* .:. ***

C1              GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
C2              GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
C3              GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
C4              GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
C5              GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
                *** .***::******.*..*** :.*.*:*:*.*  ** ******* **

C1              VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
C2              VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
C3              VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
C4              VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
C5              VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
                **. ********************************* ************

C1              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
C2              EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQIYDSADLF
C3              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
C4              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQIYDSADLF
C5              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
                *****************:***************:****************

C1              TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
C2              TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
C3              TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
C4              TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
C5              TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
                **************************************************

C1              GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
C2              GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
C3              GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
C4              GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
C5              GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
                **************************************************

C1              YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
C2              YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
C3              YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
C4              YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
C5              YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
                **************************************************

C1              GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
C2              GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
C3              GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
C4              GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
C5              GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
                ********************:*****************************

C1              AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
C2              AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
C3              AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
C4              AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
C5              AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
                *.************************************************

C1              ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
C2              ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
C3              ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
C4              ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
C5              ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
                **************************************************

C1              DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
C2              DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
C3              DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
C4              DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
C5              DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
                *************.************************************

C1              FPEIRHVDLEILoo-----
C2              FPEIRHVDLEILooooooo
C3              FPEIRHVDLEILoo-----
C4              FPEIRHVDLEILoo-----
C5              FPEIRHVDLEIL-------
                ************       




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  662 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  662 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13508]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [13508]--->[13406]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/ZnT49B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.376 Mb, Max= 30.931 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILoo-----
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKYDLPPVTKV-----AASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILooooooo
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILoo-----
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDS--KKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILoo-----
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL-------

FORMAT of file /tmp/tmp2607628228815009019aln Not Supported[FATAL:T-COFFEE]
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILoo-----
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKYDLPPVTKV-----AASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILooooooo
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILoo-----
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDS--KKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEILoo-----
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL-------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:669 S:99 BS:669
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.56 C1	 C2	 97.56
TOP	    1    0	 97.56 C2	 C1	 97.56
BOT	    0    2	 97.89 C1	 C3	 97.89
TOP	    2    0	 97.89 C3	 C1	 97.89
BOT	    0    3	 94.09 C1	 C4	 94.09
TOP	    3    0	 94.09 C4	 C1	 94.09
BOT	    0    4	 93.18 C1	 C5	 93.18
TOP	    4    0	 93.18 C5	 C1	 93.18
BOT	    1    2	 98.48 C2	 C3	 98.48
TOP	    2    1	 98.48 C3	 C2	 98.48
BOT	    1    3	 93.44 C2	 C4	 93.44
TOP	    3    1	 93.44 C4	 C2	 93.44
BOT	    1    4	 93.59 C2	 C5	 93.59
TOP	    4    1	 93.59 C5	 C2	 93.59
BOT	    2    3	 93.79 C3	 C4	 93.79
TOP	    3    2	 93.79 C4	 C3	 93.79
BOT	    2    4	 93.64 C3	 C5	 93.64
TOP	    4    2	 93.64 C5	 C3	 93.64
BOT	    3    4	 94.55 C4	 C5	 94.55
TOP	    4    3	 94.55 C5	 C4	 94.55
AVG	 0	 C1	  *	 95.68
AVG	 1	 C2	  *	 95.77
AVG	 2	 C3	  *	 95.95
AVG	 3	 C4	  *	 93.96
AVG	 4	 C5	  *	 93.74
TOT	 TOT	  *	 95.02
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTGGG
C2              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
C3              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
C4              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCATCACTTCGG
C5              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
                ***************************************** ***** **

C1              AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGACGGCAGGAACCCTTGGA
C2              AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
C3              AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
C4              AAAGGCTTTTAGCCAGTGCACCTTGCGCCACGATGCCAGAATCTCCTGGA
C5              AAAGGCTTTTAGCCAGTGCTCCTTGCGCCAAGATGCCAGTTATCCCTGGA
                *******************:****.** **.** * *** ::  * ****

C1              GGCGGCATGACGGCGAGGCATTCAAACTACAGCCGTGGAAGCGACCAAGC
C2              GGCGGCATGACGGCGAGGCATTCAAAATACAGCCGTGGAAGCGACCAAGC
C3              GGCGGCATGACGGCGAGGCGTTTAAACTACAGCCGTGGAAGCGACCAGAC
C4              GGAGGAATGACGGCGAGTCATTCAAACTACAACCGTGGAAGCGACCAAGC
C5              AGCGGAATGACGGCGTGTCATTCAAGCAACAACCGTGGAAGCGCCCAAGC
                .*.**.*********:* *.** **..:***.***********.***..*

C1              ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGGCAGTGATTCCAAGAAGGA
C2              ATGTTCCTTCAGTTTCGCTGCAGCGCCAATGACAGTGATTCCAAGAAGGA
C3              ATGTTCCTTCAGTTTCGCTGCAGTGCCAATGGCAGTGATTCCAAGAAGGA
C4              ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGATTCG------AAAAAGGA
C5              ATGTTCCTGCAGTTTCGCTGTAGCGCCAATGACAGTGATTCCAAGAGGGA
                * ****** *********** ** *******. :        **.*.***

C1              AAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAAGG
C2              GAAACCTGTGCAGAAGGAGACCACCGCTGGTCCAGTTGCCAAGCCAAAGG
C3              TAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAGGG
C4              CCAACCTTTGCAGGAGGAGTCCACCACTGGTTCAGTTGCCAAACCAAAGG
C5              CAAACCTCTGCAGGAGGAGTCCACCGCTGGTGCAGTCGCCAAACCAAAGG
                 .***** *****.***** *****.***** **** *****.****.**

C1              AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGCATCCTGTCT
C2              AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
C3              AA------ACGAAAAATTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
C4              AGAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTCTCT
C5              AAAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTGTCT
                *.      ******** **************.******** ***** ***

C1              ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
C2              ATCAGCACCACCATCGAGGACTCCAAAATTAACGAAATTGTGTTTGAAAA
C3              ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
C4              ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
C5              ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
                **************************.********.**************

C1              ATCCGATCTGCCACCGGTAACGAAGGTGAAAGAGCCGGTTTTGGCCGCAA
C2              ATACGATCTACCACCGGTAACCAAGGTG---------------GCCGCAA
C3              ATCCGATCTACCACCGGTAACCAAGGTGAAAGAGCCGGTTTTGGCCGCAA
C4              ATCCGATCTGCCACCGCTAGCCAAGGTGAAAGAGCCGGTATTGGCCGCAG
C5              ATCCGATCTACCGCCGCTAACCAAGGTGAAAGAGCCAGCATTGGTCGCAG
                **.******.**.*** **.* ******               * ****.

C1              GTGCCATTAATCTACGTTCTACGTCTACTGGAGTAGCAACTGGTGCTGTA
C2              GTGCCATTAATCTACGATCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
C3              GTGCCATTAATCTACGTTCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
C4              GGGCTATCAATCTGCGTTCCAGCTCCATTGCAGTAGCAGCTGGTGCTGTG
C5              GGGCCATCAATCTACGTTCCAGCTCCACTGCATTGGGAATTGGTGCTGTG
                * ** ** *****.**:** *  ** * ** * *.* *. ********* 

C1              GGATTGGGAGAGAGCTCTGGTTCTGTTATGAATCCTCCTGAAACAGTGAA
C2              GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
C3              GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
C4              GGATTGGGAAGTGGCTCTGGTTCAATTATGAATCCACCTGAAACAGTGAC
C5              GGATTGGGAGGGGCTTCTGGCTCCATTTTGAATCCTCCTGAAACAGTGAC
                *********.. .  ***** ** .**:*.*****:*************.

C1              AAGCGCACCTAAAAATTCTCCGTCTGGTGCTGTGCTAGCTGAAAAGGCGG
C2              AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
C3              AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
C4              AAGCCCAACTAAAAATTCTTTAGCTGGTGCTGTGCTAGCTGAAAAGGCAG
C5              AAGCGCAACTAAAAATTCTCCGGCTGATGCTGTGCTATCTGAAAGGGCCG
                **** ** ***********  . ***.***** **** ******.*** *

C1              GAGAAGGTATTCGAACATCCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
C2              GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
C3              GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
C4              GAGAGGCTAGTCGAACAGGCCCACCTGCAGAGGTGACGCCTCCAGCGCCT
C5              CAGAAGTTAGTCGAACATGCCCACCTGCAGAGGTGACGCCTCTAGCGCCT
                 .**.* ** *******  ***************.******* *******

C1              GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
C2              GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
C3              GTGATTCCTATAAAGCGACCCCGATTCGATTATCGAGCTTCCCTAGAGCG
C4              GTGATTCCTCCAAAGCGACCACGTTTCGATTATCGTGCTTCCCTAGAGCG
C5              GTGATTTCTCCAAAGCGACCCCGTTTCGATTATCGTGCTTCCCTAGAGCG
                ****** **. *********.**:***********:**************

C1              CAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGTTGACCGCTG
C2              AAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGCTGACCGCCG
C3              CAACTTTGTGACCCCCAACCGCGCCATCAGCGATTTCTTGCTAACCGCCG
C4              CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGCTGACCGCTG
C5              CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGTTGACCGCTG
                .******************.* ****************** *.***** *

C1              CTCAACTCGAAAGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
C2              CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
C3              CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
C4              CTCAACTCGAGAATCTGCCCAAGATTAAGCGAAGATCGCCGTACGAGCAG
C5              CTCAACTGGAGTGTCTGCCCAAAATTAAGCGGAGATCGCCGTACGAGCAG
                ******* **.:.*********.** *****.******************

C1              GAGCCACCCATGACTGTCTACTGGCGACGGGATGTGGAGGCTAAGGCCGT
C2              GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAGGCTAAGGCCGT
C3              GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAAGCTAAGGCAGT
C4              GAGCCACCCATGACTGTTTACTGGCGTCGCGATGTGGAAGCTAAGGCTGT
C5              GAGCCGCCCATGACGGTCTACTGGCGACGCGATGTTGAAGCTAAGGCTGT
                **.**.******** ** ********:** ** ** **.******** **

C1              CGAAGTGTGGGGGTCCAAGGAAAATCTGTTGCGGGAGCGACTCAAGCGGG
C2              AGACGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
C3              AGAAGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
C4              AGAAGTGTGGGGATCCAAGGAAAACCTGTTGCGGGAACGACTTAAGCGGG
C5              GGAGGTGTGGGGATCCAAGGAAAACCTGTTACGGGAACGACTCAAGCGGG
                 ** ** *****.** *****.** *****.*****.***** *******

C1              AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
C2              AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
C3              AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
C4              ATGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
C5              AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
                * ************************************************

C1              ACTGTTAAACGGCGGTTGCGTGACTACCGCAGGGAAATGGGATCTCGAAC
C2              ACTGTCAAACGGCGGTTGCGTGACTACCGCAGGGAGATGGGATCTCGAAC
C3              ACTGTCAAACGGCGGTTGCGCGACTACCGCAGGGAGATGGGATCTCGAAC
C4              ACTGTCAAACGGCGGTTGCGCGACTACCGCAGAGAGATGGGTTCTCGAAC
C5              ACTGTCAAACGGCGGTTGCGCGACTACCGCAGGGAGATGGGATCTCGGAC
                ***** ************** ***********.**.*****:*****.**

C1              CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGG
C2              CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGG
C3              CAAAGTAATGCTCGACAACAGAAAGGAGTCTGAGAAGTCCGGGCAAGTGG
C4              CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGACAAGTGG
C5              CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGG
                ****************************** ***********.*******

C1              TGGCCACCGCCATCGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
C2              TGGCCACCGCCATCGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
C3              TGGCCACCGCCATTGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
C4              TTGCCACCGCCATCGCTATCAATGCAGCTAATTTGCTTTTCAAAGCAGGA
C5              TGGCCACCGCCATCGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
                * *********** ************** **************.******

C1              GGTTGGCTGTACAGCGGTTCTCACAGCATGTTTGCAGAAGTTATCCATTC
C2              GGTTGGCTGTACAGCGGTTCTCACAGCATGTTTGCAGAGGTTATCCATTC
C3              GGTTGGCTGTACAGCGGTTCCCACAGCATGTTTGCGGAGGTTATCCATTC
C4              GGCTGGCTGTACAGCGGTTCTCACAGCATGTTTGCGGAGGTTATCCATTC
C5              GGTTGGCTGTACAGCGGTTCCCACAGCATGTTTGCGGAGGTTATCCATTC
                ** ***************** **************.**.***********

C1              TTTGGCCGACTTAATCAACCAGCTCATCCTCGCGTTTGGCATCTACAAGT
C2              TTTGGCCGACTTAATCAACCAGCTCATCCTCGCCTTTGGCATCTACAAGT
C3              TTTGGCCGACTTAATCAACCAGCTCATCCTCGCATTTGGCATCTACAAGT
C4              ATTGGCCGACCTAATCAACCAGCTAATTCTCGCCTTTGGCATCTACAAGT
C5              TTTGGCCGACCTAATCAACCAGCTCATTCTCGCCTTTGGCATTTACAAGT
                :********* *************.** ***** ******** *******

C1              CCTCTCAGAGTCCCGATATAGATCATCCATATGGATACATGAACATGCGA
C2              CCTCTCAGAGTCCCGATATAGATCATCCTTATGGATATATGAACATGAGA
C3              CCTCTCAGAGTCCCGATATAGATCATCCTTATGGATATATGAACATGAGA
C4              CCTCTCAGAGTCCGGACATAGATCATCCTTATGGATACATGAACATGCGT
C5              CATCTCAGAGTCCGGACATAGATCATCCTTATGGATACATGAACATGCGA
                *.*********** ** ***********:******** *********.*:

C1              TATGTTTCCTCGCTGATTTCGGGCGTTGGCATCTTTTGCGTTGGCTGTGG
C2              TATGTTTCCTCGCTGATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGG
C3              TATGTTTCCTCGCTGATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGG
C4              TATGTATCCTCGCTGATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGG
C5              TATGTGTCCTCGCTGATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGG
                ***** *********************** **.***** **:********

C1              CCTGTCCATATACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
C2              CCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
C3              CCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
C4              CCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
C5              GCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
                 ********.****************************************

C1              CAGATCTATTTTGGGTGTACTGTATCTTGATGGGATCATTAGTTTCTGAG
C2              CAGATCTGTTTTGGGTGTATTGTATCTTGATGGGATCATTGGTTTCTGAG
C3              CAGATCTGTTTTGGGTGTACTGCATCTTGATGGGATCATTAGTTTCTGAG
C4              CAGATCTGTTTTGGGTATACTGCATCTTAATGGGATCGCTGGTTTCTGAG
C5              CCGATCTGTTTTGGGTGTATTGCATCTTAATGGGATCGTTAGTTTCTGAG
                *.*****.********.** ** *****.********. *.*********

C1              GGAGCCACATTGGTGGTGGCCATTAATGAGCTTAAGCGATCGGCTAAGGA
C2              GGAGCCACTTTGGTGGTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGA
C3              GGAGCCACTTTGGTGGTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGA
C4              GGAGCTACTTTGGTGGTAGCCATCAATGAGCTTAAACGATCGGCCAAGGA
C5              GGAGCCACTCTGGTGGTGGCCATCAATGAGCTTAAACGATCGGCCAAGGA
                ***** **: *******.***** ***********.******** *****

C1              AAACAATATGTCCTTTAAGGATTATGTGATTTCTGGCAAGGATCCGTGCG
C2              AAACAATATGTCCTTTAAGGATTATGTGATTTCTGGCAAGGATCCGTGCG
C3              AAACAATATGTCCTTTAAGGATTATGTCATTTCTGGCAAGGATCCGTGCG
C4              AAACAATATGACCTTTAAAGATTATGTGATTTCTGGCAAGGATCCGTGCG
C5              AAACAATATGACCTTTAAAGATTATGTAATTTCTGGCAAGGATCCATGCG
                **********:*******.******** *****************.****

C1              TGAATGTGGTGCTGTGTGAAGACGCTGCAGCGGTAACTGGCGTTATGGTG
C2              TGAATGTGGTGCTATGTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTG
C3              TGAATGTGGTGCTGTGTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTG
C4              TAAATGTGGTGCTGTGCGAAGATGCTGCAGCTGTAACTGGCGTTATGGTG
C5              TGAATGTGGTGCTGTGCGAAGACGCTGCAGCTGTAACTGGCGTTATGGTG
                *.***********.** ***** ******** *********** ******

C1              GCTGCAGCTTGCATGGGATTAAGTAGTTACACAGGATCGCCCATCTTCGA
C2              GCTGCAGCTTGCATGGGATTAAGTAGTTACACAGGATCGCCCATCTTTGA
C3              GCGGCAGCTTGCATGGGATTAAGTAGTTACACAGGATCGCCCATCTTTGA
C4              GCTGGAGCCTGTATGGGATTAAGTAGTTACACAGGATCCCCCATTTTCGA
C5              GCTGGAGCTTGTATGGGATTGAGTAGTTACACAGGATCGCCCATCTTCGA
                ** * *** ** ********.***************** ***** ** **

C1              CGCCGCTGGTTCACTGGTTATAGGTGCTCTTCTGGGCGCTGTGGCCTCTT
C2              CGCCGCTGGATCACTGGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCT
C3              CGCCGCTGGATCACTGGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCT
C4              CGCCGCTGGATCACTGGTTATAGGTGCTCTTCTGGGCGCTGTGGCTTCTT
C5              CGCCGCTGGATCACTGGTTATAGGTGCTCTCCTGGGTGCTGTGGCCTCTT
                *********:******************** ***** ** ***** ** *

C1              TTATTATTTATACAAATGCCAATGCGTTGGTGGGGATATCCATTGCTTCC
C2              TTATCATTTATACAAATGCTAATGCGCTGGTGGGGATATCCATTGCTTCC
C3              TTATCATTTATACAAATGCTAATGCGCTGGTGGGGATATCCATCGCTTCC
C4              TTATCATTTATACAAATGCTAATGCGCTGGTAGGGATATCCATTGCTTCC
C5              TTATCATTTATACAAATGCCAATGCGCTGGTAGGAATATCCATTGCATCC
                **** ************** ****** ****.**.******** **:***

C1              GAGCGCCTAGAAAAGATTAACTCTGCTTTGGAGGCTGATGTAATGATCAG
C2              GAGCGCCTAGAAAAGATTAATTCTGCCTTGGAGGCTGATGTGATGATCAG
C3              GAGCGCCTAGAAAAGATTAATTCTGCTTTGGAGGCTGATGTGATGATCAG
C4              GAGCGCCTAGAAAAAATTAATTCTGCTTTGGAGGCTGATGTGATGATCAG
C5              GAGCGCCTAGAAAAGATAAATTCTGCTTTGGAGGCTGATGTGATGATCAG
                **************.**:** ***** **************.********

C1              AGCGATTTACGATGTCAAGGGAATCGATATTGGCAATGCTCGGGTTCGGT
C2              AGCGATTTACGATGTCAAGGGAATCGACATTGGCAATGCTCGGGTTCGGT
C3              AGCGATTTACGATGTCAAGGGAATCGACATTGGCAACGCTCGGGTTCGGT
C4              AGCGATTTACGATGTCAAGGGAATCGATATTGGCAACGCTCGGGTTCGGT
C5              AGCGATTTACGATGTCAAGGGAATCGATATTGGCAACGCTCGAGTTCGTT
                *************************** ******** *****.***** *

C1              ATAAGGCTGAGCTCGACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTG
C2              ATAAGGCTGAGCTCGACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTG
C3              ATAAGGCTGAGCTCGACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTG
C4              ATAAGGCTGAACTCGATTTTGACGGCCGTGAGTTGACGCGTTCGTATCTG
C5              ATAAGGCTGAGCTTGACTTCGATGGCCGTGAGCTGACGCGTTCGTATCTG
                **********.** ** ** ** ********* **** ************

C1              GACAAACAGGATCTCGCAAAACTGCTCACGACGGTTCGAGGCTTTCAAAA
C2              GACAAACAGGATCTCGCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAA
C3              GACAAACAGGATCTCGCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAA
C4              GACAAACAGGATCTCGCAAAACTGCTCACTACTGTTCGAGGCTTTCAAAA
C5              GATAAACAGGATCTCGCAAAACTGCTCACAACTGTTCGAGGCTTTCAAAA
                ** ************************** ** ******.**** *****

C1              GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
C2              GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
C3              GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
C4              GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
C5              GGTTGAGGATCTGGAGAGCTTTTTGCTGGATCAAGGCGAAAACATTGTGG
                ********************** ***************************

C1              ACCTGATGGGCGGCGAAATTGATCGCATTGAGATGAACTTGCGGACACAA
C2              ACCTGATGGGCGGTGAAATTGATCGCATTGAGATGAATCTGCGGACACAA
C3              ACCTGATGGGCGGTGAAATTGATCGCATTGAGATGAATCTGCGGACACAA
C4              ACCTGATGGGCGGCGAAATTGATCGCATTGAGATGAACTTGCGGACACAA
C5              ACCTGATGGGCGGTGAGATTGATCGCATTGAGATGAACCTGCGGACACAA
                ************* **.********************  ***********

C1              TTCCCGGAAATACGCCATGTGGACCTGGAAATACTC--------------
C2              TTTCCGGAAATACGCCATGTGGACCTGGAAATACTC--------------
C3              TTTCCGGAAATACGCCATGTGGACCTGGAAATACTC--------------
C4              TTCCCGGAAATACGTCATGTGGACCTGGAAATACTC--------------
C5              TTTCCGGAAATACGTCATGTGGACCTGGAAATACTC--------------
                ** *********** *********************              

C1              -------
C2              -------
C3              -------
C4              -------
C5              -------
                       



>C1
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTGGG
AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGACGGCAGGAACCCTTGGA
GGCGGCATGACGGCGAGGCATTCAAACTACAGCCGTGGAAGCGACCAAGC
ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGGCAGTGATTCCAAGAAGGA
AAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAAGG
AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGCATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
ATCCGATCTGCCACCGGTAACGAAGGTGAAAGAGCCGGTTTTGGCCGCAA
GTGCCATTAATCTACGTTCTACGTCTACTGGAGTAGCAACTGGTGCTGTA
GGATTGGGAGAGAGCTCTGGTTCTGTTATGAATCCTCCTGAAACAGTGAA
AAGCGCACCTAAAAATTCTCCGTCTGGTGCTGTGCTAGCTGAAAAGGCGG
GAGAAGGTATTCGAACATCCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGTTGACCGCTG
CTCAACTCGAAAGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
GAGCCACCCATGACTGTCTACTGGCGACGGGATGTGGAGGCTAAGGCCGT
CGAAGTGTGGGGGTCCAAGGAAAATCTGTTGCGGGAGCGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
ACTGTTAAACGGCGGTTGCGTGACTACCGCAGGGAAATGGGATCTCGAAC
CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGG
TGGCCACCGCCATCGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
GGTTGGCTGTACAGCGGTTCTCACAGCATGTTTGCAGAAGTTATCCATTC
TTTGGCCGACTTAATCAACCAGCTCATCCTCGCGTTTGGCATCTACAAGT
CCTCTCAGAGTCCCGATATAGATCATCCATATGGATACATGAACATGCGA
TATGTTTCCTCGCTGATTTCGGGCGTTGGCATCTTTTGCGTTGGCTGTGG
CCTGTCCATATACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
CAGATCTATTTTGGGTGTACTGTATCTTGATGGGATCATTAGTTTCTGAG
GGAGCCACATTGGTGGTGGCCATTAATGAGCTTAAGCGATCGGCTAAGGA
AAACAATATGTCCTTTAAGGATTATGTGATTTCTGGCAAGGATCCGTGCG
TGAATGTGGTGCTGTGTGAAGACGCTGCAGCGGTAACTGGCGTTATGGTG
GCTGCAGCTTGCATGGGATTAAGTAGTTACACAGGATCGCCCATCTTCGA
CGCCGCTGGTTCACTGGTTATAGGTGCTCTTCTGGGCGCTGTGGCCTCTT
TTATTATTTATACAAATGCCAATGCGTTGGTGGGGATATCCATTGCTTCC
GAGCGCCTAGAAAAGATTAACTCTGCTTTGGAGGCTGATGTAATGATCAG
AGCGATTTACGATGTCAAGGGAATCGATATTGGCAATGCTCGGGTTCGGT
ATAAGGCTGAGCTCGACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTG
GACAAACAGGATCTCGCAAAACTGCTCACGACGGTTCGAGGCTTTCAAAA
GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
ACCTGATGGGCGGCGAAATTGATCGCATTGAGATGAACTTGCGGACACAA
TTCCCGGAAATACGCCATGTGGACCTGGAAATACTC--------------
-------
>C2
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
GGCGGCATGACGGCGAGGCATTCAAAATACAGCCGTGGAAGCGACCAAGC
ATGTTCCTTCAGTTTCGCTGCAGCGCCAATGACAGTGATTCCAAGAAGGA
GAAACCTGTGCAGAAGGAGACCACCGCTGGTCCAGTTGCCAAGCCAAAGG
AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAAATTAACGAAATTGTGTTTGAAAA
ATACGATCTACCACCGGTAACCAAGGTG---------------GCCGCAA
GTGCCATTAATCTACGATCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
AAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGCTGACCGCCG
CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAGGCTAAGGCCGT
AGACGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
ACTGTCAAACGGCGGTTGCGTGACTACCGCAGGGAGATGGGATCTCGAAC
CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGG
TGGCCACCGCCATCGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
GGTTGGCTGTACAGCGGTTCTCACAGCATGTTTGCAGAGGTTATCCATTC
TTTGGCCGACTTAATCAACCAGCTCATCCTCGCCTTTGGCATCTACAAGT
CCTCTCAGAGTCCCGATATAGATCATCCTTATGGATATATGAACATGAGA
TATGTTTCCTCGCTGATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGG
CCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
CAGATCTGTTTTGGGTGTATTGTATCTTGATGGGATCATTGGTTTCTGAG
GGAGCCACTTTGGTGGTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGA
AAACAATATGTCCTTTAAGGATTATGTGATTTCTGGCAAGGATCCGTGCG
TGAATGTGGTGCTATGTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTG
GCTGCAGCTTGCATGGGATTAAGTAGTTACACAGGATCGCCCATCTTTGA
CGCCGCTGGATCACTGGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCT
TTATCATTTATACAAATGCTAATGCGCTGGTGGGGATATCCATTGCTTCC
GAGCGCCTAGAAAAGATTAATTCTGCCTTGGAGGCTGATGTGATGATCAG
AGCGATTTACGATGTCAAGGGAATCGACATTGGCAATGCTCGGGTTCGGT
ATAAGGCTGAGCTCGACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTG
GACAAACAGGATCTCGCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAA
GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
ACCTGATGGGCGGTGAAATTGATCGCATTGAGATGAATCTGCGGACACAA
TTTCCGGAAATACGCCATGTGGACCTGGAAATACTC--------------
-------
>C3
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
GGCGGCATGACGGCGAGGCGTTTAAACTACAGCCGTGGAAGCGACCAGAC
ATGTTCCTTCAGTTTCGCTGCAGTGCCAATGGCAGTGATTCCAAGAAGGA
TAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAGGG
AA------ACGAAAAATTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
ATCCGATCTACCACCGGTAACCAAGGTGAAAGAGCCGGTTTTGGCCGCAA
GTGCCATTAATCTACGTTCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
GTGATTCCTATAAAGCGACCCCGATTCGATTATCGAGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACCGCGCCATCAGCGATTTCTTGCTAACCGCCG
CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAAGCTAAGGCAGT
AGAAGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
ACTGTCAAACGGCGGTTGCGCGACTACCGCAGGGAGATGGGATCTCGAAC
CAAAGTAATGCTCGACAACAGAAAGGAGTCTGAGAAGTCCGGGCAAGTGG
TGGCCACCGCCATTGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
GGTTGGCTGTACAGCGGTTCCCACAGCATGTTTGCGGAGGTTATCCATTC
TTTGGCCGACTTAATCAACCAGCTCATCCTCGCATTTGGCATCTACAAGT
CCTCTCAGAGTCCCGATATAGATCATCCTTATGGATATATGAACATGAGA
TATGTTTCCTCGCTGATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGG
CCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
CAGATCTGTTTTGGGTGTACTGCATCTTGATGGGATCATTAGTTTCTGAG
GGAGCCACTTTGGTGGTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGA
AAACAATATGTCCTTTAAGGATTATGTCATTTCTGGCAAGGATCCGTGCG
TGAATGTGGTGCTGTGTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTG
GCGGCAGCTTGCATGGGATTAAGTAGTTACACAGGATCGCCCATCTTTGA
CGCCGCTGGATCACTGGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCT
TTATCATTTATACAAATGCTAATGCGCTGGTGGGGATATCCATCGCTTCC
GAGCGCCTAGAAAAGATTAATTCTGCTTTGGAGGCTGATGTGATGATCAG
AGCGATTTACGATGTCAAGGGAATCGACATTGGCAACGCTCGGGTTCGGT
ATAAGGCTGAGCTCGACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTG
GACAAACAGGATCTCGCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAA
GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
ACCTGATGGGCGGTGAAATTGATCGCATTGAGATGAATCTGCGGACACAA
TTTCCGGAAATACGCCATGTGGACCTGGAAATACTC--------------
-------
>C4
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCATCACTTCGG
AAAGGCTTTTAGCCAGTGCACCTTGCGCCACGATGCCAGAATCTCCTGGA
GGAGGAATGACGGCGAGTCATTCAAACTACAACCGTGGAAGCGACCAAGC
ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGATTCG------AAAAAGGA
CCAACCTTTGCAGGAGGAGTCCACCACTGGTTCAGTTGCCAAACCAAAGG
AGAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTCTCT
ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
ATCCGATCTGCCACCGCTAGCCAAGGTGAAAGAGCCGGTATTGGCCGCAG
GGGCTATCAATCTGCGTTCCAGCTCCATTGCAGTAGCAGCTGGTGCTGTG
GGATTGGGAAGTGGCTCTGGTTCAATTATGAATCCACCTGAAACAGTGAC
AAGCCCAACTAAAAATTCTTTAGCTGGTGCTGTGCTAGCTGAAAAGGCAG
GAGAGGCTAGTCGAACAGGCCCACCTGCAGAGGTGACGCCTCCAGCGCCT
GTGATTCCTCCAAAGCGACCACGTTTCGATTATCGTGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGCTGACCGCTG
CTCAACTCGAGAATCTGCCCAAGATTAAGCGAAGATCGCCGTACGAGCAG
GAGCCACCCATGACTGTTTACTGGCGTCGCGATGTGGAAGCTAAGGCTGT
AGAAGTGTGGGGATCCAAGGAAAACCTGTTGCGGGAACGACTTAAGCGGG
ATGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
ACTGTCAAACGGCGGTTGCGCGACTACCGCAGAGAGATGGGTTCTCGAAC
CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGACAAGTGG
TTGCCACCGCCATCGCTATCAATGCAGCTAATTTGCTTTTCAAAGCAGGA
GGCTGGCTGTACAGCGGTTCTCACAGCATGTTTGCGGAGGTTATCCATTC
ATTGGCCGACCTAATCAACCAGCTAATTCTCGCCTTTGGCATCTACAAGT
CCTCTCAGAGTCCGGACATAGATCATCCTTATGGATACATGAACATGCGT
TATGTATCCTCGCTGATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGG
CCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
CAGATCTGTTTTGGGTATACTGCATCTTAATGGGATCGCTGGTTTCTGAG
GGAGCTACTTTGGTGGTAGCCATCAATGAGCTTAAACGATCGGCCAAGGA
AAACAATATGACCTTTAAAGATTATGTGATTTCTGGCAAGGATCCGTGCG
TAAATGTGGTGCTGTGCGAAGATGCTGCAGCTGTAACTGGCGTTATGGTG
GCTGGAGCCTGTATGGGATTAAGTAGTTACACAGGATCCCCCATTTTCGA
CGCCGCTGGATCACTGGTTATAGGTGCTCTTCTGGGCGCTGTGGCTTCTT
TTATCATTTATACAAATGCTAATGCGCTGGTAGGGATATCCATTGCTTCC
GAGCGCCTAGAAAAAATTAATTCTGCTTTGGAGGCTGATGTGATGATCAG
AGCGATTTACGATGTCAAGGGAATCGATATTGGCAACGCTCGGGTTCGGT
ATAAGGCTGAACTCGATTTTGACGGCCGTGAGTTGACGCGTTCGTATCTG
GACAAACAGGATCTCGCAAAACTGCTCACTACTGTTCGAGGCTTTCAAAA
GGTTGAGGATCTGGAGAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGG
ACCTGATGGGCGGCGAAATTGATCGCATTGAGATGAACTTGCGGACACAA
TTCCCGGAAATACGTCATGTGGACCTGGAAATACTC--------------
-------
>C5
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
AAAGGCTTTTAGCCAGTGCTCCTTGCGCCAAGATGCCAGTTATCCCTGGA
AGCGGAATGACGGCGTGTCATTCAAGCAACAACCGTGGAAGCGCCCAAGC
ATGTTCCTGCAGTTTCGCTGTAGCGCCAATGACAGTGATTCCAAGAGGGA
CAAACCTCTGCAGGAGGAGTCCACCGCTGGTGCAGTCGCCAAACCAAAGG
AAAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
ATCCGATCTACCGCCGCTAACCAAGGTGAAAGAGCCAGCATTGGTCGCAG
GGGCCATCAATCTACGTTCCAGCTCCACTGCATTGGGAATTGGTGCTGTG
GGATTGGGAGGGGCTTCTGGCTCCATTTTGAATCCTCCTGAAACAGTGAC
AAGCGCAACTAAAAATTCTCCGGCTGATGCTGTGCTATCTGAAAGGGCCG
CAGAAGTTAGTCGAACATGCCCACCTGCAGAGGTGACGCCTCTAGCGCCT
GTGATTTCTCCAAAGCGACCCCGTTTCGATTATCGTGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGTTGACCGCTG
CTCAACTGGAGTGTCTGCCCAAAATTAAGCGGAGATCGCCGTACGAGCAG
GAGCCGCCCATGACGGTCTACTGGCGACGCGATGTTGAAGCTAAGGCTGT
GGAGGTGTGGGGATCCAAGGAAAACCTGTTACGGGAACGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGATCTATGACTCCGCAGATCTATTC
ACTGTCAAACGGCGGTTGCGCGACTACCGCAGGGAGATGGGATCTCGGAC
CAAAGTAATGCTCGACAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGG
TGGCCACCGCCATCGCTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGA
GGTTGGCTGTACAGCGGTTCCCACAGCATGTTTGCGGAGGTTATCCATTC
TTTGGCCGACCTAATCAACCAGCTCATTCTCGCCTTTGGCATTTACAAGT
CATCTCAGAGTCCGGACATAGATCATCCTTATGGATACATGAACATGCGA
TATGTGTCCTCGCTGATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGG
GCTGTCCATCTACCACGGTATTGATGGCATTCTCCATCCGGAACCCATAA
CCGATCTGTTTTGGGTGTATTGCATCTTAATGGGATCGTTAGTTTCTGAG
GGAGCCACTCTGGTGGTGGCCATCAATGAGCTTAAACGATCGGCCAAGGA
AAACAATATGACCTTTAAAGATTATGTAATTTCTGGCAAGGATCCATGCG
TGAATGTGGTGCTGTGCGAAGACGCTGCAGCTGTAACTGGCGTTATGGTG
GCTGGAGCTTGTATGGGATTGAGTAGTTACACAGGATCGCCCATCTTCGA
CGCCGCTGGATCACTGGTTATAGGTGCTCTCCTGGGTGCTGTGGCCTCTT
TTATCATTTATACAAATGCCAATGCGCTGGTAGGAATATCCATTGCATCC
GAGCGCCTAGAAAAGATAAATTCTGCTTTGGAGGCTGATGTGATGATCAG
AGCGATTTACGATGTCAAGGGAATCGATATTGGCAACGCTCGAGTTCGTT
ATAAGGCTGAGCTTGACTTCGATGGCCGTGAGCTGACGCGTTCGTATCTG
GATAAACAGGATCTCGCAAAACTGCTCACAACTGTTCGAGGCTTTCAAAA
GGTTGAGGATCTGGAGAGCTTTTTGCTGGATCAAGGCGAAAACATTGTGG
ACCTGATGGGCGGTGAGATTGATCGCATTGAGATGAACCTGCGGACACAA
TTTCCGGAAATACGTCATGTGGACCTGGAAATACTC--------------
-------
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKEooTKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKEooTKNFEVKTTKGILS
ISTTIEDSKINEIVFEKYDLPPVTKVoooooAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPREooTKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AAACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDSooKKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYDSADLF
TVKRRLRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAG
GWLYSGSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMR
YVSSLISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSE
GATLVVAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMV
AGACMGLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIAS
ERLEKINSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYL
DKQDLAKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQ
FPEIRHVDLEIL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 2007 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481283025
      Setting output file names to "/opt/ADOPS/444/ZnT49B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1560349687
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0738084393
      Seed = 342084840
      Swapseed = 1481283025
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 49 unique site patterns
      Division 2 has 38 unique site patterns
      Division 3 has 93 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5336.174331 -- -25.624409
         Chain 2 -- -5299.276122 -- -25.624409
         Chain 3 -- -5298.211091 -- -25.624409
         Chain 4 -- -5150.545058 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5087.538991 -- -25.624409
         Chain 2 -- -5334.291921 -- -25.624409
         Chain 3 -- -5323.267276 -- -25.624409
         Chain 4 -- -5299.775387 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5336.174] (-5299.276) (-5298.211) (-5150.545) * [-5087.539] (-5334.292) (-5323.267) (-5299.775) 
        500 -- (-4477.692) (-4475.519) [-4457.544] (-4466.801) * [-4478.023] (-4497.144) (-4477.582) (-4476.496) -- 0:00:00
       1000 -- (-4452.029) (-4440.671) [-4452.683] (-4450.303) * [-4456.581] (-4486.475) (-4460.307) (-4457.928) -- 0:16:39
       1500 -- (-4432.468) (-4421.891) [-4424.721] (-4443.025) * [-4413.530] (-4470.963) (-4440.212) (-4450.255) -- 0:11:05
       2000 -- [-4405.916] (-4410.050) (-4405.917) (-4417.668) * [-4412.375] (-4450.772) (-4440.843) (-4425.091) -- 0:08:19
       2500 -- [-4397.514] (-4395.016) (-4404.092) (-4391.361) * (-4405.947) (-4425.261) (-4424.737) [-4416.802] -- 0:06:39
       3000 -- (-4391.036) (-4396.230) (-4403.170) [-4391.940] * (-4401.067) [-4409.403] (-4407.597) (-4403.374) -- 0:05:32
       3500 -- (-4388.608) [-4388.423] (-4402.328) (-4387.559) * (-4400.531) (-4406.102) (-4393.054) [-4394.731] -- 0:04:44
       4000 -- (-4389.034) (-4395.291) (-4387.678) [-4389.198] * (-4398.242) (-4402.477) [-4394.214] (-4389.303) -- 0:04:09
       4500 -- [-4396.079] (-4387.361) (-4400.711) (-4394.952) * (-4397.896) (-4394.097) (-4388.481) [-4386.647] -- 0:07:22
       5000 -- (-4389.863) (-4393.435) [-4393.738] (-4390.907) * (-4394.536) (-4390.369) (-4388.602) [-4388.522] -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-4392.657) (-4396.423) [-4384.917] (-4390.563) * (-4387.630) (-4392.147) (-4392.766) [-4384.511] -- 0:06:01
       6000 -- [-4389.725] (-4388.404) (-4388.737) (-4391.641) * (-4388.270) (-4384.986) (-4392.909) [-4398.668] -- 0:05:31
       6500 -- [-4387.905] (-4389.665) (-4401.492) (-4387.956) * (-4383.344) (-4394.522) [-4391.515] (-4387.437) -- 0:05:05
       7000 -- (-4387.932) (-4392.876) (-4395.330) [-4391.951] * (-4387.056) (-4393.785) (-4385.145) [-4397.337] -- 0:04:43
       7500 -- (-4390.982) (-4389.627) [-4396.107] (-4396.503) * (-4399.095) (-4393.452) [-4385.638] (-4397.178) -- 0:06:37
       8000 -- (-4395.083) (-4384.502) [-4387.531] (-4389.059) * (-4397.117) (-4391.216) (-4386.259) [-4386.573] -- 0:06:12
       8500 -- (-4389.514) (-4393.835) (-4393.880) [-4387.440] * (-4392.091) [-4390.452] (-4386.098) (-4395.155) -- 0:05:49
       9000 -- (-4394.558) (-4389.159) (-4394.178) [-4388.571] * [-4393.659] (-4390.549) (-4392.702) (-4390.873) -- 0:05:30
       9500 -- [-4391.874] (-4386.081) (-4396.367) (-4385.043) * (-4391.462) (-4386.735) [-4391.612] (-4389.486) -- 0:05:12
      10000 -- [-4392.268] (-4387.919) (-4397.261) (-4395.399) * (-4394.080) (-4387.495) (-4398.026) [-4394.107] -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-4390.046) (-4391.173) (-4391.350) [-4388.935] * (-4391.180) (-4394.086) (-4392.704) [-4391.466] -- 0:04:42
      11000 -- (-4392.248) (-4389.523) (-4394.617) [-4388.214] * (-4392.978) (-4398.034) (-4395.595) [-4389.037] -- 0:05:59
      11500 -- (-4389.675) (-4388.632) [-4384.849] (-4392.624) * (-4383.044) (-4398.036) (-4394.446) [-4396.089] -- 0:05:43
      12000 -- (-4391.800) (-4386.243) [-4388.299] (-4389.700) * (-4387.972) (-4390.349) [-4392.732] (-4389.041) -- 0:05:29
      12500 -- (-4393.080) (-4382.610) (-4392.531) [-4386.845] * (-4387.494) (-4394.165) (-4388.097) [-4386.096] -- 0:05:16
      13000 -- (-4389.580) [-4386.617] (-4393.497) (-4389.219) * [-4391.431] (-4397.803) (-4390.724) (-4392.189) -- 0:05:03
      13500 -- [-4395.004] (-4384.195) (-4391.316) (-4394.376) * (-4389.769) (-4393.577) [-4389.394] (-4382.126) -- 0:04:52
      14000 -- (-4394.754) (-4385.743) (-4390.267) [-4389.033] * (-4394.560) (-4389.093) (-4385.465) [-4386.651] -- 0:05:52
      14500 -- (-4398.161) (-4388.449) [-4394.614] (-4394.987) * (-4391.352) (-4390.950) (-4390.333) [-4385.888] -- 0:05:39
      15000 -- (-4391.210) (-4385.305) [-4391.350] (-4394.216) * (-4391.062) (-4394.281) (-4381.988) [-4385.525] -- 0:05:28

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-4401.362) [-4388.851] (-4392.769) (-4391.483) * (-4387.752) [-4388.026] (-4388.989) (-4386.831) -- 0:05:17
      16000 -- (-4394.915) [-4387.366] (-4389.966) (-4389.245) * (-4393.479) (-4388.952) [-4394.489] (-4387.341) -- 0:05:07
      16500 -- [-4387.305] (-4398.584) (-4396.420) (-4390.254) * (-4383.403) (-4390.771) (-4387.424) [-4387.138] -- 0:04:58
      17000 -- (-4394.346) [-4388.170] (-4387.735) (-4388.896) * [-4386.766] (-4392.431) (-4394.734) (-4395.082) -- 0:04:49
      17500 -- [-4386.074] (-4388.442) (-4388.215) (-4392.220) * (-4393.005) (-4392.177) (-4393.738) [-4385.919] -- 0:05:36
      18000 -- (-4388.165) (-4387.703) [-4387.506] (-4387.114) * [-4391.701] (-4388.097) (-4393.069) (-4388.518) -- 0:05:27
      18500 -- (-4389.748) (-4386.484) [-4388.615] (-4387.772) * (-4389.845) (-4395.321) (-4390.739) [-4385.503] -- 0:05:18
      19000 -- (-4385.123) (-4387.807) (-4388.284) [-4389.144] * (-4391.822) (-4395.368) (-4387.028) [-4389.881] -- 0:05:09
      19500 -- (-4393.874) (-4384.076) (-4385.213) [-4388.848] * [-4385.287] (-4385.906) (-4389.893) (-4391.902) -- 0:05:01
      20000 -- (-4383.867) [-4393.730] (-4390.502) (-4390.843) * (-4389.303) [-4385.487] (-4395.462) (-4392.844) -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-4392.457) (-4382.529) [-4388.807] (-4396.045) * (-4399.030) (-4389.842) [-4387.342] (-4384.873) -- 0:05:34
      21000 -- [-4390.744] (-4382.531) (-4387.845) (-4388.886) * (-4387.287) (-4390.749) (-4387.487) [-4388.585] -- 0:05:26
      21500 -- (-4396.850) (-4389.469) [-4390.460] (-4398.635) * (-4389.165) [-4384.677] (-4388.392) (-4392.697) -- 0:05:18
      22000 -- (-4387.137) [-4384.613] (-4391.089) (-4390.284) * [-4391.102] (-4388.921) (-4385.378) (-4385.533) -- 0:05:11
      22500 -- [-4388.592] (-4385.667) (-4390.442) (-4393.855) * (-4392.190) (-4391.968) (-4390.721) [-4388.094] -- 0:05:04
      23000 -- (-4392.549) [-4385.571] (-4389.364) (-4394.711) * (-4393.954) (-4396.195) (-4395.727) [-4392.486] -- 0:04:57
      23500 -- (-4398.905) (-4387.653) [-4390.369] (-4385.968) * (-4390.764) (-4391.798) (-4387.098) [-4389.737] -- 0:05:32
      24000 -- (-4389.090) [-4385.320] (-4393.659) (-4387.332) * (-4390.188) (-4397.925) [-4392.162] (-4391.625) -- 0:05:25
      24500 -- [-4386.017] (-4387.091) (-4397.704) (-4390.368) * [-4390.974] (-4394.350) (-4391.377) (-4387.410) -- 0:05:18
      25000 -- (-4391.593) (-4388.714) (-4388.583) [-4393.585] * (-4396.163) (-4400.034) (-4391.837) [-4387.970] -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-4391.990) (-4389.847) [-4391.541] (-4386.689) * (-4391.496) (-4392.374) (-4394.649) [-4391.256] -- 0:05:05
      26000 -- (-4393.681) (-4386.484) [-4383.817] (-4393.353) * (-4390.037) [-4390.784] (-4386.710) (-4388.275) -- 0:04:59
      26500 -- (-4389.538) (-4386.730) (-4388.033) [-4383.683] * (-4388.961) (-4392.632) (-4391.925) [-4389.166] -- 0:04:53
      27000 -- [-4389.306] (-4386.806) (-4388.157) (-4387.156) * (-4397.227) (-4387.508) [-4389.214] (-4388.063) -- 0:05:24
      27500 -- (-4397.021) [-4390.616] (-4393.171) (-4390.779) * (-4397.502) [-4387.465] (-4391.162) (-4395.305) -- 0:05:18
      28000 -- (-4392.079) (-4389.908) [-4386.663] (-4385.244) * [-4391.713] (-4394.127) (-4391.175) (-4396.097) -- 0:05:12
      28500 -- (-4390.755) (-4390.212) (-4389.997) [-4386.491] * [-4391.395] (-4391.394) (-4385.690) (-4384.542) -- 0:05:06
      29000 -- [-4391.376] (-4388.920) (-4393.840) (-4394.939) * (-4395.519) [-4392.930] (-4388.878) (-4385.035) -- 0:05:01
      29500 -- (-4392.019) (-4384.290) [-4391.543] (-4388.888) * [-4386.975] (-4389.740) (-4385.634) (-4387.733) -- 0:04:56
      30000 -- (-4391.024) (-4389.282) (-4389.588) [-4386.147] * (-4396.221) (-4389.032) (-4388.484) [-4389.507] -- 0:05:23

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-4393.573) [-4392.461] (-4390.112) (-4383.812) * [-4386.390] (-4391.057) (-4387.369) (-4390.022) -- 0:05:17
      31000 -- [-4393.799] (-4389.913) (-4397.930) (-4383.171) * [-4388.457] (-4389.841) (-4388.929) (-4394.585) -- 0:05:12
      31500 -- (-4393.110) (-4393.123) [-4386.661] (-4387.378) * [-4386.379] (-4397.822) (-4391.146) (-4391.524) -- 0:05:07
      32000 -- (-4397.141) (-4391.017) [-4387.347] (-4387.266) * (-4387.917) (-4390.558) (-4391.486) [-4385.170] -- 0:05:02
      32500 -- (-4395.595) (-4387.037) (-4395.137) [-4389.654] * (-4390.964) (-4385.457) [-4387.586] (-4389.043) -- 0:04:57
      33000 -- (-4391.515) (-4386.187) (-4387.564) [-4390.398] * (-4391.610) [-4392.419] (-4386.559) (-4386.767) -- 0:04:53
      33500 -- (-4387.866) [-4385.137] (-4400.442) (-4388.485) * [-4389.519] (-4390.116) (-4390.499) (-4388.970) -- 0:05:17
      34000 -- (-4393.234) (-4385.014) [-4387.445] (-4403.330) * (-4391.832) (-4390.224) (-4387.994) [-4393.266] -- 0:05:12
      34500 -- (-4385.687) (-4388.406) [-4391.568] (-4391.923) * (-4392.659) (-4390.645) [-4392.638] (-4391.227) -- 0:05:07
      35000 -- [-4384.972] (-4390.522) (-4391.723) (-4396.048) * [-4385.984] (-4388.826) (-4388.111) (-4392.750) -- 0:05:03

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-4391.156) [-4388.568] (-4393.520) (-4385.182) * (-4386.343) (-4387.493) (-4393.323) [-4389.709] -- 0:04:58
      36000 -- (-4385.483) (-4393.486) (-4397.317) [-4384.741] * (-4387.396) [-4385.076] (-4399.536) (-4389.945) -- 0:04:54
      36500 -- (-4384.752) [-4388.956] (-4395.921) (-4385.210) * [-4402.780] (-4386.182) (-4387.158) (-4386.797) -- 0:04:50
      37000 -- [-4386.927] (-4385.221) (-4389.697) (-4385.901) * [-4389.030] (-4387.038) (-4388.694) (-4389.694) -- 0:05:12
      37500 -- (-4395.967) (-4390.854) (-4391.103) [-4385.424] * [-4385.726] (-4390.425) (-4392.550) (-4393.053) -- 0:05:08
      38000 -- [-4388.778] (-4389.748) (-4388.380) (-4387.809) * (-4388.743) [-4386.698] (-4392.841) (-4388.504) -- 0:05:03
      38500 -- (-4391.681) [-4384.353] (-4389.682) (-4386.596) * (-4386.119) [-4390.019] (-4384.024) (-4389.035) -- 0:04:59
      39000 -- (-4392.673) (-4386.490) (-4391.634) [-4388.768] * (-4384.117) (-4395.712) [-4383.567] (-4393.612) -- 0:04:55
      39500 -- [-4385.053] (-4394.941) (-4388.538) (-4387.831) * (-4388.806) (-4392.686) [-4391.544] (-4386.052) -- 0:04:51
      40000 -- (-4391.564) (-4385.105) (-4388.189) [-4386.320] * (-4391.189) (-4388.185) (-4392.015) [-4395.161] -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      40500 -- [-4390.813] (-4385.397) (-4391.355) (-4395.671) * (-4390.336) [-4388.850] (-4384.198) (-4385.507) -- 0:05:07
      41000 -- [-4386.487] (-4387.914) (-4388.380) (-4396.899) * (-4385.579) [-4392.734] (-4390.045) (-4391.025) -- 0:05:04
      41500 -- (-4394.611) [-4389.221] (-4386.103) (-4390.682) * (-4398.624) [-4386.030] (-4385.688) (-4393.323) -- 0:05:00
      42000 -- (-4393.433) (-4387.033) (-4391.649) [-4390.252] * (-4392.773) (-4384.293) [-4388.496] (-4386.187) -- 0:04:56
      42500 -- (-4388.257) (-4387.986) (-4384.630) [-4388.025] * (-4393.873) (-4387.731) (-4390.054) [-4387.650] -- 0:04:52
      43000 -- [-4392.475] (-4386.121) (-4387.125) (-4403.537) * (-4399.136) [-4389.859] (-4389.400) (-4391.603) -- 0:04:49
      43500 -- (-4385.116) [-4389.208] (-4388.570) (-4389.656) * [-4386.095] (-4387.388) (-4386.342) (-4390.357) -- 0:05:07
      44000 -- (-4388.888) [-4389.177] (-4388.110) (-4387.979) * (-4388.327) (-4395.420) [-4385.854] (-4385.915) -- 0:05:04
      44500 -- [-4388.340] (-4385.577) (-4387.871) (-4388.804) * [-4385.708] (-4394.720) (-4390.456) (-4397.738) -- 0:05:00
      45000 -- (-4383.380) (-4395.298) (-4391.686) [-4388.025] * (-4385.714) [-4387.353] (-4390.616) (-4391.611) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-4386.745) [-4387.801] (-4387.398) (-4389.631) * (-4389.670) (-4386.418) (-4390.578) [-4390.854] -- 0:04:53
      46000 -- (-4389.118) (-4388.459) (-4391.848) [-4395.603] * (-4389.299) [-4385.829] (-4388.628) (-4391.876) -- 0:04:50
      46500 -- (-4388.924) (-4397.992) [-4392.662] (-4392.884) * (-4392.386) (-4385.960) (-4392.993) [-4388.139] -- 0:05:07
      47000 -- (-4393.178) [-4392.123] (-4391.358) (-4391.172) * (-4393.219) [-4388.654] (-4397.716) (-4386.449) -- 0:05:04
      47500 -- (-4390.305) (-4395.039) [-4387.247] (-4394.889) * (-4391.647) (-4393.727) (-4392.415) [-4394.368] -- 0:05:00
      48000 -- [-4392.278] (-4389.418) (-4390.271) (-4395.456) * (-4391.644) (-4384.625) (-4392.556) [-4392.159] -- 0:04:57
      48500 -- (-4392.764) [-4389.248] (-4389.647) (-4390.259) * (-4391.952) [-4390.309] (-4391.917) (-4385.261) -- 0:04:54
      49000 -- [-4390.665] (-4395.776) (-4387.604) (-4390.476) * (-4388.793) [-4391.756] (-4390.489) (-4388.894) -- 0:04:51
      49500 -- (-4390.287) [-4393.670] (-4396.729) (-4386.483) * (-4390.484) (-4388.816) [-4392.941] (-4388.319) -- 0:04:48
      50000 -- [-4385.861] (-4393.338) (-4393.331) (-4391.504) * (-4392.298) (-4390.064) [-4391.159] (-4388.942) -- 0:05:04

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-4389.800) (-4398.034) [-4393.407] (-4392.628) * (-4384.571) [-4394.168] (-4388.761) (-4392.704) -- 0:05:00
      51000 -- (-4391.362) [-4390.539] (-4402.357) (-4391.881) * (-4391.035) (-4395.124) [-4387.756] (-4390.745) -- 0:04:57
      51500 -- [-4388.045] (-4387.277) (-4390.541) (-4387.398) * (-4392.424) [-4393.349] (-4388.035) (-4390.170) -- 0:04:54
      52000 -- [-4384.097] (-4388.284) (-4392.699) (-4389.644) * (-4401.812) [-4387.185] (-4392.008) (-4388.128) -- 0:04:51
      52500 -- (-4390.600) [-4392.356] (-4389.047) (-4396.414) * (-4393.989) (-4390.223) (-4391.619) [-4386.814] -- 0:04:48
      53000 -- (-4388.952) (-4388.760) [-4387.967] (-4394.224) * (-4385.540) [-4385.917] (-4393.155) (-4389.318) -- 0:05:03
      53500 -- (-4384.364) (-4389.297) (-4387.831) [-4385.007] * (-4389.823) [-4391.156] (-4386.533) (-4389.872) -- 0:05:00
      54000 -- (-4392.263) [-4388.387] (-4386.320) (-4392.241) * [-4386.652] (-4393.155) (-4388.710) (-4391.296) -- 0:04:57
      54500 -- (-4385.143) [-4392.048] (-4389.493) (-4398.036) * (-4393.324) (-4398.479) (-4387.582) [-4389.518] -- 0:04:54
      55000 -- [-4389.552] (-4391.912) (-4390.915) (-4398.072) * [-4384.544] (-4391.989) (-4389.142) (-4395.709) -- 0:04:52

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-4392.456) [-4388.902] (-4386.947) (-4392.701) * (-4388.819) (-4389.235) (-4393.598) [-4387.053] -- 0:04:49
      56000 -- (-4386.668) (-4391.484) [-4385.282] (-4387.083) * (-4389.697) (-4382.936) [-4383.433] (-4385.088) -- 0:04:46
      56500 -- [-4385.557] (-4398.444) (-4389.345) (-4387.246) * (-4395.596) [-4385.624] (-4395.750) (-4395.157) -- 0:05:00
      57000 -- (-4389.941) (-4391.032) [-4391.186] (-4383.773) * (-4394.715) [-4386.672] (-4389.780) (-4392.913) -- 0:04:57
      57500 -- (-4389.155) (-4384.875) (-4386.157) [-4386.904] * [-4390.858] (-4384.076) (-4391.801) (-4388.421) -- 0:04:55
      58000 -- [-4389.310] (-4390.863) (-4387.165) (-4390.624) * (-4391.251) (-4393.568) [-4389.310] (-4392.119) -- 0:04:52
      58500 -- (-4388.333) (-4386.971) [-4388.144] (-4393.710) * (-4391.333) [-4386.603] (-4385.215) (-4395.393) -- 0:04:49
      59000 -- (-4385.640) [-4386.506] (-4398.612) (-4396.876) * (-4389.205) (-4387.759) (-4387.906) [-4386.257] -- 0:04:47
      59500 -- [-4388.457] (-4397.459) (-4386.853) (-4387.587) * [-4386.254] (-4392.764) (-4385.267) (-4383.224) -- 0:05:00
      60000 -- (-4393.560) (-4387.758) (-4386.197) [-4385.446] * (-4388.826) (-4388.002) [-4386.939] (-4391.052) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-4391.025) (-4393.962) (-4388.270) [-4384.514] * (-4384.122) (-4387.157) (-4391.499) [-4391.974] -- 0:04:55
      61000 -- (-4400.274) (-4391.044) [-4389.986] (-4390.312) * (-4381.469) (-4386.813) [-4383.775] (-4395.134) -- 0:04:52
      61500 -- (-4387.149) [-4390.747] (-4387.605) (-4391.508) * (-4388.804) (-4392.561) [-4393.114] (-4395.281) -- 0:04:49
      62000 -- (-4385.019) (-4386.798) [-4385.776] (-4390.568) * [-4392.207] (-4389.023) (-4386.769) (-4392.536) -- 0:04:47
      62500 -- [-4390.480] (-4389.942) (-4395.528) (-4390.440) * (-4389.681) [-4386.790] (-4393.292) (-4390.063) -- 0:05:00
      63000 -- [-4382.575] (-4390.455) (-4393.287) (-4395.210) * [-4389.652] (-4395.273) (-4390.304) (-4387.226) -- 0:04:57
      63500 -- (-4386.650) (-4388.969) (-4390.708) [-4392.708] * (-4390.108) (-4392.379) (-4387.354) [-4391.831] -- 0:04:54
      64000 -- (-4387.364) (-4385.970) (-4393.596) [-4385.023] * (-4389.321) (-4388.629) (-4398.469) [-4393.174] -- 0:04:52
      64500 -- (-4389.366) [-4393.077] (-4388.795) (-4385.279) * [-4391.384] (-4392.786) (-4390.953) (-4389.548) -- 0:04:50
      65000 -- (-4384.796) (-4392.064) (-4389.449) [-4386.855] * (-4388.572) [-4390.212] (-4395.194) (-4392.440) -- 0:04:47

      Average standard deviation of split frequencies: 0.000000

      65500 -- [-4383.692] (-4390.675) (-4389.822) (-4386.488) * [-4385.676] (-4387.018) (-4386.219) (-4393.231) -- 0:04:45
      66000 -- (-4387.909) [-4388.198] (-4393.298) (-4391.516) * [-4388.612] (-4387.096) (-4391.215) (-4389.397) -- 0:04:57
      66500 -- (-4385.195) (-4384.771) (-4390.056) [-4390.595] * (-4390.617) (-4384.146) (-4382.061) [-4391.450] -- 0:04:54
      67000 -- [-4390.449] (-4387.566) (-4392.216) (-4396.067) * (-4388.796) (-4386.976) (-4389.489) [-4389.399] -- 0:04:52
      67500 -- (-4389.237) (-4390.495) (-4399.136) [-4388.163] * (-4386.114) (-4389.916) [-4384.214] (-4391.337) -- 0:04:50
      68000 -- (-4392.127) (-4389.721) [-4386.521] (-4402.372) * (-4386.391) [-4389.059] (-4386.585) (-4391.231) -- 0:04:47
      68500 -- (-4393.259) [-4391.523] (-4386.792) (-4386.664) * [-4391.005] (-4391.266) (-4390.624) (-4386.025) -- 0:04:45
      69000 -- [-4389.438] (-4389.256) (-4388.976) (-4387.259) * [-4395.256] (-4399.681) (-4387.631) (-4384.308) -- 0:04:56
      69500 -- (-4386.503) [-4392.061] (-4388.747) (-4395.868) * [-4388.575] (-4392.886) (-4386.325) (-4387.467) -- 0:04:54
      70000 -- [-4397.053] (-4393.332) (-4388.374) (-4394.222) * (-4407.216) [-4394.321] (-4390.791) (-4388.843) -- 0:04:52

      Average standard deviation of split frequencies: 0.000000

      70500 -- [-4390.528] (-4394.006) (-4393.445) (-4388.680) * (-4391.435) (-4389.853) [-4384.953] (-4386.094) -- 0:04:50
      71000 -- [-4383.230] (-4388.711) (-4394.944) (-4388.230) * (-4390.503) [-4390.644] (-4397.235) (-4391.414) -- 0:04:47
      71500 -- [-4393.016] (-4388.560) (-4398.479) (-4387.531) * (-4391.454) (-4388.791) [-4387.192] (-4386.068) -- 0:04:45
      72000 -- [-4390.501] (-4391.226) (-4400.440) (-4390.437) * (-4390.238) (-4393.303) [-4389.474] (-4385.838) -- 0:04:43
      72500 -- (-4386.409) (-4390.374) [-4389.002] (-4388.876) * (-4398.574) (-4387.895) (-4401.650) [-4384.389] -- 0:04:54
      73000 -- (-4388.029) [-4392.898] (-4399.345) (-4388.519) * (-4408.737) [-4388.096] (-4391.763) (-4385.724) -- 0:04:52
      73500 -- [-4389.446] (-4386.173) (-4384.586) (-4390.791) * (-4394.772) [-4392.794] (-4393.032) (-4392.236) -- 0:04:49
      74000 -- (-4389.077) (-4393.970) [-4386.730] (-4390.256) * [-4394.861] (-4390.841) (-4398.988) (-4391.766) -- 0:04:47
      74500 -- (-4390.507) (-4387.159) [-4388.775] (-4390.526) * (-4387.665) [-4389.443] (-4391.922) (-4389.509) -- 0:04:45
      75000 -- (-4391.177) (-4386.310) (-4394.461) [-4392.507] * (-4392.269) (-4391.374) (-4387.020) [-4388.444] -- 0:04:43

      Average standard deviation of split frequencies: 0.000000

      75500 -- [-4388.117] (-4387.370) (-4396.292) (-4384.435) * (-4391.176) [-4387.846] (-4390.238) (-4391.560) -- 0:04:53
      76000 -- (-4384.891) [-4390.910] (-4391.937) (-4383.778) * (-4388.455) (-4389.704) [-4392.759] (-4388.891) -- 0:04:51
      76500 -- [-4387.121] (-4387.368) (-4396.236) (-4387.423) * (-4391.810) (-4393.639) (-4392.151) [-4385.704] -- 0:04:49
      77000 -- (-4384.816) [-4386.258] (-4391.323) (-4390.602) * (-4393.712) (-4394.454) [-4386.079] (-4386.212) -- 0:04:47
      77500 -- (-4388.548) (-4386.800) (-4388.842) [-4396.826] * (-4391.130) (-4386.503) [-4385.618] (-4388.902) -- 0:04:45
      78000 -- [-4387.093] (-4387.781) (-4389.940) (-4402.037) * (-4391.020) [-4388.496] (-4390.368) (-4387.636) -- 0:04:43
      78500 -- (-4385.037) (-4388.392) [-4389.214] (-4398.830) * (-4387.873) [-4392.594] (-4384.731) (-4392.193) -- 0:04:41
      79000 -- (-4388.815) [-4384.626] (-4389.342) (-4406.162) * (-4392.017) [-4388.905] (-4388.164) (-4391.577) -- 0:04:51
      79500 -- [-4386.249] (-4398.371) (-4392.413) (-4389.350) * (-4393.120) (-4386.221) [-4389.027] (-4393.066) -- 0:04:49
      80000 -- (-4390.228) (-4386.883) (-4388.628) [-4390.520] * (-4389.373) [-4385.718] (-4387.774) (-4390.917) -- 0:04:47

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-4392.100) (-4389.717) (-4388.572) [-4388.033] * (-4399.371) (-4386.441) [-4385.121] (-4391.116) -- 0:04:45
      81000 -- [-4388.076] (-4403.749) (-4385.268) (-4388.806) * (-4388.888) (-4391.357) [-4388.988] (-4389.917) -- 0:04:43
      81500 -- [-4387.643] (-4392.133) (-4384.468) (-4382.890) * [-4392.453] (-4402.607) (-4387.450) (-4387.894) -- 0:04:41
      82000 -- [-4387.138] (-4387.685) (-4387.916) (-4385.161) * (-4396.926) (-4396.140) (-4390.850) [-4385.358] -- 0:04:51
      82500 -- (-4392.595) (-4392.486) (-4389.944) [-4387.996] * (-4391.516) (-4385.832) [-4393.775] (-4389.531) -- 0:04:49
      83000 -- (-4391.548) (-4391.283) (-4388.822) [-4386.095] * [-4384.466] (-4389.802) (-4392.898) (-4387.773) -- 0:04:47
      83500 -- (-4393.461) [-4390.418] (-4386.337) (-4390.502) * [-4388.569] (-4386.217) (-4397.318) (-4389.888) -- 0:04:45
      84000 -- (-4393.392) [-4387.082] (-4389.795) (-4390.744) * (-4384.949) (-4392.616) [-4393.189] (-4388.872) -- 0:04:43
      84500 -- (-4386.277) (-4383.651) (-4390.622) [-4384.691] * (-4395.571) [-4390.388] (-4395.126) (-4386.799) -- 0:04:41
      85000 -- (-4384.955) (-4391.243) [-4392.488] (-4384.376) * (-4390.055) (-4393.363) [-4398.891] (-4389.720) -- 0:04:50

      Average standard deviation of split frequencies: 0.000000

      85500 -- [-4393.642] (-4385.669) (-4393.596) (-4392.540) * (-4391.113) (-4395.909) (-4387.583) [-4386.416] -- 0:04:48
      86000 -- [-4387.396] (-4384.604) (-4388.601) (-4392.201) * (-4387.877) [-4395.256] (-4393.075) (-4391.104) -- 0:04:46
      86500 -- (-4393.150) (-4387.702) [-4387.278] (-4392.418) * (-4391.779) (-4389.943) [-4383.002] (-4390.454) -- 0:04:45
      87000 -- (-4390.106) [-4387.394] (-4387.092) (-4384.545) * (-4397.984) (-4383.923) [-4388.224] (-4393.159) -- 0:04:43
      87500 -- (-4399.886) (-4392.452) [-4385.721] (-4385.522) * (-4382.332) [-4384.495] (-4396.272) (-4387.890) -- 0:04:41
      88000 -- (-4389.850) (-4390.224) [-4390.505] (-4386.961) * (-4384.615) (-4390.056) (-4390.414) [-4394.417] -- 0:04:39
      88500 -- [-4387.731] (-4395.502) (-4387.301) (-4383.220) * [-4385.675] (-4386.592) (-4400.675) (-4385.730) -- 0:04:48
      89000 -- (-4385.346) (-4391.575) [-4386.745] (-4388.222) * [-4386.652] (-4388.647) (-4392.706) (-4389.495) -- 0:04:46
      89500 -- [-4385.669] (-4385.823) (-4382.555) (-4395.770) * (-4385.842) (-4389.259) [-4390.123] (-4392.306) -- 0:04:44
      90000 -- [-4386.795] (-4391.947) (-4383.347) (-4386.370) * [-4382.804] (-4400.471) (-4388.516) (-4388.199) -- 0:04:43

      Average standard deviation of split frequencies: 0.000000

      90500 -- [-4392.468] (-4388.320) (-4388.543) (-4389.678) * [-4387.704] (-4397.357) (-4391.866) (-4390.240) -- 0:04:41
      91000 -- (-4396.883) (-4387.785) [-4394.354] (-4387.066) * [-4391.735] (-4387.478) (-4390.995) (-4393.402) -- 0:04:39
      91500 -- (-4386.423) (-4396.044) (-4391.800) [-4387.245] * (-4388.834) [-4388.186] (-4387.803) (-4392.999) -- 0:04:47
      92000 -- (-4387.154) [-4397.353] (-4389.606) (-4391.486) * [-4388.495] (-4387.611) (-4389.038) (-4390.840) -- 0:04:46
      92500 -- (-4395.691) [-4392.606] (-4395.770) (-4388.978) * (-4390.620) (-4388.776) [-4385.554] (-4387.615) -- 0:04:44
      93000 -- [-4387.548] (-4391.358) (-4393.202) (-4394.809) * (-4392.518) [-4390.395] (-4389.234) (-4388.594) -- 0:04:42
      93500 -- (-4390.527) (-4388.528) [-4387.632] (-4385.437) * [-4393.058] (-4390.553) (-4390.031) (-4391.237) -- 0:04:41
      94000 -- (-4389.388) [-4388.184] (-4392.300) (-4390.801) * (-4393.866) (-4396.020) (-4391.303) [-4389.985] -- 0:04:39
      94500 -- [-4387.509] (-4391.463) (-4384.427) (-4391.430) * (-4388.752) [-4388.181] (-4389.141) (-4388.444) -- 0:04:37
      95000 -- (-4394.339) (-4391.257) [-4392.551] (-4390.255) * [-4394.858] (-4396.291) (-4389.317) (-4393.248) -- 0:04:45

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-4385.095) (-4391.087) (-4395.263) [-4391.421] * (-4388.212) [-4389.455] (-4393.176) (-4387.144) -- 0:04:44
      96000 -- (-4390.664) [-4387.595] (-4395.380) (-4389.435) * [-4385.100] (-4396.684) (-4388.464) (-4388.693) -- 0:04:42
      96500 -- [-4390.510] (-4387.568) (-4387.655) (-4388.238) * [-4388.126] (-4393.778) (-4386.065) (-4387.241) -- 0:04:40
      97000 -- (-4392.192) [-4386.879] (-4388.365) (-4388.803) * (-4389.329) (-4389.613) [-4390.499] (-4393.360) -- 0:04:39
      97500 -- [-4387.982] (-4391.875) (-4399.983) (-4391.670) * (-4396.329) (-4393.969) (-4393.883) [-4390.308] -- 0:04:37
      98000 -- [-4387.443] (-4387.153) (-4388.028) (-4392.553) * (-4387.229) (-4400.145) (-4389.895) [-4389.166] -- 0:04:45
      98500 -- [-4393.010] (-4395.352) (-4394.204) (-4389.051) * (-4391.434) [-4388.733] (-4391.014) (-4396.146) -- 0:04:43
      99000 -- (-4393.846) (-4388.567) [-4388.883] (-4390.179) * (-4387.923) (-4394.914) [-4386.904] (-4389.624) -- 0:04:42
      99500 -- (-4394.151) (-4392.230) [-4387.253] (-4389.963) * (-4397.808) (-4391.255) (-4390.477) [-4389.416] -- 0:04:40
      100000 -- (-4392.713) (-4389.688) [-4387.505] (-4387.865) * (-4383.961) [-4386.826] (-4387.764) (-4392.751) -- 0:04:39

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-4385.719) [-4388.979] (-4384.552) (-4386.381) * [-4388.664] (-4383.716) (-4386.913) (-4385.428) -- 0:04:37
      101000 -- (-4390.307) (-4387.611) (-4386.967) [-4383.362] * [-4384.470] (-4385.355) (-4386.897) (-4391.547) -- 0:04:35
      101500 -- (-4391.785) [-4388.701] (-4384.185) (-4401.115) * (-4388.259) (-4385.014) [-4395.914] (-4385.159) -- 0:04:43
      102000 -- (-4390.078) (-4396.290) [-4385.187] (-4387.406) * (-4389.144) [-4392.442] (-4396.154) (-4390.516) -- 0:04:41
      102500 -- [-4388.567] (-4385.483) (-4388.294) (-4383.586) * (-4393.636) [-4395.817] (-4396.378) (-4390.840) -- 0:04:40
      103000 -- (-4391.433) [-4391.070] (-4389.251) (-4391.606) * (-4393.355) (-4394.512) (-4397.181) [-4389.425] -- 0:04:38
      103500 -- [-4389.034] (-4390.346) (-4383.783) (-4390.779) * (-4387.097) (-4393.857) (-4392.777) [-4391.164] -- 0:04:37
      104000 -- (-4382.332) [-4387.745] (-4387.432) (-4385.737) * (-4389.164) [-4395.959] (-4397.089) (-4392.141) -- 0:04:35
      104500 -- (-4388.256) (-4386.903) (-4385.247) [-4390.201] * (-4384.961) (-4397.524) [-4390.316] (-4393.400) -- 0:04:42
      105000 -- (-4386.899) (-4386.621) [-4394.986] (-4389.234) * (-4392.684) (-4391.178) (-4391.544) [-4395.477] -- 0:04:41

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-4388.454) [-4387.310] (-4394.834) (-4390.323) * (-4386.968) (-4395.806) [-4391.526] (-4395.916) -- 0:04:39
      106000 -- (-4390.204) (-4389.848) (-4397.661) [-4389.677] * (-4389.488) (-4393.734) (-4383.290) [-4386.456] -- 0:04:38
      106500 -- (-4394.892) [-4388.021] (-4399.559) (-4395.391) * (-4387.804) (-4396.718) [-4387.106] (-4396.556) -- 0:04:36
      107000 -- (-4394.028) [-4387.503] (-4392.622) (-4390.773) * (-4394.066) (-4390.351) [-4390.737] (-4391.012) -- 0:04:35
      107500 -- (-4390.704) (-4388.723) (-4390.491) [-4388.388] * [-4398.173] (-4394.098) (-4391.605) (-4388.446) -- 0:04:33
      108000 -- (-4384.537) (-4383.804) (-4385.988) [-4391.429] * [-4389.419] (-4391.624) (-4389.829) (-4400.836) -- 0:04:40
      108500 -- (-4384.402) [-4391.080] (-4383.470) (-4388.794) * (-4394.505) (-4399.605) [-4387.446] (-4383.559) -- 0:04:39
      109000 -- (-4385.386) (-4386.932) [-4387.872] (-4389.119) * (-4395.297) (-4394.991) (-4390.508) [-4394.245] -- 0:04:37
      109500 -- (-4393.742) [-4388.984] (-4388.494) (-4389.632) * [-4392.550] (-4387.519) (-4391.657) (-4392.676) -- 0:04:36
      110000 -- [-4391.708] (-4387.183) (-4389.269) (-4390.199) * (-4388.884) (-4390.872) (-4391.295) [-4388.799] -- 0:04:35

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-4388.137] (-4386.795) (-4393.645) (-4388.654) * (-4391.701) (-4390.570) [-4390.660] (-4390.867) -- 0:04:33
      111000 -- (-4388.976) [-4386.496] (-4389.670) (-4385.143) * (-4387.705) (-4397.530) [-4386.992] (-4385.199) -- 0:04:40
      111500 -- [-4393.287] (-4399.521) (-4385.682) (-4388.315) * (-4388.267) [-4388.486] (-4390.847) (-4391.737) -- 0:04:38
      112000 -- (-4389.501) (-4392.757) [-4395.180] (-4384.317) * [-4384.183] (-4389.885) (-4387.573) (-4395.525) -- 0:04:37
      112500 -- (-4391.046) [-4389.103] (-4395.110) (-4387.552) * (-4387.987) (-4397.047) [-4387.139] (-4390.379) -- 0:04:36
      113000 -- (-4391.845) (-4396.046) (-4394.614) [-4390.248] * (-4385.839) [-4385.444] (-4387.853) (-4388.494) -- 0:04:34
      113500 -- (-4386.211) (-4399.137) [-4389.677] (-4395.415) * (-4396.339) [-4393.550] (-4385.450) (-4385.331) -- 0:04:33
      114000 -- [-4385.281] (-4388.688) (-4393.023) (-4387.662) * [-4391.541] (-4387.545) (-4386.859) (-4392.953) -- 0:04:32
      114500 -- (-4390.171) (-4397.797) [-4391.144] (-4385.093) * [-4388.941] (-4395.756) (-4388.671) (-4388.544) -- 0:04:38
      115000 -- (-4399.020) (-4386.294) (-4389.167) [-4385.530] * [-4389.203] (-4390.264) (-4399.672) (-4387.824) -- 0:04:37

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-4396.338) [-4387.975] (-4386.762) (-4386.776) * [-4390.452] (-4387.876) (-4395.716) (-4388.569) -- 0:04:35
      116000 -- (-4388.264) (-4393.287) [-4390.049] (-4386.604) * (-4385.958) (-4389.719) (-4393.759) [-4388.136] -- 0:04:34
      116500 -- (-4389.213) [-4386.238] (-4387.228) (-4398.507) * (-4391.428) (-4385.224) (-4389.490) [-4389.500] -- 0:04:33
      117000 -- (-4387.841) [-4384.188] (-4386.776) (-4390.001) * (-4392.290) (-4383.351) [-4392.813] (-4387.262) -- 0:04:31
      117500 -- (-4385.441) (-4386.552) [-4383.256] (-4390.132) * (-4386.666) (-4391.003) (-4396.073) [-4385.196] -- 0:04:37
      118000 -- [-4389.257] (-4388.706) (-4387.216) (-4387.937) * (-4389.227) (-4389.298) (-4390.817) [-4391.497] -- 0:04:36
      118500 -- (-4387.111) [-4388.935] (-4387.863) (-4390.182) * [-4388.677] (-4384.377) (-4390.340) (-4391.130) -- 0:04:35
      119000 -- [-4393.254] (-4393.695) (-4387.726) (-4387.189) * [-4396.406] (-4386.257) (-4394.339) (-4387.043) -- 0:04:33
      119500 -- (-4389.218) (-4388.179) [-4388.507] (-4393.344) * (-4392.243) (-4385.977) (-4400.905) [-4387.079] -- 0:04:32
      120000 -- (-4386.165) [-4388.730] (-4388.225) (-4397.869) * (-4394.503) (-4395.352) [-4393.307] (-4387.620) -- 0:04:31

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-4388.006] (-4391.197) (-4394.085) (-4394.605) * (-4390.853) (-4389.240) (-4392.596) [-4386.849] -- 0:04:30
      121000 -- (-4388.763) (-4388.106) [-4390.101] (-4391.709) * (-4396.338) [-4393.433] (-4398.111) (-4384.924) -- 0:04:36
      121500 -- (-4391.221) (-4389.074) (-4385.768) [-4391.099] * [-4385.664] (-4388.835) (-4389.906) (-4386.970) -- 0:04:34
      122000 -- (-4390.387) (-4391.564) [-4388.191] (-4385.876) * [-4384.201] (-4388.967) (-4389.709) (-4387.414) -- 0:04:33
      122500 -- (-4394.679) (-4395.400) (-4390.684) [-4393.313] * (-4389.177) [-4389.537] (-4390.138) (-4383.998) -- 0:04:32
      123000 -- (-4392.027) [-4389.904] (-4386.424) (-4390.015) * (-4384.413) [-4392.034] (-4402.385) (-4387.773) -- 0:04:30
      123500 -- (-4390.352) [-4387.103] (-4389.916) (-4393.798) * [-4386.073] (-4391.397) (-4391.224) (-4392.338) -- 0:04:29
      124000 -- (-4385.509) (-4389.156) [-4389.902] (-4389.672) * (-4388.452) [-4385.227] (-4393.293) (-4384.988) -- 0:04:35
      124500 -- (-4389.817) (-4391.845) [-4394.359] (-4391.400) * (-4386.087) (-4390.607) (-4386.053) [-4388.321] -- 0:04:34
      125000 -- (-4383.804) (-4395.383) (-4391.903) [-4390.673] * (-4383.679) [-4394.874] (-4396.587) (-4387.533) -- 0:04:33

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-4387.340) [-4385.933] (-4394.416) (-4394.323) * (-4385.573) (-4388.647) [-4391.319] (-4385.757) -- 0:04:31
      126000 -- (-4390.254) [-4386.469] (-4402.182) (-4387.907) * [-4390.374] (-4390.368) (-4395.643) (-4387.061) -- 0:04:30
      126500 -- [-4397.960] (-4389.347) (-4387.436) (-4394.918) * (-4389.075) (-4390.087) [-4387.931] (-4394.984) -- 0:04:29
      127000 -- (-4392.947) (-4396.050) (-4392.223) [-4389.860] * (-4388.337) (-4392.194) [-4394.614] (-4390.158) -- 0:04:28
      127500 -- [-4383.127] (-4394.153) (-4388.150) (-4394.008) * (-4391.938) (-4390.872) [-4384.342] (-4392.337) -- 0:04:33
      128000 -- [-4385.945] (-4385.120) (-4394.692) (-4396.923) * [-4386.362] (-4390.631) (-4394.432) (-4391.116) -- 0:04:32
      128500 -- [-4384.908] (-4394.752) (-4387.792) (-4405.126) * [-4386.375] (-4393.509) (-4385.735) (-4391.541) -- 0:04:31
      129000 -- (-4394.581) [-4389.741] (-4386.753) (-4395.814) * (-4392.241) (-4390.938) [-4391.818] (-4393.810) -- 0:04:30
      129500 -- (-4392.439) (-4387.937) (-4390.662) [-4387.950] * [-4386.137] (-4392.291) (-4381.270) (-4388.543) -- 0:04:28
      130000 -- [-4388.131] (-4383.718) (-4386.433) (-4387.596) * [-4392.595] (-4393.582) (-4383.153) (-4385.880) -- 0:04:27

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-4385.393) (-4386.909) [-4386.442] (-4386.548) * (-4393.260) (-4390.689) (-4388.116) [-4387.054] -- 0:04:33
      131000 -- (-4392.338) [-4388.744] (-4385.382) (-4386.903) * (-4385.824) (-4391.825) (-4390.299) [-4393.489] -- 0:04:31
      131500 -- (-4384.144) (-4387.019) (-4385.601) [-4386.324] * (-4390.139) [-4391.401] (-4400.182) (-4388.382) -- 0:04:30
      132000 -- [-4389.045] (-4388.414) (-4388.535) (-4388.454) * (-4391.412) (-4385.461) [-4394.397] (-4389.801) -- 0:04:29
      132500 -- (-4389.038) (-4392.067) (-4386.887) [-4386.510] * [-4387.414] (-4392.582) (-4393.844) (-4393.170) -- 0:04:28
      133000 -- (-4387.274) (-4390.920) (-4389.101) [-4386.849] * [-4393.625] (-4390.014) (-4393.400) (-4394.520) -- 0:04:27
      133500 -- (-4385.203) [-4389.100] (-4386.591) (-4398.930) * (-4386.040) (-4398.700) [-4388.327] (-4386.467) -- 0:04:26
      134000 -- (-4386.398) [-4393.752] (-4400.609) (-4389.683) * (-4386.237) (-4387.965) (-4386.697) [-4386.517] -- 0:04:31
      134500 -- [-4391.887] (-4395.888) (-4390.517) (-4389.174) * (-4387.812) (-4392.228) [-4386.166] (-4392.600) -- 0:04:30
      135000 -- (-4383.978) [-4387.432] (-4397.098) (-4385.512) * (-4388.862) [-4387.586] (-4396.338) (-4387.761) -- 0:04:29

      Average standard deviation of split frequencies: 0.000000

      135500 -- [-4387.552] (-4390.789) (-4402.398) (-4391.646) * [-4382.173] (-4390.398) (-4391.735) (-4394.300) -- 0:04:27
      136000 -- [-4392.521] (-4386.054) (-4394.325) (-4388.465) * (-4388.871) (-4391.543) (-4387.962) [-4386.276] -- 0:04:26
      136500 -- (-4389.492) [-4387.811] (-4402.253) (-4384.970) * [-4386.645] (-4391.201) (-4393.923) (-4387.154) -- 0:04:25
      137000 -- (-4391.870) [-4385.730] (-4392.759) (-4386.571) * [-4393.406] (-4394.203) (-4387.648) (-4393.084) -- 0:04:30
      137500 -- (-4384.468) (-4393.082) [-4384.096] (-4392.312) * [-4389.402] (-4398.776) (-4387.455) (-4390.182) -- 0:04:29
      138000 -- [-4387.153] (-4388.212) (-4386.462) (-4390.273) * (-4396.576) (-4399.090) (-4389.361) [-4387.648] -- 0:04:28
      138500 -- [-4391.145] (-4384.042) (-4389.540) (-4386.053) * (-4394.325) (-4397.223) [-4388.469] (-4383.040) -- 0:04:27
      139000 -- [-4391.626] (-4391.844) (-4389.074) (-4386.396) * (-4391.911) [-4392.170] (-4387.223) (-4383.838) -- 0:04:26
      139500 -- (-4393.489) (-4389.343) (-4392.670) [-4388.363] * [-4385.875] (-4394.430) (-4390.801) (-4388.564) -- 0:04:25
      140000 -- (-4390.682) (-4393.959) (-4393.703) [-4391.112] * (-4384.785) (-4394.895) (-4396.140) [-4391.121] -- 0:04:30

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-4387.677) [-4386.703] (-4387.566) (-4389.144) * [-4386.441] (-4389.165) (-4387.577) (-4394.862) -- 0:04:29
      141000 -- [-4386.450] (-4397.386) (-4384.882) (-4391.872) * [-4387.509] (-4387.049) (-4393.908) (-4388.747) -- 0:04:28
      141500 -- [-4386.992] (-4402.034) (-4387.928) (-4391.831) * [-4390.062] (-4387.517) (-4384.695) (-4384.699) -- 0:04:26
      142000 -- (-4387.650) [-4394.544] (-4388.170) (-4388.257) * (-4387.011) (-4387.014) [-4386.296] (-4395.725) -- 0:04:25
      142500 -- (-4393.402) (-4383.828) (-4389.304) [-4389.940] * (-4385.242) (-4388.034) [-4385.836] (-4386.915) -- 0:04:24
      143000 -- (-4394.060) (-4388.471) [-4386.184] (-4387.534) * (-4389.273) (-4385.158) (-4391.116) [-4389.686] -- 0:04:23
      143500 -- [-4391.584] (-4389.813) (-4394.355) (-4384.527) * (-4396.538) (-4392.803) (-4391.050) [-4393.327] -- 0:04:28
      144000 -- (-4390.181) (-4387.954) (-4388.846) [-4383.244] * (-4388.930) [-4388.944] (-4385.634) (-4386.733) -- 0:04:27
      144500 -- (-4387.138) (-4388.451) [-4383.223] (-4386.662) * (-4391.307) (-4390.037) (-4386.027) [-4390.912] -- 0:04:26
      145000 -- (-4386.063) [-4389.253] (-4394.178) (-4392.433) * [-4389.476] (-4385.992) (-4387.956) (-4392.211) -- 0:04:25

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-4393.229) (-4392.410) [-4390.032] (-4393.083) * [-4389.197] (-4386.262) (-4390.712) (-4387.049) -- 0:04:24
      146000 -- [-4389.250] (-4388.940) (-4389.524) (-4388.224) * [-4386.944] (-4391.011) (-4388.701) (-4392.693) -- 0:04:23
      146500 -- (-4388.394) (-4388.861) (-4388.941) [-4391.691] * [-4389.412] (-4393.484) (-4389.671) (-4395.701) -- 0:04:27
      147000 -- (-4385.361) (-4386.725) (-4389.736) [-4387.525] * (-4390.649) (-4392.335) (-4394.554) [-4386.395] -- 0:04:26
      147500 -- (-4384.429) [-4388.801] (-4386.934) (-4387.512) * (-4391.928) (-4386.606) [-4386.254] (-4391.301) -- 0:04:25
      148000 -- (-4389.278) (-4392.098) (-4397.568) [-4390.650] * (-4391.057) (-4388.549) [-4392.356] (-4400.368) -- 0:04:24
      148500 -- (-4387.856) [-4392.477] (-4386.879) (-4389.667) * [-4385.577] (-4394.498) (-4386.108) (-4389.545) -- 0:04:23
      149000 -- [-4386.495] (-4390.680) (-4384.466) (-4387.654) * (-4384.381) (-4401.764) [-4384.200] (-4388.925) -- 0:04:22
      149500 -- (-4393.036) (-4384.862) (-4388.483) [-4386.043] * (-4388.595) (-4396.404) (-4396.768) [-4383.128] -- 0:04:21
      150000 -- (-4387.450) (-4389.429) (-4392.601) [-4388.156] * (-4394.692) (-4396.037) [-4385.758] (-4385.429) -- 0:04:26

      Average standard deviation of split frequencies: 0.000000

      150500 -- [-4386.004] (-4386.892) (-4392.453) (-4386.719) * (-4391.699) [-4389.541] (-4391.048) (-4389.681) -- 0:04:25
      151000 -- (-4387.412) (-4390.287) (-4397.997) [-4389.324] * (-4392.908) (-4395.973) (-4389.264) [-4391.176] -- 0:04:24
      151500 -- (-4388.960) (-4390.043) [-4395.800] (-4389.257) * (-4393.080) (-4397.583) (-4388.291) [-4384.314] -- 0:04:23
      152000 -- (-4390.327) (-4389.333) (-4390.148) [-4386.045] * (-4390.788) [-4386.120] (-4388.650) (-4392.038) -- 0:04:22
      152500 -- (-4396.448) (-4391.116) [-4392.162] (-4384.918) * (-4388.350) [-4385.482] (-4388.654) (-4388.187) -- 0:04:21
      153000 -- (-4393.903) (-4388.200) (-4385.049) [-4393.646] * (-4385.819) (-4399.148) (-4392.364) [-4384.790] -- 0:04:25
      153500 -- [-4386.870] (-4391.614) (-4387.210) (-4393.599) * (-4388.697) [-4390.892] (-4391.831) (-4391.919) -- 0:04:24
      154000 -- (-4390.452) [-4397.664] (-4388.025) (-4396.145) * (-4387.570) [-4386.405] (-4390.297) (-4389.755) -- 0:04:23
      154500 -- (-4386.848) [-4397.121] (-4385.314) (-4385.194) * (-4386.642) (-4386.874) (-4390.353) [-4388.640] -- 0:04:22
      155000 -- (-4394.889) (-4386.687) [-4388.658] (-4393.503) * (-4385.124) (-4398.004) (-4387.446) [-4390.136] -- 0:04:21

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-4394.426) (-4390.447) [-4389.206] (-4389.768) * (-4389.466) (-4398.228) [-4389.844] (-4383.188) -- 0:04:20
      156000 -- [-4391.033] (-4396.460) (-4386.549) (-4387.556) * [-4384.904] (-4392.580) (-4395.993) (-4388.003) -- 0:04:19
      156500 -- (-4389.591) (-4390.948) [-4385.744] (-4386.834) * (-4389.298) (-4393.075) [-4387.925] (-4394.215) -- 0:04:24
      157000 -- [-4393.141] (-4388.466) (-4388.515) (-4388.570) * (-4392.946) (-4389.404) [-4385.136] (-4391.960) -- 0:04:23
      157500 -- (-4388.853) (-4391.582) [-4382.388] (-4389.377) * (-4391.641) [-4391.195] (-4389.628) (-4393.916) -- 0:04:22
      158000 -- (-4386.976) (-4391.427) (-4390.469) [-4389.093] * [-4388.819] (-4396.725) (-4394.944) (-4388.260) -- 0:04:21
      158500 -- (-4388.675) (-4389.075) (-4388.155) [-4386.652] * (-4391.088) (-4397.382) [-4383.667] (-4386.788) -- 0:04:20
      159000 -- (-4388.870) (-4389.927) [-4386.305] (-4383.302) * (-4387.925) [-4384.184] (-4396.644) (-4387.761) -- 0:04:19
      159500 -- (-4388.269) (-4392.263) (-4388.340) [-4385.933] * (-4388.430) (-4386.891) [-4391.871] (-4390.222) -- 0:04:18
      160000 -- (-4388.030) (-4397.242) [-4390.809] (-4387.552) * (-4385.880) (-4385.118) [-4384.388] (-4400.301) -- 0:04:22

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-4401.121) [-4391.697] (-4395.120) (-4390.297) * [-4382.802] (-4390.505) (-4390.557) (-4391.903) -- 0:04:21
      161000 -- [-4395.092] (-4392.475) (-4392.186) (-4392.990) * (-4390.802) (-4387.759) [-4390.571] (-4393.664) -- 0:04:20
      161500 -- (-4392.442) [-4393.561] (-4387.669) (-4394.234) * (-4390.983) (-4386.813) (-4388.009) [-4394.878] -- 0:04:19
      162000 -- (-4404.057) (-4389.608) [-4391.177] (-4393.918) * (-4390.741) [-4386.748] (-4393.374) (-4394.037) -- 0:04:18
      162500 -- [-4392.683] (-4384.315) (-4392.279) (-4384.900) * (-4390.189) [-4384.126] (-4388.166) (-4400.549) -- 0:04:17
      163000 -- (-4388.282) (-4384.860) [-4385.851] (-4393.954) * [-4383.303] (-4389.306) (-4391.111) (-4388.373) -- 0:04:21
      163500 -- (-4392.814) (-4399.627) [-4380.950] (-4385.896) * (-4384.058) (-4392.994) (-4394.935) [-4387.967] -- 0:04:20
      164000 -- (-4393.271) (-4392.595) [-4384.706] (-4388.747) * (-4390.279) (-4390.018) [-4387.647] (-4386.044) -- 0:04:19
      164500 -- (-4395.830) (-4388.605) (-4398.829) [-4384.863] * (-4390.064) [-4383.829] (-4391.684) (-4399.923) -- 0:04:19
      165000 -- (-4391.266) (-4388.150) (-4388.393) [-4389.892] * (-4394.772) (-4385.878) [-4390.596] (-4392.296) -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      165500 -- (-4385.865) (-4386.648) [-4388.804] (-4389.372) * [-4387.672] (-4389.146) (-4392.122) (-4384.323) -- 0:04:17
      166000 -- (-4392.641) [-4386.010] (-4385.170) (-4386.309) * (-4393.390) (-4393.242) [-4397.394] (-4391.928) -- 0:04:16
      166500 -- (-4400.152) [-4392.714] (-4392.241) (-4400.113) * (-4389.276) (-4385.477) (-4390.211) [-4388.690] -- 0:04:20
      167000 -- (-4386.143) (-4392.236) [-4387.085] (-4391.759) * (-4385.386) [-4390.731] (-4385.543) (-4387.624) -- 0:04:19
      167500 -- [-4384.254] (-4389.671) (-4388.049) (-4392.373) * (-4386.788) (-4382.543) (-4392.914) [-4387.263] -- 0:04:18
      168000 -- [-4389.952] (-4386.417) (-4390.595) (-4399.275) * (-4395.671) (-4383.520) [-4388.708] (-4397.601) -- 0:04:17
      168500 -- (-4387.163) [-4390.949] (-4386.680) (-4389.400) * (-4387.034) (-4388.008) [-4390.232] (-4391.204) -- 0:04:16
      169000 -- (-4388.231) (-4394.029) (-4388.849) [-4392.114] * (-4387.137) (-4388.612) (-4396.830) [-4385.597] -- 0:04:15
      169500 -- (-4390.795) (-4395.708) [-4389.404] (-4394.424) * (-4393.847) [-4382.937] (-4388.933) (-4390.261) -- 0:04:19
      170000 -- (-4388.827) [-4389.177] (-4386.740) (-4393.036) * (-4390.340) (-4388.737) (-4388.962) [-4385.225] -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-4390.662) (-4391.816) (-4384.358) [-4395.654] * (-4389.259) [-4380.937] (-4386.514) (-4386.035) -- 0:04:17
      171000 -- (-4394.996) (-4390.923) (-4395.385) [-4397.793] * (-4387.744) (-4392.239) (-4389.477) [-4386.765] -- 0:04:16
      171500 -- (-4390.827) (-4395.622) [-4385.553] (-4392.002) * (-4391.286) (-4393.208) [-4391.134] (-4390.492) -- 0:04:16
      172000 -- (-4390.778) (-4398.859) [-4395.298] (-4390.369) * [-4386.899] (-4391.437) (-4391.919) (-4390.730) -- 0:04:15
      172500 -- (-4391.274) (-4389.690) (-4394.872) [-4390.803] * [-4387.462] (-4390.465) (-4391.852) (-4394.135) -- 0:04:19
      173000 -- [-4389.250] (-4388.790) (-4388.417) (-4391.582) * (-4394.267) (-4391.517) [-4381.885] (-4386.442) -- 0:04:18
      173500 -- (-4386.338) (-4391.850) [-4386.647] (-4390.432) * (-4388.488) (-4386.746) (-4383.553) [-4397.152] -- 0:04:17
      174000 -- (-4388.543) (-4387.081) [-4385.739] (-4393.546) * [-4385.108] (-4391.508) (-4394.614) (-4383.663) -- 0:04:16
      174500 -- (-4382.871) (-4394.462) [-4395.634] (-4394.132) * (-4390.016) (-4388.932) (-4390.757) [-4383.572] -- 0:04:15
      175000 -- (-4387.691) [-4392.117] (-4384.424) (-4390.370) * (-4392.095) [-4391.770] (-4400.801) (-4388.354) -- 0:04:14

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-4392.977) (-4390.742) (-4390.202) [-4388.317] * (-4388.054) (-4386.617) (-4396.056) [-4392.358] -- 0:04:13
      176000 -- (-4392.945) (-4384.194) [-4390.702] (-4393.388) * [-4388.484] (-4389.190) (-4397.941) (-4392.512) -- 0:04:17
      176500 -- (-4390.995) [-4384.500] (-4393.541) (-4394.367) * [-4387.221] (-4388.498) (-4393.463) (-4389.145) -- 0:04:16
      177000 -- [-4391.442] (-4391.652) (-4387.972) (-4388.871) * (-4392.894) (-4383.740) (-4391.577) [-4388.620] -- 0:04:15
      177500 -- (-4385.309) (-4393.134) (-4389.190) [-4385.243] * (-4384.498) [-4386.329] (-4394.750) (-4390.548) -- 0:04:14
      178000 -- (-4387.627) [-4392.800] (-4387.199) (-4391.147) * (-4384.749) (-4391.925) (-4396.619) [-4388.800] -- 0:04:13
      178500 -- (-4389.863) [-4386.337] (-4385.700) (-4393.570) * [-4390.228] (-4385.713) (-4384.812) (-4389.102) -- 0:04:13
      179000 -- (-4390.855) (-4388.155) [-4385.398] (-4385.019) * [-4386.771] (-4390.394) (-4386.953) (-4383.448) -- 0:04:16
      179500 -- (-4390.140) (-4394.281) [-4389.726] (-4387.554) * (-4388.539) [-4386.253] (-4386.175) (-4386.900) -- 0:04:15
      180000 -- (-4399.700) (-4387.995) (-4385.640) [-4386.622] * (-4385.397) (-4392.452) (-4388.496) [-4387.475] -- 0:04:15

      Average standard deviation of split frequencies: 0.000000

      180500 -- [-4392.527] (-4388.489) (-4386.687) (-4385.061) * (-4388.316) [-4386.074] (-4387.895) (-4388.647) -- 0:04:14
      181000 -- (-4390.753) (-4391.323) [-4388.480] (-4390.923) * (-4391.135) [-4385.461] (-4396.579) (-4386.390) -- 0:04:13
      181500 -- (-4397.505) (-4385.690) (-4390.905) [-4389.276] * [-4392.854] (-4388.471) (-4391.616) (-4388.353) -- 0:04:12
      182000 -- (-4399.044) [-4388.048] (-4384.985) (-4389.690) * [-4392.100] (-4391.614) (-4389.027) (-4388.265) -- 0:04:11
      182500 -- (-4387.682) (-4389.736) (-4384.820) [-4391.326] * (-4383.784) [-4388.367] (-4389.122) (-4392.560) -- 0:04:15
      183000 -- (-4388.818) [-4386.935] (-4386.776) (-4405.559) * [-4384.124] (-4388.358) (-4387.601) (-4385.433) -- 0:04:14
      183500 -- (-4389.331) (-4390.912) [-4384.797] (-4384.057) * (-4386.719) (-4392.832) (-4385.972) [-4384.652] -- 0:04:13
      184000 -- (-4395.980) (-4397.946) (-4385.199) [-4392.757] * [-4386.576] (-4389.749) (-4390.692) (-4397.195) -- 0:04:12
      184500 -- (-4392.614) [-4389.072] (-4385.832) (-4388.822) * (-4390.133) (-4387.896) (-4384.405) [-4390.368] -- 0:04:11
      185000 -- (-4387.414) [-4387.900] (-4389.629) (-4394.015) * (-4394.452) [-4388.568] (-4394.637) (-4392.770) -- 0:04:11

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-4383.804) [-4389.702] (-4392.295) (-4395.086) * (-4387.878) (-4391.692) [-4386.801] (-4388.365) -- 0:04:14
      186000 -- (-4391.947) (-4384.872) [-4390.502] (-4392.446) * (-4397.693) (-4395.612) [-4385.008] (-4390.471) -- 0:04:13
      186500 -- (-4388.550) [-4385.037] (-4391.525) (-4397.236) * (-4391.403) (-4390.344) [-4393.413] (-4390.463) -- 0:04:12
      187000 -- [-4386.521] (-4389.533) (-4389.770) (-4394.918) * (-4392.889) (-4392.037) (-4392.932) [-4390.246] -- 0:04:12
      187500 -- (-4387.025) (-4392.743) (-4391.189) [-4393.636] * (-4392.145) (-4391.234) [-4388.137] (-4391.607) -- 0:04:11
      188000 -- [-4388.671] (-4389.347) (-4397.177) (-4390.173) * (-4394.109) (-4386.040) (-4390.564) [-4385.380] -- 0:04:10
      188500 -- (-4389.433) (-4388.985) [-4389.306] (-4387.490) * (-4391.303) (-4388.582) (-4388.823) [-4387.519] -- 0:04:09
      189000 -- (-4394.367) (-4387.992) [-4387.897] (-4392.244) * (-4391.663) [-4389.141] (-4387.737) (-4389.028) -- 0:04:13
      189500 -- (-4395.398) [-4387.469] (-4387.707) (-4391.406) * (-4385.624) (-4394.034) [-4385.303] (-4391.019) -- 0:04:12
      190000 -- (-4395.928) (-4381.387) (-4390.267) [-4387.667] * (-4386.065) (-4389.115) [-4385.858] (-4390.323) -- 0:04:11

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-4393.568) (-4387.225) [-4388.552] (-4389.473) * [-4393.588] (-4391.141) (-4388.840) (-4396.845) -- 0:04:10
      191000 -- (-4390.316) (-4395.018) (-4390.409) [-4387.327] * (-4385.880) (-4391.704) (-4382.975) [-4384.279] -- 0:04:09
      191500 -- (-4390.889) (-4390.253) (-4386.512) [-4391.893] * (-4386.248) [-4388.744] (-4387.741) (-4386.183) -- 0:04:09
      192000 -- (-4387.554) (-4390.325) (-4397.135) [-4397.500] * (-4383.419) [-4388.743] (-4396.607) (-4387.619) -- 0:04:12
      192500 -- [-4385.890] (-4387.423) (-4396.318) (-4391.132) * (-4386.412) (-4403.887) (-4395.623) [-4387.364] -- 0:04:11
      193000 -- [-4388.817] (-4389.890) (-4386.744) (-4393.783) * (-4393.809) (-4388.016) [-4388.938] (-4391.502) -- 0:04:10
      193500 -- (-4393.473) (-4390.636) (-4392.420) [-4402.803] * (-4389.967) (-4391.299) (-4390.785) [-4390.164] -- 0:04:10
      194000 -- (-4392.695) (-4386.156) (-4391.174) [-4385.313] * [-4382.479] (-4389.143) (-4386.175) (-4397.917) -- 0:04:09
      194500 -- (-4388.265) (-4385.269) [-4396.306] (-4386.078) * (-4386.023) [-4388.943] (-4385.867) (-4397.765) -- 0:04:08
      195000 -- [-4391.700] (-4391.587) (-4394.888) (-4382.821) * (-4385.071) (-4388.412) [-4388.911] (-4395.518) -- 0:04:07

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-4394.881) (-4389.885) [-4390.848] (-4386.603) * (-4392.418) (-4391.541) [-4390.858] (-4397.729) -- 0:04:11
      196000 -- (-4389.257) [-4386.614] (-4392.290) (-4391.312) * (-4386.674) (-4391.680) (-4391.112) [-4393.646] -- 0:04:10
      196500 -- (-4393.692) (-4390.190) (-4384.089) [-4395.051] * [-4386.819] (-4388.051) (-4390.735) (-4392.487) -- 0:04:09
      197000 -- [-4393.720] (-4391.587) (-4390.391) (-4385.394) * [-4387.797] (-4389.905) (-4389.585) (-4391.160) -- 0:04:08
      197500 -- (-4387.731) (-4391.955) (-4384.284) [-4389.337] * [-4388.732] (-4390.850) (-4392.613) (-4391.318) -- 0:04:07
      198000 -- [-4390.161] (-4391.798) (-4389.662) (-4392.335) * [-4383.022] (-4389.289) (-4399.516) (-4391.547) -- 0:04:07
      198500 -- (-4398.383) (-4393.146) (-4390.551) [-4386.918] * (-4391.597) (-4393.711) [-4387.325] (-4389.739) -- 0:04:10
      199000 -- (-4385.260) (-4390.124) [-4396.380] (-4390.062) * (-4393.114) [-4389.513] (-4396.123) (-4393.776) -- 0:04:09
      199500 -- (-4387.371) (-4387.449) (-4384.871) [-4387.835] * (-4386.206) (-4395.146) (-4388.254) [-4389.695] -- 0:04:08
      200000 -- (-4387.156) (-4391.931) [-4381.480] (-4388.970) * (-4399.383) (-4390.683) [-4384.132] (-4388.962) -- 0:04:08

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-4383.597) (-4385.262) [-4387.826] (-4393.996) * (-4389.405) (-4392.818) [-4390.305] (-4386.082) -- 0:04:07
      201000 -- (-4397.623) (-4398.573) (-4384.472) [-4393.973] * (-4387.003) (-4386.624) [-4383.146] (-4389.760) -- 0:04:06
      201500 -- [-4384.626] (-4392.031) (-4393.098) (-4402.702) * (-4387.812) [-4389.275] (-4389.788) (-4388.325) -- 0:04:05
      202000 -- (-4391.319) (-4394.906) (-4389.385) [-4384.974] * (-4385.099) (-4398.200) (-4390.669) [-4386.582] -- 0:04:08
      202500 -- [-4396.442] (-4395.524) (-4391.006) (-4385.119) * [-4384.782] (-4393.494) (-4387.789) (-4391.785) -- 0:04:08
      203000 -- (-4392.846) [-4392.960] (-4395.383) (-4394.277) * [-4381.879] (-4395.636) (-4385.427) (-4390.473) -- 0:04:07
      203500 -- (-4387.463) (-4396.084) (-4391.389) [-4391.468] * (-4383.548) (-4391.287) [-4389.529] (-4388.398) -- 0:04:06
      204000 -- [-4386.046] (-4392.974) (-4389.003) (-4392.999) * (-4387.889) (-4387.894) [-4387.840] (-4389.255) -- 0:04:05
      204500 -- [-4388.304] (-4392.748) (-4390.945) (-4393.765) * [-4389.836] (-4386.288) (-4388.032) (-4391.663) -- 0:04:05
      205000 -- (-4387.999) (-4393.099) (-4391.583) [-4390.967] * [-4383.428] (-4390.190) (-4390.485) (-4399.843) -- 0:04:08

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-4390.179) [-4393.548] (-4391.329) (-4392.400) * [-4386.838] (-4387.979) (-4393.247) (-4387.247) -- 0:04:07
      206000 -- (-4383.281) [-4388.823] (-4393.273) (-4393.528) * (-4387.812) (-4389.534) [-4394.628] (-4386.998) -- 0:04:06
      206500 -- (-4390.481) (-4387.938) (-4385.407) [-4389.886] * (-4385.522) (-4387.435) (-4391.023) [-4386.858] -- 0:04:05
      207000 -- [-4388.024] (-4389.896) (-4388.262) (-4390.988) * (-4393.011) (-4390.767) (-4389.540) [-4390.774] -- 0:04:05
      207500 -- (-4389.667) (-4389.847) (-4388.367) [-4385.687] * (-4395.954) (-4391.629) [-4393.939] (-4387.414) -- 0:04:04
      208000 -- (-4391.578) (-4385.567) (-4387.885) [-4387.952] * (-4391.878) (-4386.962) [-4394.680] (-4398.842) -- 0:04:07
      208500 -- [-4389.003] (-4393.897) (-4388.235) (-4389.995) * (-4388.140) (-4396.911) [-4389.295] (-4385.979) -- 0:04:06
      209000 -- (-4389.983) (-4393.679) [-4389.096] (-4394.909) * [-4390.335] (-4395.561) (-4385.359) (-4391.584) -- 0:04:06
      209500 -- (-4395.480) [-4387.419] (-4385.491) (-4393.350) * (-4395.614) [-4388.089] (-4390.359) (-4387.820) -- 0:04:05
      210000 -- (-4388.998) (-4390.563) (-4390.574) [-4385.736] * [-4387.681] (-4387.375) (-4393.583) (-4387.562) -- 0:04:04

      Average standard deviation of split frequencies: 0.000000

      210500 -- [-4389.779] (-4391.101) (-4391.230) (-4388.832) * (-4392.853) [-4386.121] (-4391.201) (-4384.069) -- 0:04:03
      211000 -- (-4391.074) (-4393.175) [-4386.440] (-4394.042) * [-4383.056] (-4388.965) (-4394.223) (-4387.636) -- 0:04:03
      211500 -- (-4385.768) (-4395.322) [-4385.961] (-4395.175) * (-4387.304) [-4389.488] (-4389.256) (-4388.572) -- 0:04:06
      212000 -- [-4388.430] (-4385.795) (-4391.966) (-4391.731) * (-4389.749) (-4390.044) [-4386.661] (-4390.974) -- 0:04:05
      212500 -- (-4393.672) (-4390.253) [-4391.241] (-4390.105) * (-4386.223) (-4394.177) [-4389.191] (-4389.699) -- 0:04:04
      213000 -- (-4386.896) (-4393.273) [-4386.698] (-4396.974) * [-4390.282] (-4395.366) (-4386.237) (-4387.315) -- 0:04:03
      213500 -- (-4393.193) (-4391.822) (-4393.962) [-4393.746] * [-4389.952] (-4387.415) (-4389.973) (-4393.350) -- 0:04:03
      214000 -- (-4391.097) (-4393.294) [-4383.792] (-4387.211) * [-4386.772] (-4393.745) (-4391.412) (-4388.954) -- 0:04:02
      214500 -- (-4390.241) (-4395.533) (-4383.045) [-4390.602] * (-4388.349) (-4390.447) [-4396.616] (-4395.908) -- 0:04:05
      215000 -- [-4390.643] (-4389.534) (-4388.244) (-4389.898) * (-4387.761) [-4386.730] (-4388.172) (-4389.290) -- 0:04:04

      Average standard deviation of split frequencies: 0.000000

      215500 -- [-4390.562] (-4389.810) (-4386.248) (-4389.075) * (-4388.768) (-4387.713) [-4383.669] (-4391.610) -- 0:04:03
      216000 -- [-4393.386] (-4397.662) (-4388.531) (-4389.978) * (-4386.045) (-4391.488) [-4393.656] (-4389.718) -- 0:04:03
      216500 -- [-4389.693] (-4396.965) (-4387.091) (-4388.888) * [-4388.110] (-4389.473) (-4392.766) (-4390.514) -- 0:04:02
      217000 -- (-4383.708) [-4391.708] (-4398.690) (-4387.609) * (-4389.705) [-4384.825] (-4387.589) (-4386.256) -- 0:04:01
      217500 -- [-4387.083] (-4392.487) (-4388.643) (-4389.739) * (-4392.687) [-4390.009] (-4392.555) (-4392.279) -- 0:04:01
      218000 -- (-4389.311) [-4391.104] (-4387.824) (-4390.645) * [-4392.836] (-4392.897) (-4396.765) (-4387.589) -- 0:04:03
      218500 -- (-4396.039) (-4399.237) [-4385.909] (-4398.679) * (-4385.392) (-4391.216) [-4390.978] (-4387.326) -- 0:04:03
      219000 -- [-4390.333] (-4397.405) (-4385.478) (-4397.713) * (-4390.961) (-4389.341) [-4387.408] (-4389.477) -- 0:04:02
      219500 -- [-4390.835] (-4398.780) (-4385.609) (-4383.123) * (-4388.635) (-4386.857) (-4389.477) [-4385.493] -- 0:04:01
      220000 -- [-4387.008] (-4392.446) (-4390.670) (-4385.228) * [-4388.853] (-4395.874) (-4393.812) (-4387.648) -- 0:04:01

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-4382.410) [-4385.550] (-4391.678) (-4390.496) * (-4387.656) (-4394.208) (-4389.461) [-4386.692] -- 0:04:00
      221000 -- (-4402.605) (-4386.347) [-4393.100] (-4391.775) * (-4393.417) (-4393.679) [-4392.968] (-4387.822) -- 0:04:03
      221500 -- (-4394.759) (-4393.088) [-4389.794] (-4393.335) * (-4393.065) [-4384.701] (-4396.442) (-4387.138) -- 0:04:02
      222000 -- (-4393.534) [-4390.118] (-4388.442) (-4391.654) * [-4384.917] (-4389.442) (-4396.957) (-4392.262) -- 0:04:01
      222500 -- (-4389.291) [-4391.030] (-4394.746) (-4387.245) * (-4392.108) (-4383.146) [-4396.509] (-4392.302) -- 0:04:01
      223000 -- (-4387.363) (-4389.809) [-4390.508] (-4389.867) * [-4390.720] (-4389.484) (-4400.533) (-4390.378) -- 0:04:00
      223500 -- (-4386.138) (-4392.261) [-4387.107] (-4390.130) * (-4389.897) (-4386.045) [-4388.484] (-4390.403) -- 0:03:59
      224000 -- [-4388.831] (-4388.223) (-4386.250) (-4392.858) * (-4388.485) (-4383.434) (-4390.775) [-4387.840] -- 0:03:59
      224500 -- (-4383.987) (-4391.311) [-4388.371] (-4390.946) * (-4387.744) (-4388.615) [-4386.452] (-4396.464) -- 0:04:01
      225000 -- (-4394.591) [-4385.240] (-4403.099) (-4392.053) * [-4385.996] (-4386.014) (-4396.420) (-4386.190) -- 0:04:01

      Average standard deviation of split frequencies: 0.000000

      225500 -- [-4391.159] (-4385.971) (-4388.511) (-4389.742) * (-4390.587) (-4385.630) (-4388.902) [-4388.413] -- 0:04:00
      226000 -- (-4391.204) (-4387.487) [-4392.702] (-4389.101) * (-4392.974) [-4386.538] (-4388.513) (-4387.594) -- 0:03:59
      226500 -- [-4386.966] (-4387.905) (-4386.423) (-4391.866) * (-4394.688) (-4393.385) [-4388.054] (-4389.978) -- 0:03:59
      227000 -- (-4388.306) (-4390.305) (-4386.536) [-4392.104] * (-4385.897) (-4399.737) [-4384.977] (-4381.828) -- 0:03:58
      227500 -- (-4387.617) (-4393.949) (-4390.461) [-4388.847] * [-4392.119] (-4390.249) (-4385.057) (-4394.572) -- 0:04:01
      228000 -- (-4384.052) (-4395.267) [-4389.716] (-4393.696) * (-4389.651) (-4389.800) (-4403.729) [-4391.574] -- 0:04:00
      228500 -- [-4388.395] (-4397.044) (-4387.855) (-4386.337) * (-4396.195) (-4383.919) [-4389.914] (-4388.552) -- 0:03:59
      229000 -- [-4386.525] (-4391.112) (-4390.984) (-4386.899) * [-4394.687] (-4388.163) (-4389.559) (-4390.156) -- 0:03:59
      229500 -- [-4386.817] (-4393.169) (-4397.182) (-4391.268) * (-4393.518) (-4385.603) [-4393.625] (-4387.022) -- 0:03:58
      230000 -- [-4395.554] (-4388.548) (-4394.639) (-4389.559) * (-4399.028) (-4388.282) [-4391.292] (-4387.694) -- 0:03:57

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-4387.789) (-4392.840) [-4388.767] (-4388.840) * (-4396.299) (-4389.724) [-4387.152] (-4387.610) -- 0:03:57
      231000 -- (-4388.738) (-4389.850) [-4392.292] (-4384.569) * (-4392.646) (-4391.255) [-4384.951] (-4387.402) -- 0:03:59
      231500 -- (-4393.142) [-4392.787] (-4386.631) (-4386.673) * (-4390.117) (-4393.859) [-4391.588] (-4387.278) -- 0:03:59
      232000 -- (-4390.620) (-4389.179) [-4385.308] (-4388.256) * (-4392.057) [-4387.913] (-4392.372) (-4392.305) -- 0:03:58
      232500 -- (-4401.198) (-4386.167) [-4385.637] (-4387.295) * (-4391.540) [-4393.406] (-4388.828) (-4388.069) -- 0:03:57
      233000 -- [-4389.670] (-4387.274) (-4386.538) (-4392.107) * (-4393.674) (-4393.505) (-4387.676) [-4394.201] -- 0:03:57
      233500 -- [-4387.526] (-4389.618) (-4388.911) (-4396.386) * (-4388.454) (-4391.259) (-4388.328) [-4385.633] -- 0:03:56
      234000 -- (-4398.953) [-4386.076] (-4390.664) (-4391.619) * (-4389.069) (-4387.101) [-4386.753] (-4384.629) -- 0:03:58
      234500 -- (-4394.762) (-4388.215) (-4391.281) [-4384.829] * (-4389.837) (-4388.760) [-4391.585] (-4388.108) -- 0:03:58
      235000 -- (-4385.178) [-4389.382] (-4390.089) (-4385.929) * (-4389.279) (-4402.854) [-4387.748] (-4396.359) -- 0:03:57

      Average standard deviation of split frequencies: 0.000000

      235500 -- [-4384.824] (-4386.190) (-4386.240) (-4392.032) * (-4391.076) (-4394.033) (-4389.299) [-4395.698] -- 0:03:56
      236000 -- (-4385.309) (-4391.405) [-4386.110] (-4383.119) * (-4393.651) [-4386.273] (-4393.590) (-4389.141) -- 0:03:56
      236500 -- (-4386.182) (-4394.166) (-4390.872) [-4391.739] * (-4389.461) (-4386.533) (-4391.561) [-4385.505] -- 0:03:55
      237000 -- (-4389.993) (-4392.262) [-4390.777] (-4387.444) * (-4394.825) (-4389.990) (-4394.104) [-4386.957] -- 0:03:55
      237500 -- [-4385.320] (-4390.585) (-4389.851) (-4388.078) * (-4388.074) (-4389.626) (-4390.994) [-4391.049] -- 0:03:57
      238000 -- (-4385.926) [-4389.467] (-4390.326) (-4385.042) * (-4387.336) [-4392.800] (-4387.193) (-4394.065) -- 0:03:56
      238500 -- (-4387.170) (-4385.099) [-4385.115] (-4387.877) * (-4395.752) (-4391.772) [-4386.257] (-4391.235) -- 0:03:56
      239000 -- (-4390.054) (-4384.962) (-4389.885) [-4387.525] * (-4391.371) (-4388.553) [-4383.753] (-4383.024) -- 0:03:55
      239500 -- [-4384.752] (-4388.858) (-4389.928) (-4394.030) * (-4386.998) (-4387.345) [-4390.535] (-4392.103) -- 0:03:54
      240000 -- (-4391.186) (-4389.537) [-4390.171] (-4391.643) * [-4387.255] (-4388.615) (-4388.269) (-4396.015) -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-4384.399) (-4394.516) [-4390.629] (-4391.930) * [-4388.421] (-4393.386) (-4385.164) (-4387.499) -- 0:03:56
      241000 -- (-4388.362) (-4385.851) [-4387.349] (-4398.254) * (-4394.372) (-4397.363) (-4386.434) [-4387.044] -- 0:03:56
      241500 -- (-4386.781) (-4391.565) [-4384.131] (-4394.689) * (-4387.873) (-4387.675) [-4386.338] (-4389.979) -- 0:03:55
      242000 -- (-4387.175) (-4386.004) [-4387.947] (-4393.948) * [-4388.005] (-4392.110) (-4382.835) (-4401.190) -- 0:03:54
      242500 -- (-4385.181) (-4384.805) [-4389.281] (-4391.201) * (-4388.010) (-4386.493) [-4394.280] (-4398.217) -- 0:03:54
      243000 -- (-4390.896) (-4382.809) [-4385.870] (-4391.692) * (-4386.138) (-4392.507) (-4392.188) [-4393.607] -- 0:03:53
      243500 -- (-4388.618) (-4387.143) [-4390.772] (-4390.562) * (-4393.809) (-4400.336) (-4390.830) [-4387.616] -- 0:03:53
      244000 -- (-4387.674) (-4385.324) (-4395.857) [-4394.772] * [-4392.580] (-4392.660) (-4392.163) (-4389.917) -- 0:03:55
      244500 -- (-4394.404) (-4387.650) [-4389.492] (-4387.863) * (-4398.735) (-4393.616) (-4387.392) [-4387.914] -- 0:03:54
      245000 -- (-4397.461) (-4389.086) (-4391.356) [-4390.376] * (-4392.246) (-4393.362) (-4385.350) [-4385.486] -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-4394.605) (-4384.939) [-4396.399] (-4389.022) * [-4390.537] (-4393.763) (-4390.348) (-4387.830) -- 0:03:53
      246000 -- (-4384.035) [-4392.874] (-4395.252) (-4392.384) * (-4395.325) [-4389.178] (-4384.108) (-4387.146) -- 0:03:52
      246500 -- [-4383.843] (-4389.402) (-4395.464) (-4390.846) * (-4392.649) (-4398.179) [-4387.358] (-4390.106) -- 0:03:52
      247000 -- (-4395.516) (-4395.733) [-4389.178] (-4387.995) * (-4389.375) [-4388.555] (-4383.773) (-4393.001) -- 0:03:54
      247500 -- (-4392.012) (-4399.260) [-4388.510] (-4394.863) * [-4391.465] (-4387.641) (-4386.785) (-4396.629) -- 0:03:54
      248000 -- (-4386.637) (-4391.384) [-4387.761] (-4392.424) * (-4384.939) (-4386.503) [-4386.863] (-4394.261) -- 0:03:53
      248500 -- (-4393.515) [-4391.485] (-4386.545) (-4391.035) * (-4395.779) (-4390.627) [-4388.280] (-4396.070) -- 0:03:52
      249000 -- (-4394.253) [-4385.742] (-4394.491) (-4389.955) * (-4401.241) (-4386.604) (-4386.069) [-4383.853] -- 0:03:52
      249500 -- (-4383.977) [-4390.695] (-4391.611) (-4398.037) * (-4387.784) [-4387.447] (-4390.462) (-4389.508) -- 0:03:51
      250000 -- (-4386.652) [-4389.291] (-4386.537) (-4397.220) * (-4384.406) [-4385.585] (-4391.069) (-4394.591) -- 0:03:51

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-4384.597) (-4389.536) [-4392.376] (-4393.016) * (-4389.062) (-4381.949) [-4390.071] (-4384.341) -- 0:03:53
      251000 -- (-4390.326) [-4389.403] (-4397.065) (-4394.407) * (-4382.598) (-4395.109) [-4389.398] (-4396.439) -- 0:03:52
      251500 -- (-4390.734) (-4394.992) [-4387.912] (-4391.410) * [-4387.757] (-4389.368) (-4386.450) (-4392.342) -- 0:03:52
      252000 -- [-4396.253] (-4388.312) (-4387.524) (-4393.405) * (-4386.692) (-4387.714) [-4389.706] (-4395.707) -- 0:03:51
      252500 -- (-4390.330) [-4385.602] (-4388.470) (-4394.860) * (-4390.581) (-4389.684) [-4387.987] (-4393.314) -- 0:03:50
      253000 -- (-4385.947) (-4388.250) [-4389.819] (-4394.403) * (-4394.581) (-4395.316) (-4397.451) [-4391.750] -- 0:03:50
      253500 -- (-4388.715) (-4388.756) (-4391.895) [-4397.843] * (-4394.561) (-4395.364) (-4396.715) [-4391.626] -- 0:03:52
      254000 -- (-4386.495) [-4382.782] (-4392.854) (-4393.278) * (-4395.514) (-4391.452) (-4395.583) [-4385.662] -- 0:03:52
      254500 -- [-4389.262] (-4389.675) (-4389.066) (-4384.378) * (-4393.613) [-4388.062] (-4387.542) (-4384.100) -- 0:03:51
      255000 -- (-4386.837) (-4390.863) [-4384.039] (-4387.330) * [-4390.478] (-4391.807) (-4385.487) (-4385.647) -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      255500 -- [-4390.069] (-4390.622) (-4386.466) (-4387.209) * [-4391.942] (-4391.277) (-4389.756) (-4390.175) -- 0:03:50
      256000 -- (-4389.682) (-4387.920) [-4387.719] (-4391.990) * (-4389.294) (-4393.434) (-4390.987) [-4393.490] -- 0:03:49
      256500 -- (-4389.597) (-4393.897) (-4389.864) [-4389.102] * [-4388.342] (-4390.142) (-4389.636) (-4404.246) -- 0:03:48
      257000 -- [-4385.948] (-4386.606) (-4386.542) (-4390.945) * (-4390.509) (-4385.570) [-4384.947] (-4401.957) -- 0:03:51
      257500 -- (-4398.801) [-4385.970] (-4387.451) (-4386.352) * (-4398.028) (-4396.084) [-4389.944] (-4389.115) -- 0:03:50
      258000 -- (-4387.253) (-4392.912) (-4387.860) [-4390.633] * (-4394.742) (-4390.762) (-4389.686) [-4388.524] -- 0:03:50
      258500 -- [-4393.340] (-4392.680) (-4390.314) (-4391.630) * (-4391.717) (-4394.431) [-4386.869] (-4388.239) -- 0:03:49
      259000 -- [-4386.044] (-4393.148) (-4386.321) (-4387.625) * (-4395.059) (-4394.891) (-4394.168) [-4385.754] -- 0:03:48
      259500 -- (-4391.463) (-4386.207) (-4385.757) [-4382.098] * [-4389.296] (-4386.786) (-4407.305) (-4392.218) -- 0:03:48
      260000 -- [-4401.602] (-4388.188) (-4389.444) (-4394.814) * (-4386.475) (-4392.546) [-4393.604] (-4396.233) -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      260500 -- [-4392.993] (-4389.064) (-4390.198) (-4393.170) * (-4391.781) (-4393.938) [-4388.503] (-4386.066) -- 0:03:49
      261000 -- (-4390.165) [-4392.121] (-4390.828) (-4392.198) * (-4393.187) (-4390.137) [-4385.776] (-4394.513) -- 0:03:49
      261500 -- (-4394.541) (-4385.453) (-4384.211) [-4385.534] * (-4396.966) (-4391.597) [-4386.327] (-4387.915) -- 0:03:48
      262000 -- (-4391.429) (-4391.825) (-4389.543) [-4390.553] * [-4389.229] (-4390.226) (-4389.324) (-4391.989) -- 0:03:48
      262500 -- [-4389.632] (-4388.363) (-4390.690) (-4383.907) * (-4388.559) (-4391.293) [-4384.649] (-4389.193) -- 0:03:47
      263000 -- [-4386.846] (-4389.641) (-4389.986) (-4395.738) * (-4385.977) (-4383.923) (-4392.904) [-4386.485] -- 0:03:46
      263500 -- (-4386.131) (-4387.037) [-4388.285] (-4392.895) * (-4392.637) (-4385.144) [-4383.155] (-4394.478) -- 0:03:49
      264000 -- (-4390.656) [-4387.218] (-4395.667) (-4389.153) * (-4389.654) [-4391.862] (-4385.500) (-4389.129) -- 0:03:48
      264500 -- (-4388.403) (-4387.961) [-4393.716] (-4392.354) * (-4393.514) (-4393.188) [-4387.818] (-4388.309) -- 0:03:48
      265000 -- (-4387.918) (-4389.908) [-4391.930] (-4386.707) * (-4386.695) [-4389.146] (-4385.239) (-4391.918) -- 0:03:47

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-4391.249) [-4385.525] (-4394.798) (-4393.049) * (-4384.845) [-4391.686] (-4384.157) (-4395.611) -- 0:03:46
      266000 -- (-4388.967) [-4389.597] (-4391.139) (-4389.981) * (-4390.827) (-4387.530) [-4385.984] (-4393.966) -- 0:03:46
      266500 -- (-4387.455) (-4388.924) (-4387.894) [-4389.148] * (-4389.832) (-4386.379) (-4390.963) [-4383.123] -- 0:03:48
      267000 -- (-4385.593) (-4390.076) [-4387.277] (-4389.747) * [-4387.879] (-4389.790) (-4393.347) (-4390.466) -- 0:03:47
      267500 -- (-4388.510) (-4389.125) (-4386.211) [-4385.153] * (-4390.988) [-4385.225] (-4391.393) (-4391.198) -- 0:03:47
      268000 -- (-4388.835) (-4386.975) (-4398.633) [-4392.126] * (-4388.160) (-4394.693) [-4382.599] (-4392.907) -- 0:03:46
      268500 -- (-4393.305) (-4386.136) [-4387.410] (-4387.838) * [-4387.987] (-4393.707) (-4390.051) (-4395.797) -- 0:03:46
      269000 -- (-4387.975) [-4388.109] (-4396.471) (-4388.280) * (-4392.715) (-4389.067) [-4393.336] (-4401.283) -- 0:03:45
      269500 -- (-4389.707) (-4389.855) (-4380.871) [-4384.307] * (-4392.184) [-4394.937] (-4391.832) (-4397.997) -- 0:03:44
      270000 -- (-4393.688) (-4392.956) (-4389.162) [-4384.463] * (-4391.240) [-4388.595] (-4393.158) (-4401.231) -- 0:03:47

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-4389.665) [-4385.955] (-4391.350) (-4383.702) * [-4394.051] (-4386.304) (-4389.377) (-4391.165) -- 0:03:46
      271000 -- (-4391.553) (-4393.357) (-4387.166) [-4391.598] * (-4396.527) (-4390.130) (-4388.387) [-4397.306] -- 0:03:45
      271500 -- (-4391.881) (-4386.305) [-4389.093] (-4387.347) * (-4388.548) [-4390.417] (-4390.478) (-4394.440) -- 0:03:45
      272000 -- (-4390.119) [-4382.523] (-4390.623) (-4395.458) * (-4390.147) (-4386.185) [-4387.457] (-4407.075) -- 0:03:44
      272500 -- [-4387.109] (-4385.568) (-4386.726) (-4393.883) * (-4386.616) (-4384.636) (-4394.653) [-4388.792] -- 0:03:44
      273000 -- (-4388.166) (-4388.776) (-4388.213) [-4388.223] * (-4387.237) (-4391.980) [-4392.294] (-4391.318) -- 0:03:46
      273500 -- (-4389.759) [-4384.945] (-4389.901) (-4393.683) * (-4386.856) (-4394.327) [-4389.846] (-4393.589) -- 0:03:45
      274000 -- (-4393.982) (-4388.986) (-4390.082) [-4390.231] * (-4386.550) (-4387.057) (-4384.613) [-4390.267] -- 0:03:45
      274500 -- (-4396.686) [-4388.225] (-4384.071) (-4390.784) * (-4383.386) [-4389.139] (-4389.474) (-4386.922) -- 0:03:44
      275000 -- (-4389.006) (-4389.589) (-4392.875) [-4385.920] * [-4382.606] (-4387.301) (-4392.463) (-4387.355) -- 0:03:44

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-4390.353] (-4389.631) (-4390.512) (-4392.127) * (-4385.776) [-4383.863] (-4392.512) (-4388.561) -- 0:03:43
      276000 -- [-4386.510] (-4387.889) (-4389.388) (-4393.677) * (-4389.348) (-4389.822) [-4388.516] (-4392.106) -- 0:03:42
      276500 -- (-4396.866) (-4384.912) [-4389.699] (-4391.063) * (-4382.122) (-4390.134) [-4384.317] (-4383.055) -- 0:03:45
      277000 -- (-4388.869) [-4386.472] (-4387.117) (-4394.455) * (-4388.286) [-4388.901] (-4389.122) (-4388.821) -- 0:03:44
      277500 -- [-4384.056] (-4390.163) (-4386.368) (-4396.891) * [-4385.600] (-4385.548) (-4392.997) (-4390.718) -- 0:03:43
      278000 -- [-4390.062] (-4390.784) (-4394.491) (-4388.117) * [-4387.686] (-4386.019) (-4389.644) (-4388.034) -- 0:03:43
      278500 -- (-4386.836) (-4387.032) (-4389.969) [-4387.485] * (-4384.379) (-4391.848) (-4391.986) [-4389.760] -- 0:03:42
      279000 -- (-4399.761) (-4385.254) (-4388.480) [-4386.385] * (-4393.312) (-4387.209) [-4389.771] (-4395.375) -- 0:03:42
      279500 -- [-4396.203] (-4386.542) (-4389.095) (-4398.046) * (-4397.458) (-4391.146) (-4390.374) [-4394.879] -- 0:03:44
      280000 -- (-4396.532) [-4389.929] (-4392.461) (-4392.432) * (-4392.910) (-4386.813) [-4392.855] (-4390.121) -- 0:03:43

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-4388.647) (-4396.180) (-4386.156) [-4387.027] * [-4389.885] (-4389.702) (-4391.626) (-4391.955) -- 0:03:43
      281000 -- [-4392.315] (-4390.870) (-4390.830) (-4385.950) * (-4395.858) [-4390.248] (-4383.725) (-4394.452) -- 0:03:42
      281500 -- (-4396.122) [-4393.540] (-4389.284) (-4385.330) * [-4387.957] (-4392.866) (-4386.560) (-4393.557) -- 0:03:42
      282000 -- (-4389.680) [-4386.025] (-4386.112) (-4389.116) * (-4387.199) (-4388.122) [-4385.211] (-4386.748) -- 0:03:41
      282500 -- (-4388.495) [-4397.602] (-4387.175) (-4385.082) * (-4384.577) [-4390.761] (-4389.340) (-4388.471) -- 0:03:40
      283000 -- (-4387.759) (-4393.416) [-4383.380] (-4389.118) * [-4386.147] (-4387.672) (-4396.292) (-4390.321) -- 0:03:42
      283500 -- (-4385.962) (-4393.170) (-4403.608) [-4391.276] * (-4387.174) (-4387.980) [-4391.709] (-4393.869) -- 0:03:42
      284000 -- (-4393.901) (-4395.245) (-4399.080) [-4387.257] * (-4394.251) [-4389.155] (-4385.240) (-4396.353) -- 0:03:41
      284500 -- (-4388.385) (-4394.496) (-4392.254) [-4388.482] * (-4391.425) (-4392.507) [-4383.914] (-4385.737) -- 0:03:41
      285000 -- (-4393.818) [-4384.261] (-4389.611) (-4384.686) * (-4393.151) (-4389.403) (-4396.568) [-4388.522] -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-4389.160) (-4387.159) (-4391.385) [-4389.675] * (-4395.347) [-4388.084] (-4394.068) (-4397.407) -- 0:03:40
      286000 -- (-4385.191) (-4392.724) (-4383.801) [-4381.999] * (-4386.436) (-4392.950) [-4391.294] (-4390.502) -- 0:03:42
      286500 -- (-4388.099) (-4390.175) [-4387.120] (-4388.133) * (-4388.006) (-4384.828) [-4394.236] (-4389.370) -- 0:03:41
      287000 -- (-4389.119) [-4384.267] (-4388.799) (-4389.792) * (-4398.768) [-4385.083] (-4383.847) (-4391.221) -- 0:03:41
      287500 -- (-4386.510) (-4384.557) [-4393.977] (-4390.139) * (-4393.655) (-4396.486) (-4390.269) [-4385.977] -- 0:03:40
      288000 -- (-4390.187) (-4391.817) (-4390.501) [-4386.098] * (-4394.513) (-4393.143) (-4398.420) [-4393.341] -- 0:03:40
      288500 -- (-4392.638) (-4386.118) (-4392.523) [-4386.445] * [-4390.582] (-4385.279) (-4397.002) (-4393.850) -- 0:03:39
      289000 -- (-4388.672) (-4394.343) [-4386.300] (-4387.825) * (-4390.832) (-4386.234) (-4397.809) [-4391.742] -- 0:03:38
      289500 -- [-4382.859] (-4389.366) (-4394.860) (-4384.229) * (-4389.793) [-4390.174] (-4393.747) (-4392.071) -- 0:03:40
      290000 -- (-4394.284) (-4385.385) (-4387.502) [-4386.710] * (-4384.755) [-4388.086] (-4398.085) (-4397.454) -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-4391.403) (-4390.054) (-4384.371) [-4398.479] * [-4388.940] (-4388.947) (-4402.030) (-4396.331) -- 0:03:39
      291000 -- (-4388.800) [-4388.451] (-4397.996) (-4388.306) * (-4391.574) (-4389.400) (-4391.230) [-4390.502] -- 0:03:39
      291500 -- (-4386.702) [-4392.699] (-4386.812) (-4391.117) * (-4390.661) [-4384.627] (-4388.709) (-4390.550) -- 0:03:38
      292000 -- [-4384.376] (-4389.431) (-4393.670) (-4391.331) * (-4390.130) (-4390.339) (-4390.372) [-4387.154] -- 0:03:38
      292500 -- (-4387.349) (-4399.055) (-4396.832) [-4395.224] * [-4396.417] (-4385.126) (-4387.571) (-4389.111) -- 0:03:40
      293000 -- (-4393.410) [-4395.955] (-4397.860) (-4387.612) * (-4391.905) (-4392.336) [-4389.166] (-4386.473) -- 0:03:39
      293500 -- (-4387.374) (-4387.993) [-4393.972] (-4391.810) * (-4392.762) (-4390.726) [-4386.339] (-4392.296) -- 0:03:39
      294000 -- (-4388.161) (-4388.747) (-4394.688) [-4387.009] * (-4386.632) [-4390.496] (-4387.623) (-4386.372) -- 0:03:38
      294500 -- (-4397.764) (-4389.574) (-4393.339) [-4390.864] * (-4393.950) (-4388.069) [-4391.645] (-4387.090) -- 0:03:37
      295000 -- [-4388.811] (-4394.987) (-4389.377) (-4404.578) * (-4384.384) (-4392.178) [-4384.802] (-4388.276) -- 0:03:37

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-4384.443) (-4390.203) [-4388.965] (-4388.851) * (-4389.093) [-4389.430] (-4385.697) (-4388.153) -- 0:03:36
      296000 -- (-4390.770) (-4396.444) (-4402.139) [-4390.781] * (-4392.225) [-4388.299] (-4390.937) (-4383.897) -- 0:03:38
      296500 -- (-4390.826) (-4393.234) [-4382.364] (-4387.667) * (-4388.496) (-4389.610) [-4389.069] (-4382.938) -- 0:03:38
      297000 -- (-4391.392) (-4389.241) (-4386.475) [-4389.409] * [-4388.494] (-4395.394) (-4388.076) (-4390.267) -- 0:03:37
      297500 -- (-4392.754) [-4387.847] (-4386.000) (-4390.352) * (-4389.726) [-4390.821] (-4397.447) (-4383.908) -- 0:03:37
      298000 -- [-4394.824] (-4389.335) (-4387.020) (-4386.630) * [-4388.548] (-4390.089) (-4406.928) (-4387.794) -- 0:03:36
      298500 -- (-4397.098) [-4388.987] (-4395.460) (-4383.850) * (-4398.092) [-4392.754] (-4406.361) (-4395.817) -- 0:03:36
      299000 -- (-4388.019) (-4390.282) (-4393.906) [-4385.300] * (-4397.364) (-4389.754) (-4391.746) [-4389.183] -- 0:03:38
      299500 -- (-4388.945) (-4385.826) (-4391.504) [-4388.807] * (-4388.849) (-4389.993) [-4392.004] (-4389.459) -- 0:03:37
      300000 -- (-4397.420) (-4391.640) (-4395.790) [-4381.761] * (-4398.538) (-4391.177) (-4390.843) [-4390.149] -- 0:03:37

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-4393.152) (-4390.231) [-4392.673] (-4391.940) * [-4385.884] (-4386.789) (-4395.901) (-4395.376) -- 0:03:36
      301000 -- (-4390.041) [-4389.088] (-4395.889) (-4393.981) * (-4393.630) (-4392.403) [-4393.528] (-4385.248) -- 0:03:35
      301500 -- (-4390.696) [-4391.164] (-4397.410) (-4391.808) * (-4392.125) (-4395.198) [-4389.975] (-4389.587) -- 0:03:35
      302000 -- (-4392.221) [-4385.971] (-4393.205) (-4389.986) * (-4393.768) [-4388.020] (-4388.125) (-4395.172) -- 0:03:34
      302500 -- (-4385.907) (-4386.717) (-4392.501) [-4389.776] * (-4395.545) [-4391.134] (-4384.461) (-4392.206) -- 0:03:36
      303000 -- (-4395.590) [-4387.369] (-4387.966) (-4389.954) * (-4389.923) (-4391.903) (-4390.611) [-4387.461] -- 0:03:36
      303500 -- [-4385.741] (-4387.672) (-4390.049) (-4386.157) * (-4388.318) [-4387.142] (-4393.399) (-4390.196) -- 0:03:35
      304000 -- (-4385.457) (-4389.359) (-4390.594) [-4389.372] * (-4393.419) (-4393.236) (-4388.597) [-4391.430] -- 0:03:35
      304500 -- [-4391.139] (-4387.587) (-4391.908) (-4395.050) * (-4397.048) (-4392.433) [-4395.039] (-4392.335) -- 0:03:34
      305000 -- (-4387.523) (-4387.121) [-4386.463] (-4383.586) * [-4385.137] (-4391.048) (-4393.583) (-4392.763) -- 0:03:34

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-4389.693) (-4396.259) (-4387.344) [-4389.018] * [-4385.354] (-4385.601) (-4387.189) (-4398.846) -- 0:03:35
      306000 -- (-4389.115) [-4386.837] (-4394.879) (-4389.583) * (-4386.103) (-4387.793) (-4389.747) [-4387.148] -- 0:03:35
      306500 -- [-4388.749] (-4389.473) (-4394.478) (-4391.339) * (-4386.388) (-4394.794) [-4386.803] (-4382.010) -- 0:03:34
      307000 -- (-4400.540) (-4391.222) (-4391.585) [-4389.495] * (-4399.750) [-4389.958] (-4383.010) (-4395.985) -- 0:03:34
      307500 -- (-4395.089) (-4391.266) [-4390.102] (-4393.874) * (-4390.311) [-4389.799] (-4382.929) (-4389.991) -- 0:03:33
      308000 -- [-4391.709] (-4386.245) (-4390.961) (-4396.412) * (-4390.967) (-4388.128) [-4393.507] (-4393.913) -- 0:03:33
      308500 -- (-4396.754) [-4384.558] (-4391.313) (-4387.503) * [-4387.500] (-4398.580) (-4386.096) (-4390.545) -- 0:03:32
      309000 -- (-4389.526) (-4383.162) (-4384.900) [-4389.648] * (-4386.029) (-4391.400) (-4384.422) [-4397.446] -- 0:03:34
      309500 -- (-4389.542) [-4391.293] (-4389.238) (-4394.826) * (-4388.085) (-4400.572) [-4390.510] (-4388.433) -- 0:03:34
      310000 -- [-4384.748] (-4383.893) (-4390.045) (-4400.067) * (-4389.090) [-4395.662] (-4403.721) (-4392.398) -- 0:03:33

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-4383.509) (-4389.568) (-4391.851) [-4388.227] * [-4393.287] (-4391.494) (-4393.534) (-4389.999) -- 0:03:33
      311000 -- (-4389.908) (-4393.603) (-4383.382) [-4387.501] * [-4388.795] (-4391.199) (-4390.680) (-4383.582) -- 0:03:32
      311500 -- [-4389.364] (-4392.724) (-4388.617) (-4388.627) * [-4390.874] (-4387.557) (-4385.480) (-4387.151) -- 0:03:32
      312000 -- (-4384.260) (-4398.882) (-4384.553) [-4388.741] * [-4391.627] (-4387.477) (-4391.596) (-4393.037) -- 0:03:33
      312500 -- (-4404.691) [-4390.355] (-4387.544) (-4387.402) * (-4390.937) [-4384.875] (-4387.005) (-4391.251) -- 0:03:33
      313000 -- (-4388.384) (-4394.657) [-4392.477] (-4389.229) * (-4393.279) [-4388.483] (-4384.523) (-4394.938) -- 0:03:32
      313500 -- (-4390.095) (-4384.691) (-4385.912) [-4395.879] * (-4390.315) (-4391.926) (-4381.796) [-4386.077] -- 0:03:32
      314000 -- (-4391.831) (-4387.016) [-4397.500] (-4396.096) * (-4388.294) (-4387.622) [-4388.892] (-4390.645) -- 0:03:31
      314500 -- (-4395.529) [-4388.158] (-4384.088) (-4386.143) * (-4388.458) [-4385.317] (-4387.675) (-4389.783) -- 0:03:31
      315000 -- (-4390.362) (-4386.720) (-4385.881) [-4386.859] * (-4388.520) (-4385.351) (-4393.066) [-4389.884] -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-4397.532) (-4389.474) (-4385.643) [-4386.490] * (-4399.217) (-4389.851) (-4383.131) [-4385.927] -- 0:03:32
      316000 -- (-4388.201) (-4399.261) [-4393.003] (-4391.931) * (-4395.198) (-4394.712) [-4384.568] (-4391.151) -- 0:03:32
      316500 -- [-4391.600] (-4390.986) (-4390.760) (-4395.645) * (-4394.698) (-4393.210) [-4389.212] (-4388.280) -- 0:03:31
      317000 -- (-4384.454) (-4391.045) [-4392.244] (-4393.632) * [-4391.814] (-4397.779) (-4395.288) (-4393.966) -- 0:03:31
      317500 -- (-4388.719) (-4386.995) [-4386.412] (-4396.699) * (-4390.286) [-4390.215] (-4393.818) (-4390.198) -- 0:03:30
      318000 -- (-4390.061) (-4387.482) (-4389.751) [-4389.426] * (-4389.902) (-4389.306) (-4391.131) [-4389.336] -- 0:03:30
      318500 -- (-4390.612) [-4387.051] (-4383.699) (-4395.394) * (-4390.279) [-4390.892] (-4387.332) (-4390.370) -- 0:03:31
      319000 -- (-4387.541) [-4406.748] (-4390.620) (-4396.265) * [-4392.896] (-4395.278) (-4391.824) (-4385.455) -- 0:03:31
      319500 -- (-4389.657) (-4396.672) (-4385.598) [-4383.778] * (-4391.904) [-4396.102] (-4392.227) (-4387.612) -- 0:03:30
      320000 -- [-4388.064] (-4395.426) (-4384.930) (-4390.265) * (-4394.858) (-4389.973) [-4387.739] (-4386.721) -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      320500 -- [-4386.486] (-4402.268) (-4387.682) (-4387.164) * (-4395.989) [-4389.357] (-4391.019) (-4392.710) -- 0:03:29
      321000 -- (-4391.771) (-4393.491) (-4393.090) [-4391.812] * (-4388.489) (-4395.477) (-4390.931) [-4387.925] -- 0:03:29
      321500 -- [-4385.835] (-4388.030) (-4387.003) (-4384.962) * (-4387.486) (-4389.039) [-4389.174] (-4390.042) -- 0:03:28
      322000 -- (-4387.968) (-4383.478) (-4388.186) [-4392.824] * (-4398.223) [-4387.925] (-4392.466) (-4387.422) -- 0:03:30
      322500 -- (-4383.901) (-4386.770) [-4388.692] (-4391.795) * (-4385.981) (-4387.911) [-4393.440] (-4390.849) -- 0:03:30
      323000 -- [-4390.851] (-4395.044) (-4391.384) (-4388.335) * (-4387.550) (-4389.135) [-4390.641] (-4386.276) -- 0:03:29
      323500 -- (-4394.198) (-4391.581) (-4382.251) [-4389.048] * (-4383.718) (-4393.748) [-4388.417] (-4388.696) -- 0:03:29
      324000 -- (-4392.057) (-4387.258) [-4393.861] (-4407.831) * (-4394.711) [-4387.763] (-4385.280) (-4390.579) -- 0:03:28
      324500 -- (-4389.722) (-4388.438) [-4388.786] (-4393.839) * (-4390.615) [-4389.227] (-4386.017) (-4389.486) -- 0:03:28
      325000 -- [-4392.052] (-4392.019) (-4391.230) (-4390.335) * (-4386.229) (-4395.719) [-4389.999] (-4390.855) -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-4388.423) [-4388.310] (-4389.805) (-4394.424) * (-4386.723) (-4393.799) [-4393.110] (-4393.825) -- 0:03:29
      326000 -- (-4387.702) [-4389.112] (-4392.746) (-4392.705) * [-4386.942] (-4393.128) (-4400.594) (-4390.230) -- 0:03:28
      326500 -- (-4395.695) (-4397.299) [-4389.946] (-4389.951) * (-4385.744) [-4391.811] (-4395.008) (-4384.505) -- 0:03:28
      327000 -- (-4388.104) (-4390.902) (-4385.048) [-4393.347] * (-4390.427) (-4386.289) [-4390.866] (-4388.255) -- 0:03:27
      327500 -- (-4389.284) (-4391.252) [-4389.596] (-4385.759) * (-4394.786) (-4386.593) (-4387.372) [-4389.630] -- 0:03:27
      328000 -- (-4390.777) (-4392.696) (-4391.651) [-4385.566] * (-4396.308) (-4385.778) [-4388.580] (-4393.486) -- 0:03:26
      328500 -- [-4395.517] (-4384.164) (-4389.044) (-4390.670) * [-4386.160] (-4391.440) (-4384.885) (-4385.111) -- 0:03:28
      329000 -- (-4388.593) (-4395.288) (-4388.314) [-4386.829] * [-4386.561] (-4389.614) (-4386.812) (-4392.970) -- 0:03:28
      329500 -- [-4383.357] (-4388.097) (-4395.480) (-4391.749) * (-4387.220) [-4390.315] (-4392.525) (-4387.208) -- 0:03:27
      330000 -- (-4390.021) (-4389.834) [-4394.570] (-4387.089) * [-4385.706] (-4393.474) (-4388.806) (-4383.660) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-4391.281) [-4388.572] (-4387.524) (-4394.708) * (-4389.225) (-4393.864) (-4387.829) [-4392.331] -- 0:03:26
      331000 -- (-4386.351) (-4390.677) [-4391.769] (-4387.014) * (-4393.410) (-4387.896) (-4392.085) [-4389.242] -- 0:03:26
      331500 -- [-4388.399] (-4389.388) (-4395.203) (-4393.306) * (-4391.101) [-4393.778] (-4385.671) (-4389.336) -- 0:03:27
      332000 -- (-4391.075) [-4385.497] (-4396.246) (-4393.579) * (-4387.769) [-4383.746] (-4394.642) (-4385.420) -- 0:03:27
      332500 -- [-4397.119] (-4387.885) (-4389.979) (-4386.232) * (-4385.796) [-4391.093] (-4395.486) (-4386.724) -- 0:03:26
      333000 -- (-4390.192) (-4403.402) (-4386.299) [-4388.198] * (-4384.452) (-4387.068) (-4389.345) [-4385.034] -- 0:03:26
      333500 -- [-4387.397] (-4393.349) (-4387.724) (-4387.331) * (-4389.696) [-4390.894] (-4392.666) (-4383.848) -- 0:03:25
      334000 -- (-4401.303) (-4391.713) [-4389.570] (-4390.080) * [-4385.329] (-4389.162) (-4389.297) (-4390.678) -- 0:03:25
      334500 -- (-4393.717) (-4386.197) [-4389.992] (-4391.231) * (-4390.134) (-4387.971) (-4392.495) [-4394.027] -- 0:03:24
      335000 -- (-4394.074) [-4388.548] (-4384.400) (-4388.363) * [-4390.255] (-4386.279) (-4392.508) (-4389.356) -- 0:03:26

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-4400.287) (-4388.445) [-4391.522] (-4388.092) * (-4390.020) (-4386.499) [-4385.880] (-4394.380) -- 0:03:25
      336000 -- (-4396.303) [-4391.511] (-4396.191) (-4391.419) * (-4391.366) (-4393.003) (-4389.918) [-4388.688] -- 0:03:25
      336500 -- (-4395.233) [-4386.371] (-4388.269) (-4396.796) * (-4391.388) [-4394.904] (-4390.798) (-4388.174) -- 0:03:25
      337000 -- (-4393.093) (-4388.691) (-4390.138) [-4391.742] * (-4394.887) (-4400.819) (-4391.536) [-4386.235] -- 0:03:24
      337500 -- (-4391.911) [-4392.250] (-4384.646) (-4386.738) * (-4397.114) (-4395.487) (-4400.452) [-4388.401] -- 0:03:24
      338000 -- (-4387.745) (-4391.744) [-4388.758] (-4391.902) * (-4390.607) [-4387.747] (-4392.037) (-4386.842) -- 0:03:25
      338500 -- (-4389.349) (-4394.240) [-4387.228] (-4388.805) * (-4397.274) (-4394.318) (-4389.392) [-4387.692] -- 0:03:25
      339000 -- (-4389.816) [-4384.337] (-4384.336) (-4387.823) * (-4393.409) (-4390.498) (-4389.696) [-4388.117] -- 0:03:24
      339500 -- (-4389.384) (-4390.415) (-4393.871) [-4385.273] * [-4394.733] (-4395.895) (-4390.585) (-4391.443) -- 0:03:24
      340000 -- (-4386.491) [-4384.071] (-4394.555) (-4390.594) * (-4388.997) [-4400.465] (-4391.891) (-4398.067) -- 0:03:23

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-4385.455] (-4384.117) (-4392.033) (-4385.318) * (-4387.197) (-4387.762) (-4386.359) [-4391.533] -- 0:03:23
      341000 -- (-4388.767) (-4389.813) (-4392.985) [-4391.009] * (-4384.400) [-4388.822] (-4389.673) (-4395.292) -- 0:03:22
      341500 -- (-4385.232) [-4386.605] (-4399.387) (-4384.661) * (-4383.655) (-4391.555) [-4393.260] (-4390.141) -- 0:03:24
      342000 -- (-4386.932) (-4394.175) [-4386.069] (-4394.186) * (-4390.542) (-4396.172) (-4389.403) [-4389.655] -- 0:03:23
      342500 -- (-4391.035) [-4384.942] (-4388.609) (-4389.501) * (-4390.922) (-4392.566) (-4389.722) [-4389.277] -- 0:03:23
      343000 -- [-4387.882] (-4384.747) (-4388.066) (-4392.215) * (-4388.431) (-4385.554) (-4386.543) [-4386.026] -- 0:03:23
      343500 -- (-4391.953) [-4391.352] (-4387.359) (-4393.106) * (-4390.316) (-4393.045) [-4396.803] (-4394.698) -- 0:03:22
      344000 -- (-4390.978) (-4386.175) [-4390.660] (-4390.770) * (-4388.159) (-4392.743) (-4384.302) [-4388.667] -- 0:03:22
      344500 -- (-4391.538) (-4394.670) (-4386.495) [-4386.546] * (-4386.002) (-4386.393) [-4390.773] (-4388.312) -- 0:03:23
      345000 -- (-4386.357) (-4390.763) (-4387.233) [-4387.541] * [-4381.474] (-4387.677) (-4384.990) (-4391.628) -- 0:03:23

      Average standard deviation of split frequencies: 0.000000

      345500 -- [-4390.340] (-4387.947) (-4391.223) (-4388.286) * [-4392.286] (-4391.696) (-4395.409) (-4388.367) -- 0:03:22
      346000 -- (-4385.698) (-4387.476) [-4383.697] (-4390.187) * (-4386.752) (-4399.949) [-4388.574] (-4391.076) -- 0:03:22
      346500 -- (-4386.263) (-4382.676) [-4386.421] (-4399.735) * (-4385.446) (-4393.582) (-4393.869) [-4387.890] -- 0:03:21
      347000 -- (-4386.307) (-4386.385) (-4390.095) [-4390.255] * (-4385.565) [-4393.353] (-4391.547) (-4394.846) -- 0:03:21
      347500 -- (-4396.216) [-4391.948] (-4393.475) (-4388.944) * (-4387.428) [-4387.821] (-4390.539) (-4389.829) -- 0:03:20
      348000 -- (-4390.973) (-4390.800) (-4384.300) [-4386.776] * (-4389.615) [-4392.347] (-4386.468) (-4394.366) -- 0:03:22
      348500 -- (-4387.843) [-4397.829] (-4388.545) (-4395.117) * [-4388.289] (-4398.184) (-4394.928) (-4386.152) -- 0:03:21
      349000 -- (-4389.982) [-4385.519] (-4390.835) (-4392.177) * (-4383.176) (-4391.042) (-4385.893) [-4386.547] -- 0:03:21
      349500 -- (-4394.460) (-4392.452) (-4398.840) [-4388.723] * [-4384.941] (-4385.122) (-4386.802) (-4386.870) -- 0:03:21
      350000 -- (-4391.553) (-4391.442) [-4382.207] (-4394.430) * (-4386.634) [-4385.272] (-4387.700) (-4396.847) -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-4392.838) [-4392.210] (-4390.713) (-4394.799) * (-4395.192) [-4385.959] (-4388.841) (-4398.006) -- 0:03:20
      351000 -- (-4389.400) (-4385.512) [-4384.839] (-4389.792) * [-4391.296] (-4390.806) (-4392.402) (-4386.058) -- 0:03:21
      351500 -- (-4387.821) (-4389.320) (-4386.531) [-4386.656] * (-4384.847) (-4390.430) (-4389.045) [-4389.365] -- 0:03:21
      352000 -- (-4392.598) [-4397.385] (-4386.498) (-4396.600) * (-4386.275) [-4387.586] (-4392.055) (-4396.367) -- 0:03:20
      352500 -- (-4395.190) (-4393.431) [-4390.275] (-4390.601) * (-4385.739) [-4391.787] (-4391.442) (-4394.184) -- 0:03:20
      353000 -- (-4388.312) [-4390.192] (-4390.028) (-4388.761) * (-4387.543) (-4391.589) [-4389.910] (-4390.226) -- 0:03:19
      353500 -- (-4389.208) (-4389.652) (-4400.319) [-4389.961] * [-4386.692] (-4387.650) (-4393.426) (-4397.036) -- 0:03:19
      354000 -- (-4391.021) (-4386.946) [-4390.866] (-4395.213) * (-4384.185) (-4391.359) [-4396.743] (-4404.037) -- 0:03:18
      354500 -- (-4393.152) (-4386.218) (-4390.632) [-4390.882] * [-4393.325] (-4392.853) (-4388.307) (-4402.136) -- 0:03:20
      355000 -- (-4391.093) [-4390.853] (-4391.003) (-4387.221) * (-4393.045) (-4388.857) [-4390.974] (-4397.093) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

      355500 -- [-4384.491] (-4390.599) (-4401.519) (-4389.394) * (-4388.761) (-4391.394) (-4387.393) [-4389.185] -- 0:03:19
      356000 -- (-4385.783) [-4387.677] (-4395.164) (-4388.336) * (-4393.613) (-4387.887) [-4386.914] (-4388.880) -- 0:03:18
      356500 -- (-4382.947) [-4383.730] (-4389.913) (-4397.753) * [-4388.841] (-4397.389) (-4394.024) (-4391.795) -- 0:03:18
      357000 -- (-4389.295) (-4387.337) (-4395.830) [-4385.387] * [-4385.458] (-4386.574) (-4391.530) (-4389.134) -- 0:03:18
      357500 -- (-4387.891) (-4393.174) (-4387.835) [-4383.780] * [-4388.217] (-4387.986) (-4397.873) (-4397.769) -- 0:03:19
      358000 -- (-4383.138) [-4387.048] (-4387.614) (-4390.674) * [-4385.447] (-4392.529) (-4392.302) (-4384.803) -- 0:03:19
      358500 -- (-4383.453) [-4388.009] (-4393.122) (-4395.344) * [-4388.831] (-4386.697) (-4393.910) (-4386.186) -- 0:03:18
      359000 -- [-4390.601] (-4384.179) (-4393.447) (-4390.428) * (-4390.515) [-4387.234] (-4388.863) (-4392.576) -- 0:03:18
      359500 -- [-4389.986] (-4391.819) (-4387.614) (-4382.604) * [-4385.620] (-4386.062) (-4388.732) (-4388.992) -- 0:03:17
      360000 -- (-4393.651) (-4384.564) (-4388.671) [-4386.619] * [-4389.052] (-4394.990) (-4385.060) (-4386.641) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-4396.914) (-4388.678) [-4390.213] (-4384.344) * (-4387.568) (-4391.146) (-4387.761) [-4398.933] -- 0:03:16
      361000 -- (-4393.175) (-4389.615) (-4396.275) [-4388.336] * (-4387.478) (-4395.141) [-4391.645] (-4398.591) -- 0:03:18
      361500 -- [-4389.411] (-4386.841) (-4392.260) (-4387.475) * (-4394.658) (-4399.188) [-4384.732] (-4386.026) -- 0:03:17
      362000 -- [-4387.674] (-4389.781) (-4389.861) (-4391.192) * (-4393.235) (-4389.977) [-4386.262] (-4385.031) -- 0:03:17
      362500 -- (-4390.278) [-4387.947] (-4385.710) (-4396.751) * (-4386.654) (-4386.621) [-4388.268] (-4387.022) -- 0:03:16
      363000 -- (-4392.965) [-4389.626] (-4393.071) (-4383.939) * [-4388.137] (-4389.887) (-4394.207) (-4388.392) -- 0:03:16
      363500 -- (-4390.178) [-4389.406] (-4391.939) (-4386.065) * (-4395.674) (-4387.881) [-4388.232] (-4387.924) -- 0:03:16
      364000 -- (-4388.696) [-4384.585] (-4394.374) (-4390.745) * (-4385.706) (-4386.485) [-4390.224] (-4392.038) -- 0:03:15
      364500 -- (-4392.792) [-4390.920] (-4384.967) (-4389.398) * [-4384.197] (-4388.289) (-4388.983) (-4389.940) -- 0:03:17
      365000 -- [-4395.301] (-4387.921) (-4387.372) (-4391.129) * (-4392.282) (-4386.563) [-4394.921] (-4386.137) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-4386.653) [-4384.862] (-4392.385) (-4388.629) * (-4387.678) (-4389.965) (-4391.612) [-4386.315] -- 0:03:16
      366000 -- (-4392.064) [-4388.408] (-4387.097) (-4392.225) * (-4385.602) (-4392.224) (-4387.998) [-4392.571] -- 0:03:15
      366500 -- (-4400.771) (-4398.672) [-4385.951] (-4389.151) * (-4385.593) [-4388.532] (-4389.162) (-4387.017) -- 0:03:15
      367000 -- (-4390.262) (-4387.241) [-4388.849] (-4383.029) * [-4388.986] (-4392.139) (-4386.885) (-4398.327) -- 0:03:14
      367500 -- (-4392.397) [-4388.449] (-4389.108) (-4387.617) * (-4387.378) (-4388.523) [-4390.197] (-4399.409) -- 0:03:16
      368000 -- (-4395.265) (-4392.653) [-4385.370] (-4391.908) * (-4389.783) (-4388.254) (-4392.205) [-4387.325] -- 0:03:15
      368500 -- [-4392.262] (-4392.271) (-4390.623) (-4384.005) * (-4386.811) (-4398.167) [-4386.779] (-4395.482) -- 0:03:15
      369000 -- [-4387.738] (-4386.374) (-4389.495) (-4389.055) * (-4392.421) [-4382.286] (-4387.058) (-4386.318) -- 0:03:14
      369500 -- (-4388.205) (-4402.759) (-4393.060) [-4391.123] * (-4392.077) (-4387.833) [-4388.340] (-4388.351) -- 0:03:14
      370000 -- (-4389.788) (-4387.356) [-4392.589] (-4391.719) * (-4388.593) (-4385.832) [-4387.056] (-4393.002) -- 0:03:14

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-4388.482) [-4392.694] (-4386.417) (-4386.733) * (-4397.456) [-4386.971] (-4392.947) (-4395.209) -- 0:03:13
      371000 -- (-4390.673) (-4383.865) (-4388.161) [-4385.460] * (-4385.327) (-4391.457) (-4386.608) [-4389.552] -- 0:03:14
      371500 -- (-4388.471) (-4390.206) (-4393.748) [-4386.132] * (-4386.171) (-4385.493) (-4390.388) [-4387.797] -- 0:03:14
      372000 -- (-4386.753) (-4387.859) (-4391.002) [-4386.567] * (-4387.185) (-4392.003) [-4390.430] (-4389.937) -- 0:03:14
      372500 -- (-4386.698) [-4386.234] (-4394.472) (-4395.675) * (-4398.888) (-4396.545) (-4390.257) [-4392.755] -- 0:03:13
      373000 -- (-4385.594) (-4395.677) (-4388.875) [-4391.921] * (-4384.263) [-4389.523] (-4388.862) (-4385.100) -- 0:03:13
      373500 -- (-4388.648) (-4391.107) (-4389.223) [-4386.212] * (-4387.746) (-4385.133) (-4386.063) [-4387.959] -- 0:03:12
      374000 -- (-4390.110) (-4397.920) [-4390.781] (-4397.533) * (-4391.519) (-4384.389) (-4388.925) [-4388.263] -- 0:03:14
      374500 -- (-4390.022) (-4399.412) (-4385.860) [-4390.698] * (-4394.327) [-4384.413] (-4388.834) (-4396.549) -- 0:03:13
      375000 -- (-4400.964) [-4389.670] (-4386.418) (-4397.259) * (-4390.146) (-4387.308) [-4386.244] (-4387.674) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-4394.193) (-4386.799) [-4391.853] (-4394.683) * (-4387.147) (-4390.432) (-4385.364) [-4386.038] -- 0:03:12
      376000 -- [-4390.885] (-4391.596) (-4388.448) (-4393.445) * (-4389.476) (-4395.643) (-4390.198) [-4388.936] -- 0:03:12
      376500 -- [-4388.315] (-4392.761) (-4397.336) (-4388.786) * (-4386.513) (-4386.915) [-4390.574] (-4384.659) -- 0:03:12
      377000 -- [-4389.019] (-4389.388) (-4393.696) (-4391.871) * (-4391.573) [-4394.934] (-4395.897) (-4385.226) -- 0:03:11
      377500 -- (-4390.343) (-4391.193) (-4391.990) [-4384.873] * (-4387.276) (-4390.153) [-4402.658] (-4391.108) -- 0:03:12
      378000 -- [-4391.875] (-4390.794) (-4392.602) (-4384.673) * [-4393.423] (-4386.208) (-4399.442) (-4390.388) -- 0:03:12
      378500 -- (-4388.777) [-4390.834] (-4385.188) (-4389.279) * [-4386.046] (-4388.051) (-4388.817) (-4393.321) -- 0:03:12
      379000 -- (-4390.608) [-4387.547] (-4393.713) (-4391.367) * (-4389.981) [-4388.183] (-4388.283) (-4399.199) -- 0:03:11
      379500 -- [-4385.208] (-4403.987) (-4385.314) (-4398.451) * (-4387.647) (-4386.955) [-4387.464] (-4394.996) -- 0:03:11
      380000 -- [-4389.366] (-4400.504) (-4389.711) (-4393.584) * (-4388.133) (-4393.153) (-4392.987) [-4