--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Dec 09 11:19:16 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/444/ZnT41F-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3132.56 -3140.32 2 -3132.61 -3140.99 -------------------------------------- TOTAL -3132.59 -3140.71 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.226993 0.000760 0.174485 0.279613 0.224553 1335.43 1379.02 1.000 r(A<->C){all} 0.102828 0.000674 0.052481 0.153821 0.101216 614.36 936.38 1.000 r(A<->G){all} 0.273240 0.001522 0.198514 0.349207 0.271394 855.50 919.68 1.000 r(A<->T){all} 0.082734 0.000522 0.038931 0.127129 0.081285 981.23 1122.39 1.000 r(C<->G){all} 0.093085 0.000591 0.047879 0.139639 0.091713 1098.29 1132.18 1.000 r(C<->T){all} 0.399734 0.002109 0.309832 0.485405 0.398638 952.07 1004.63 1.000 r(G<->T){all} 0.048378 0.000349 0.010706 0.082731 0.046395 925.22 1112.13 1.000 pi(A){all} 0.277884 0.000124 0.255425 0.298482 0.277774 1337.03 1340.76 1.000 pi(C){all} 0.217673 0.000101 0.199538 0.238744 0.217172 1297.30 1391.11 1.001 pi(G){all} 0.245223 0.000112 0.223751 0.264964 0.245344 1321.15 1380.15 1.000 pi(T){all} 0.259220 0.000115 0.239311 0.281544 0.259150 1299.39 1323.36 1.000 alpha{1,2} 0.075513 0.003643 0.000132 0.187478 0.062933 1298.44 1302.01 1.000 alpha{3} 1.657819 0.509513 0.511637 3.057750 1.520630 1313.43 1407.21 1.000 pinvar{all} 0.231934 0.012513 0.006409 0.420747 0.234877 1349.61 1425.30 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2992.587114 Model 2: PositiveSelection -2992.587114 Model 0: one-ratio -3001.824688 Model 3: discrete -2992.546371 Model 7: beta -2992.568081 Model 8: beta&w>1 -2992.571184 Model 0 vs 1 18.475148000000445 Model 2 vs 1 0.0 Model 8 vs 7 0.00620600000002014
>C1 MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHSHSHSHSHGNGHEPNDSLSQTRSNSNFL TTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAHED KNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSIIV IMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQQT SQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTEoo >C2 MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN FLTAIGSQSADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAHEEK NLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSIIVI MTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQQTS QQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTEooo >C3 MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE >C4 MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV MMFVLHGSWFVSRNGHGHSHSHNHENEHEPNNSPSQTRSNSYIYTASGGQ NPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAHEEKNLNLR AAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSIIVIMTTLR LFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQQTSQQRVL MVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTEoooooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=508 C1 MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD C2 MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD C3 MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD C4 MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD *.******* **.************ ******. *:*:*****:*** * C1 YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS C2 YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS C3 YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS C4 NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS ********** *:**:**************************.****** C1 ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG C2 ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG C3 ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG C4 EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG *:******:***********. *** *********** ***:******** C1 GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV C2 GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV C3 GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV C4 GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV *********************************.* ************** C1 IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV C2 IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV C3 IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV C4 IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV *********************::**:*******************.**** C1 MMFVLHGSWFVNGNGHGHSHSH--SHSHSHSHGNGHEPNDSLSQTRSNSN C2 MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN C3 MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN C4 MMFVLHGSWFVSRNGHG--------HSHSHNHENEHEPNNSPSQTRSNSY ***********. **** ****:.* * ****:* ******* C1 FLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAH C2 FLTAIGSQ---SADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAH C3 FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH C4 IYTASGGQNPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAH : *: *.* ..**..*:*** * .****:****** :*:*.::*** C1 EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSI C2 EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI C3 EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI C4 EEKNLNLRAAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSI *:*************************:***** **************** C1 IVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQ C2 IVIMTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ C3 IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ C4 IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQ *************:***:******************::****:******* C1 QTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE C2 QTSQQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTE C3 QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE C4 QTSQQRVLMVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTE ************* ***** :****:** **:.*:**:**:***:***** C1 oo------ C2 ooo----- C3 -------- C4 oooooooo PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 500 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 500 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6380] Library Relaxation: Multi_proc [72] Relaxation Summary: [6380]--->[6265] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.273 Mb, Max= 30.635 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSH--SHSHSHSHGNGHEPNDSLSQTRSNSN FLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAH EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQ QTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE oo------ >C2 MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN FLTAIGSQ---SADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTE ooo----- >C3 MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE -------- >C4 MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV MMFVLHGSWFVSRNGHG--------HSHSHNHENEHEPNNSPSQTRSNSY IYTASGGQNPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQ QTSQQRVLMVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTE oooooooo FORMAT of file /tmp/tmp4060295525595177772aln Not Supported[FATAL:T-COFFEE] >C1 MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSH--SHSHSHSHGNGHEPNDSLSQTRSNSN FLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAH EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQ QTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE oo------ >C2 MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN FLTAIGSQ---SADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTE ooo----- >C3 MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE -------- >C4 MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV MMFVLHGSWFVSRNGHG--------HSHSHNHENEHEPNNSPSQTRSNSY IYTASGGQNPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQ QTSQQRVLMVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTE oooooooo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:508 S:98 BS:508 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 93.96 C1 C2 93.96 TOP 1 0 93.96 C2 C1 93.96 BOT 0 2 93.98 C1 C3 93.98 TOP 2 0 93.98 C3 C1 93.98 BOT 0 3 85.43 C1 C4 85.43 TOP 3 0 85.43 C4 C1 85.43 BOT 1 2 97.99 C2 C3 97.99 TOP 2 1 97.99 C3 C2 97.99 BOT 1 3 87.80 C2 C4 87.80 TOP 3 1 87.80 C4 C2 87.80 BOT 2 3 86.79 C3 C4 86.79 TOP 3 2 86.79 C4 C3 86.79 AVG 0 C1 * 91.12 AVG 1 C2 * 93.25 AVG 2 C3 * 92.92 AVG 3 C4 * 86.67 TOT TOT * 90.99 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCCAAAATATCAGAAGCTTGACAACACACTGTTGCCCAACGCTCACGA C2 ATGCCAAAATATCAGAAGCTTGACAACACACTGCTGTCCAACGCTCACGA C3 ATGCCAAAATATCAGAAGCTTGACAACATACTGTTGCCCAACGCTCACGA C4 ATGTCAAAATATCAGAAGCTTGACAATGCACTGCTATCCAACGCTCACGA *** ********************** . **** *. ************* C1 TGACGACTCTGAAGGGGGTTTCCCGGGTTACTTTGATGATAATCATCAAA C2 TGACGACTCTGAAGGGGGTTTCCCGGCTTACTTTGATGATAACCATCAAA C3 TGACGACTCTGAAGGGGGTTTCCCGGCTTACTTTGATGATAACCATCAAA C4 TGACGACTCTGAAGGGGGTTTCCCGGTTTGCTTTGATGATAATCATCAAA ************************** **.************ ******* C1 GTTTGGGAATCCAACAGGATCCAGATACTAGAGATGATCGACTGTCAGAT C2 ATCTGGGTCTCCAACAGGATCCAGATACTAGAGACGATCGATTACCAGAC C3 ATCTGGGTCTCCAACAGGATCCAGATACTAGAGAAGATCGATTACCAGAT C4 ATACGGGCTTCCAACGGGATCCAGATACTAGAGATGATCGACTGCTAGAT .* *** ******.****************** ****** *. *** C1 TACCAAGATAGGTATTACAGCGTTAACAACAATAGTGTTAATAGGGAGGT C2 TACCAAGATAGGTATTACAGCGTTAACAACAATGGTGTTGATAGGGAAAT C3 TACCAAGATAGGTATTACAGCGTTAACAACAATGGTGTTGATAGGGAAAT C4 AATCAAGACAGGTATTACAGCGTTAACAACAACGAAGTGGATAGGGAGGT :* ***** *********************** ..:** .*******..* C1 GGTGACAATTGGGTCAAATGTCGTCCGGGTTCCAGAGGAGCAAACCTGGG C2 GGTGACAATTGGATCAAATGTCGTCCGCGTTCCAGAGGAGCAAACCTGGG C3 GGTGACAATTGGATCAAATGTCGTCCGCGTTCCAGAGGAGCAAACCTGGG C4 GGTGACAATTGGGTCAAATGTCGTCCGAGTTCCAGAGGAGCAAACCTGGG ************.************** ********************** C1 AAGTGCCACTGTTGGGCGATTGTGGTGACAGTGCGAGAAACCAGAGCTCG C2 AAGTGCCACTGTTGGGCGATTGTGGGGACAGTGCGAGAAACCAGAGCTCG C3 AAGTGCCACTGTTGGGCGATTGTGGGGACAGTGCGAGAAACCAGAGCTCG C4 AGGTGCCACTGTTGGGCGACTGTGGTGACAATGCGAGGAATCAGAGTTCG *.***************** ***** ****.******.** ***** *** C1 GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT C2 GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT C3 GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT C4 GAAGCGGAATTTGATATGCAGCGTGATTGCTGCAATCATCAACCAGGGTT ***.********************** *********************** C1 CAGAGCCAACTCGAAGAGCAAATCTGCACAGGAGGCCAAGTATAAAATTA C2 CAGGGCCAACCCGAAGAGCAAATCTGCCCAGGAGGCCAAGTATAAAATTA C3 CAGGGCCAACCCGAAGAGCAAATCTGACCAGGAGGCCAAGTATAAAATTA C4 CAGGGCCAACCCAATGAGCAAATCTGCACAGGAGGCCAAATATAAAATTA ***.****** *.*:***********..***********.********** C1 TGCTCGCAGTTGCTCTGTGTTGCGTATTTATGATCATTGAATTTCTTGGC C2 TGCTCGCAGTTGCCCTGTGTTGCGTTTTTATGATCATCGAATTTCTTGGC C3 TGCTCGCAGTTGCCCTGTGTTGCGTTTTTATGATCATCGAATTTCTTGGC C4 TGCTAGCAGTTTTCCTGTGTTGCATATTTATGATCATTGAATTTCTTGGC ****.****** *********.*:*********** ************ C1 GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC C2 GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC C3 GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC C4 GGCTATGTGGCCGGAAGTCTAGCTATAATGACGGATGCCGCCCATTTAGC ******** ***********.** ************************** C1 ATCTGATTGCATTAGTTTCGTCATCGGTCTAGTCGCCATATGGATAGGGG C2 ATCTGATTGCATTAGTTTTGTCATCGGTCTAGTCGCCATATGGATAGGGG C3 ATCTGATTGCATTAGTTTCGTCATCGGTCTAGTCGCCATATGGATAGGGG C4 ATCTGATTGCATTAGTTTCGTCATCGGTTTAGTCGCTATATGGATAGGGA ****************** ********* ******* ************. C1 GTCGCCCGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT C2 GTCGCCAGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT C3 GTCGCCAGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT C4 GTCGCCCGCCCGACGAACGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ******.***.*****.********************************* C1 ATCGGAGCTCTGGCTTCTATTTTGGGAATCTGGTTCGTAACTACCCTGCT C2 ATCGGAGCTCTGGCTTCTATCCTGGGGATCTGGTTCGTAACTACCCTGCT C3 ATCGGAGCTCTGGCTTCTATCCTGGGGATCTGGTTCGTAACTACCCTGCT C4 ATCGGAGCTCTGGCCTCTATCTTGGGAATTTGGTTTGTAACTACCCTGCT ************** ***** ****.** ***** ************** C1 CGTGGTTGTGGCTATTGAGAGGATCTTCTCCCAAGACTTTGAATTAAACG C2 CGTGGTTGTGGCTATTCAGAGGATCTACTCCCAGGACTTTGAACTAAACG C3 CGTGGTTGTGGCTATTCAGAGGATCTACTCCCAGGACTTTGAACTAAACG C4 CGTGGTTGTGGCTGTTCAAAGGATCTACTCTCAGGACTTTGAACTAAACG *************.** *.*******:*** **.********* ****** C1 CCGATATGATGATGCTGATTTCAGGCATTGGCATAGTCATAAATATCGTA C2 CCGATATGATGATGCTCATTTCAGGCATTGGCATAGTCATAAATATAGTA C3 CCGATATGATGATGCTCATTTCAGGCATTGGCATAGTCATAAATATCGTA C4 CCGATATGATGATGCTTATTTCAGGCATTGGCATTTTCATAAATATTGTA **************** *****************: ********** *** C1 ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG C2 ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG C3 ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG C4 ATGATGTTTGTTTTGCATGGATCCTGGTTCGTCAGTCGGAATGGACATGG ******************************** *. *******:***** C1 CCACAGTCACAGCCAT------AGTCATAGTCACAGCCACAGTCACGGAA C2 CCACAGTCACAGCCATGGTCATAGTCACAGCCATAGTCATAGTCACGGAA C3 CCACAGTCACAGCCATGGTCATAGTCACAGCCACAGTTATAGTCACGGAA C4 C------------------------CACAGTCACAGCCATAATCACGAAA * ** ** ** ** * *.*****.** C1 ACGGACATGAGCCAAACGATAGTCTTTCACAAACACGTTCCAATTCGAAC C2 ACGGACATGAGCCAAATAATAGTCCTTCACAAACACGTTCCAATTCCAAC C3 ACGGACATGAGCCAAATAATAGTCCTTCACAAACACGTTCCAATTCCAAC C4 ACGAACATGAGCCAAATAATAGTCCTTCACAAACGCGTTCCAACTCCTAC ***.************ .****** *********.******** ** :** C1 TTTCTTACGACCATTGGAAGTCAAAGCGCTTCAACGGCAGATGAGGAGGA C2 TTTCTTACGGCGATTGGAAGTCAA---------AGCGCAGATGAGGAGGA C3 TTTCTTACGGCGATTGGAAGTCAAAGCGCTTCAACGGCAGATGAGGAGGA C4 ATTTATACGGCGAGTGGTGGTCAAAATCCTTCAAAGGTGGATGAAAGGCA :** :****.* * ***:.***** * * .*****...* * C1 TTCAATAAGGAAAGAAATTAATTCAAACGAGCATAAGATTGTTATTACAA C2 TTCACTAAGGAAAGAAATTAATTCGAACGAGCATAAGATTGTTATTACAA C3 TTCACTAAGGAAAGAAATTAATTCAAACGAGCATAAGATTGTTATTACAA C4 TTCAGTAAGGAAAGAAAGAAATTTAACCGAACATAAGATTCTTATTACAA **** ************ :**** .*.***.********* ********* C1 ATGGGAAAAAACCAACTCTGACTGGGACTTCAAACATGGAGCTGGCACAC C2 ATGGGAAAAAACAAATTCTGACTGGGTCTTCAGACATGCAGCTGGCTCAC C3 ATGGGAAAAAACAAATTCTGACTGGGACTTCAAACATGCAGCTGGCTCAC C4 ATGGAAAAAAAACAAATCAGGCTGGAACTTCAAAAATCCAGTTGGCACAC ****.******..** **:*.****.:*****.*.** ** ****:*** C1 GAGGATAAAAACCTGAACCTGCGTGCTGCTATGATTCATGTGATTGGAGA C2 GAGGAGAAAAACCTCAACCTGCGTGCTGCGATGATTCATGTGATTGGAGA C3 GAGGAGAAAAACCTCAACCTGCGTGCTGCGATGATTCATGTGATTGGAGA C4 GAGGAGAAAAACCTGAACTTGCGTGCTGCGATGATTCATGTAATTGGGGA ***** ******** *** ********** ***********.*****.** C1 CCTAGTGCAGAGCATTGGCGTTTTTTTGGCCGCCGTCCTAATTAAAGTTT C2 CCTAGTGCAGAGCATTGGCGTTTTCTTGGCTGCCGTCCTAATAAAAGTTT C3 CCTAGTGCAGAGCATTGGCGTTTTCTTGGCTGCCGTCCTAATAAAAGTTT C4 CCTAGTGCAGAGCATTGGCGTTTTTTTGGCCTCCGTCCTAATTAAAGTTT ************************ ***** **********:******* C1 GTCCAGGTGCCAAGTATGCTGATCCCCTGTGTACTCTCATATTCTCAATT C2 ATCCAGGTGCCAAGTATGCTGATCCGCTGTGTACTCTCATATTCTCAATT C3 ATCCAGGTGCCAAGTATGCTGACCCCCTGTGTACTCTCATATTCTCAATT C4 GTCCAGGTGCCAAATATGCTGATCCCCTGTGTACTCTAATATTTTCAATT .************.******** ** ***********.***** ****** C1 ATTGTAATAATGACTACCTTGCGTCTGTTTCGGGAGTCTTTGGGCATCAT C2 ATTGTAATAATGACTACCTTGCGTCTGTTCCGGGAGTCTATGGGCATCAT C3 ATTGTAATAATGACTACCTTGCGTCTGTTCCGGGAGTCTATGGGCATCAT C4 ATTGTAATTATGACTACTCTGCGTCTGTTTCGGGAGTCTATGGGAATCAT ********:******** ********** *********:****.***** C1 CGTGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC C2 CATGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC C3 CGTGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC C4 CGTGAATGCAGTTCCACAGAACCTTAATATGCGCACTCTGCATTTGGAGC *.****************.*********************** ******* C1 TGGGCAGCATCGAAGGTGTCAGATCTTTGCACCACCTAAACGTGTGGCAA C2 TGGGCAGCATCGAAGGTGTCAGATCTGTGCACCACCTAAACGTGTGGCAG C3 TGGGCAGCATCGAAGGTGTCAGATCTGTGCACCACCTAAACGTGTGGCAG C4 TGGGCAGCCTCCAAGGTGTCAGATCTGTCCACCACCTAAACGTGTGGCAA ********.** ************** * ********************. C1 CAGACCTCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG C2 CAAACCTCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG C3 CAAACATCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG C4 CAAACCTCTCAGCAAAGGGTGCTGATGGTACATCTCGTTATAGACTCTCG **.**.***********************.********** ****** ** C1 AGCGGACGGCAATGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCAGCC C2 AGCTGACAGCAACGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCGGCC C3 AGCTGACAGCCATGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCGGTC C4 AGCTGACTGCAATGAGGTACTGCAGACTGCCACGGAGCTAGTCGCTGGCC *** *** **.* ************.*********.***.**. * .* * C1 CAAGATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACAGAG C2 CAAAATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACGGAG C3 CAAAATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACGGAG C4 CAAAATATAACGTAAAGCATGCAACTATTCAAATAGAACCAACAACTGAG ***.*******.*.****** **** ******:*.*****:***** *** C1 ------------------------ C2 ------------------------ C3 ------------------------ C4 ------------------------ >C1 ATGCCAAAATATCAGAAGCTTGACAACACACTGTTGCCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGGTTACTTTGATGATAATCATCAAA GTTTGGGAATCCAACAGGATCCAGATACTAGAGATGATCGACTGTCAGAT TACCAAGATAGGTATTACAGCGTTAACAACAATAGTGTTAATAGGGAGGT GGTGACAATTGGGTCAAATGTCGTCCGGGTTCCAGAGGAGCAAACCTGGG AAGTGCCACTGTTGGGCGATTGTGGTGACAGTGCGAGAAACCAGAGCTCG GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT CAGAGCCAACTCGAAGAGCAAATCTGCACAGGAGGCCAAGTATAAAATTA TGCTCGCAGTTGCTCTGTGTTGCGTATTTATGATCATTGAATTTCTTGGC GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTCGTCATCGGTCTAGTCGCCATATGGATAGGGG GTCGCCCGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCTTCTATTTTGGGAATCTGGTTCGTAACTACCCTGCT CGTGGTTGTGGCTATTGAGAGGATCTTCTCCCAAGACTTTGAATTAAACG CCGATATGATGATGCTGATTTCAGGCATTGGCATAGTCATAAATATCGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG CCACAGTCACAGCCAT------AGTCATAGTCACAGCCACAGTCACGGAA ACGGACATGAGCCAAACGATAGTCTTTCACAAACACGTTCCAATTCGAAC TTTCTTACGACCATTGGAAGTCAAAGCGCTTCAACGGCAGATGAGGAGGA TTCAATAAGGAAAGAAATTAATTCAAACGAGCATAAGATTGTTATTACAA ATGGGAAAAAACCAACTCTGACTGGGACTTCAAACATGGAGCTGGCACAC GAGGATAAAAACCTGAACCTGCGTGCTGCTATGATTCATGTGATTGGAGA CCTAGTGCAGAGCATTGGCGTTTTTTTGGCCGCCGTCCTAATTAAAGTTT GTCCAGGTGCCAAGTATGCTGATCCCCTGTGTACTCTCATATTCTCAATT ATTGTAATAATGACTACCTTGCGTCTGTTTCGGGAGTCTTTGGGCATCAT CGTGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC TGGGCAGCATCGAAGGTGTCAGATCTTTGCACCACCTAAACGTGTGGCAA CAGACCTCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG AGCGGACGGCAATGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCAGCC CAAGATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACAGAG ------------------------ >C2 ATGCCAAAATATCAGAAGCTTGACAACACACTGCTGTCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGCTTACTTTGATGATAACCATCAAA ATCTGGGTCTCCAACAGGATCCAGATACTAGAGACGATCGATTACCAGAC TACCAAGATAGGTATTACAGCGTTAACAACAATGGTGTTGATAGGGAAAT GGTGACAATTGGATCAAATGTCGTCCGCGTTCCAGAGGAGCAAACCTGGG AAGTGCCACTGTTGGGCGATTGTGGGGACAGTGCGAGAAACCAGAGCTCG GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT CAGGGCCAACCCGAAGAGCAAATCTGCCCAGGAGGCCAAGTATAAAATTA TGCTCGCAGTTGCCCTGTGTTGCGTTTTTATGATCATCGAATTTCTTGGC GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTTGTCATCGGTCTAGTCGCCATATGGATAGGGG GTCGCCAGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCTTCTATCCTGGGGATCTGGTTCGTAACTACCCTGCT CGTGGTTGTGGCTATTCAGAGGATCTACTCCCAGGACTTTGAACTAAACG CCGATATGATGATGCTCATTTCAGGCATTGGCATAGTCATAAATATAGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG CCACAGTCACAGCCATGGTCATAGTCACAGCCATAGTCATAGTCACGGAA ACGGACATGAGCCAAATAATAGTCCTTCACAAACACGTTCCAATTCCAAC TTTCTTACGGCGATTGGAAGTCAA---------AGCGCAGATGAGGAGGA TTCACTAAGGAAAGAAATTAATTCGAACGAGCATAAGATTGTTATTACAA ATGGGAAAAAACAAATTCTGACTGGGTCTTCAGACATGCAGCTGGCTCAC GAGGAGAAAAACCTCAACCTGCGTGCTGCGATGATTCATGTGATTGGAGA CCTAGTGCAGAGCATTGGCGTTTTCTTGGCTGCCGTCCTAATAAAAGTTT ATCCAGGTGCCAAGTATGCTGATCCGCTGTGTACTCTCATATTCTCAATT ATTGTAATAATGACTACCTTGCGTCTGTTCCGGGAGTCTATGGGCATCAT CATGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC TGGGCAGCATCGAAGGTGTCAGATCTGTGCACCACCTAAACGTGTGGCAG CAAACCTCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG AGCTGACAGCAACGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCGGCC CAAAATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACGGAG ------------------------ >C3 ATGCCAAAATATCAGAAGCTTGACAACATACTGTTGCCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGCTTACTTTGATGATAACCATCAAA ATCTGGGTCTCCAACAGGATCCAGATACTAGAGAAGATCGATTACCAGAT TACCAAGATAGGTATTACAGCGTTAACAACAATGGTGTTGATAGGGAAAT GGTGACAATTGGATCAAATGTCGTCCGCGTTCCAGAGGAGCAAACCTGGG AAGTGCCACTGTTGGGCGATTGTGGGGACAGTGCGAGAAACCAGAGCTCG GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT CAGGGCCAACCCGAAGAGCAAATCTGACCAGGAGGCCAAGTATAAAATTA TGCTCGCAGTTGCCCTGTGTTGCGTTTTTATGATCATCGAATTTCTTGGC GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTCGTCATCGGTCTAGTCGCCATATGGATAGGGG GTCGCCAGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCTTCTATCCTGGGGATCTGGTTCGTAACTACCCTGCT CGTGGTTGTGGCTATTCAGAGGATCTACTCCCAGGACTTTGAACTAAACG CCGATATGATGATGCTCATTTCAGGCATTGGCATAGTCATAAATATCGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG CCACAGTCACAGCCATGGTCATAGTCACAGCCACAGTTATAGTCACGGAA ACGGACATGAGCCAAATAATAGTCCTTCACAAACACGTTCCAATTCCAAC TTTCTTACGGCGATTGGAAGTCAAAGCGCTTCAACGGCAGATGAGGAGGA TTCACTAAGGAAAGAAATTAATTCAAACGAGCATAAGATTGTTATTACAA ATGGGAAAAAACAAATTCTGACTGGGACTTCAAACATGCAGCTGGCTCAC GAGGAGAAAAACCTCAACCTGCGTGCTGCGATGATTCATGTGATTGGAGA CCTAGTGCAGAGCATTGGCGTTTTCTTGGCTGCCGTCCTAATAAAAGTTT ATCCAGGTGCCAAGTATGCTGACCCCCTGTGTACTCTCATATTCTCAATT ATTGTAATAATGACTACCTTGCGTCTGTTCCGGGAGTCTATGGGCATCAT CGTGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC TGGGCAGCATCGAAGGTGTCAGATCTGTGCACCACCTAAACGTGTGGCAG CAAACATCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG AGCTGACAGCCATGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCGGTC CAAAATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACGGAG ------------------------ >C4 ATGTCAAAATATCAGAAGCTTGACAATGCACTGCTATCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGTTTGCTTTGATGATAATCATCAAA ATACGGGCTTCCAACGGGATCCAGATACTAGAGATGATCGACTGCTAGAT AATCAAGACAGGTATTACAGCGTTAACAACAACGAAGTGGATAGGGAGGT GGTGACAATTGGGTCAAATGTCGTCCGAGTTCCAGAGGAGCAAACCTGGG AGGTGCCACTGTTGGGCGACTGTGGTGACAATGCGAGGAATCAGAGTTCG GAAGCGGAATTTGATATGCAGCGTGATTGCTGCAATCATCAACCAGGGTT CAGGGCCAACCCAATGAGCAAATCTGCACAGGAGGCCAAATATAAAATTA TGCTAGCAGTTTTCCTGTGTTGCATATTTATGATCATTGAATTTCTTGGC GGCTATGTGGCCGGAAGTCTAGCTATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTCGTCATCGGTTTAGTCGCTATATGGATAGGGA GTCGCCCGCCCGACGAACGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCCTCTATCTTGGGAATTTGGTTTGTAACTACCCTGCT CGTGGTTGTGGCTGTTCAAAGGATCTACTCTCAGGACTTTGAACTAAACG CCGATATGATGATGCTTATTTCAGGCATTGGCATTTTCATAAATATTGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTCAGTCGGAATGGACATGG C------------------------CACAGTCACAGCCATAATCACGAAA ACGAACATGAGCCAAATAATAGTCCTTCACAAACGCGTTCCAACTCCTAC ATTTATACGGCGAGTGGTGGTCAAAATCCTTCAAAGGTGGATGAAAGGCA TTCAGTAAGGAAAGAAAGAAATTTAACCGAACATAAGATTCTTATTACAA ATGGAAAAAAAACAAATCAGGCTGGAACTTCAAAAATCCAGTTGGCACAC GAGGAGAAAAACCTGAACTTGCGTGCTGCGATGATTCATGTAATTGGGGA CCTAGTGCAGAGCATTGGCGTTTTTTTGGCCTCCGTCCTAATTAAAGTTT GTCCAGGTGCCAAATATGCTGATCCCCTGTGTACTCTAATATTTTCAATT ATTGTAATTATGACTACTCTGCGTCTGTTTCGGGAGTCTATGGGAATCAT CGTGAATGCAGTTCCACAGAACCTTAATATGCGCACTCTGCATTTGGAGC TGGGCAGCCTCCAAGGTGTCAGATCTGTCCACCACCTAAACGTGTGGCAA CAAACCTCTCAGCAAAGGGTGCTGATGGTACATCTCGTTATAGACTCTCG AGCTGACTGCAATGAGGTACTGCAGACTGCCACGGAGCTAGTCGCTGGCC CAAAATATAACGTAAAGCATGCAACTATTCAAATAGAACCAACAACTGAG ------------------------ >C1 MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHooSHSHSHSHGNGHEPNDSLSQTRSNSN FLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAH EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQ QTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE >C2 MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN FLTAIGSQoooSADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTE >C3 MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE >C4 MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV MMFVLHGSWFVSRNGHGooooooooHSHSHNHENEHEPNNSPSQTRSNSY IYTASGGQNPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQ QTSQQRVLMVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTE MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1524 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481282110 Setting output file names to "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 445079060 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0391553231 Seed = 994615820 Swapseed = 1481282110 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 43 unique site patterns Division 2 has 30 unique site patterns Division 3 has 54 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3514.968070 -- -26.620141 Chain 2 -- -3589.684992 -- -26.620141 Chain 3 -- -3589.684992 -- -26.620141 Chain 4 -- -3580.472094 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3580.472094 -- -26.620141 Chain 2 -- -3580.472094 -- -26.620141 Chain 3 -- -3589.684992 -- -26.620141 Chain 4 -- -3589.684992 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3514.968] (-3589.685) (-3589.685) (-3580.472) * [-3580.472] (-3580.472) (-3589.685) (-3589.685) 500 -- (-3173.430) [-3174.254] (-3185.020) (-3178.940) * [-3174.643] (-3174.129) (-3180.687) (-3176.316) -- 0:33:19 1000 -- [-3158.441] (-3164.148) (-3161.984) (-3165.320) * (-3168.389) (-3169.147) (-3168.005) [-3153.015] -- 0:16:39 1500 -- [-3149.033] (-3153.444) (-3152.193) (-3151.423) * (-3163.437) (-3164.083) (-3159.533) [-3144.630] -- 0:11:05 2000 -- [-3139.752] (-3145.785) (-3149.196) (-3146.626) * (-3146.768) (-3143.129) (-3139.751) [-3138.301] -- 0:08:19 2500 -- (-3138.092) [-3146.699] (-3138.711) (-3137.271) * (-3138.749) [-3138.310] (-3141.513) (-3133.231) -- 0:06:39 3000 -- (-3134.629) [-3139.506] (-3148.003) (-3132.692) * (-3135.731) (-3131.445) [-3142.210] (-3133.674) -- 0:05:32 3500 -- (-3137.438) (-3142.139) (-3139.513) [-3134.771] * [-3132.427] (-3137.354) (-3142.978) (-3135.279) -- 0:04:44 4000 -- (-3139.917) [-3138.813] (-3135.217) (-3137.151) * (-3136.284) (-3133.103) [-3137.915] (-3135.012) -- 0:04:09 4500 -- (-3137.007) (-3141.128) [-3136.218] (-3134.181) * (-3139.100) [-3135.885] (-3138.563) (-3135.577) -- 0:03:41 5000 -- (-3134.891) (-3140.880) (-3134.022) [-3132.819] * (-3141.302) [-3133.336] (-3146.945) (-3136.932) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-3134.279) (-3134.761) [-3134.146] (-3131.384) * (-3136.683) (-3136.182) (-3146.516) [-3134.891] -- 0:06:01 6000 -- (-3131.899) (-3135.284) (-3135.850) [-3131.987] * (-3142.202) [-3135.271] (-3142.430) (-3137.078) -- 0:05:31 6500 -- (-3133.551) (-3130.984) (-3134.992) [-3132.797] * (-3144.938) (-3134.616) (-3137.068) [-3133.106] -- 0:05:05 7000 -- (-3137.170) [-3135.677] (-3135.440) (-3136.013) * (-3138.731) [-3138.015] (-3140.878) (-3137.029) -- 0:04:43 7500 -- [-3132.762] (-3133.416) (-3132.835) (-3134.145) * (-3139.149) (-3135.360) (-3142.374) [-3136.053] -- 0:04:24 8000 -- (-3139.478) [-3129.135] (-3133.980) (-3140.748) * (-3144.546) (-3142.269) [-3136.545] (-3134.292) -- 0:04:08 8500 -- (-3133.573) [-3136.151] (-3132.376) (-3145.709) * (-3142.431) [-3135.939] (-3131.738) (-3132.061) -- 0:03:53 9000 -- (-3135.227) (-3136.410) (-3138.601) [-3137.623] * (-3139.498) (-3140.135) (-3134.559) [-3132.271] -- 0:03:40 9500 -- (-3140.750) [-3137.096] (-3142.652) (-3135.446) * (-3137.930) [-3140.350] (-3138.898) (-3137.999) -- 0:03:28 10000 -- (-3131.698) [-3137.258] (-3135.132) (-3138.012) * [-3134.594] (-3136.856) (-3135.555) (-3129.814) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- [-3134.479] (-3130.442) (-3141.337) (-3133.336) * (-3138.534) (-3133.799) [-3135.644] (-3132.825) -- 0:03:08 11000 -- (-3132.971) [-3129.896] (-3134.636) (-3138.453) * (-3139.039) [-3138.905] (-3142.098) (-3133.678) -- 0:04:29 11500 -- [-3134.652] (-3136.962) (-3134.683) (-3135.892) * [-3142.939] (-3134.055) (-3134.828) (-3136.062) -- 0:04:17 12000 -- [-3135.197] (-3142.033) (-3133.271) (-3132.396) * (-3137.886) (-3133.746) [-3131.742] (-3134.419) -- 0:04:07 12500 -- (-3139.160) (-3134.182) (-3134.540) [-3134.343] * (-3135.698) (-3134.360) [-3132.456] (-3137.703) -- 0:03:57 13000 -- [-3136.592] (-3131.523) (-3133.573) (-3135.512) * (-3134.119) (-3137.168) (-3132.769) [-3132.952] -- 0:03:47 13500 -- [-3136.857] (-3146.549) (-3132.053) (-3141.663) * (-3135.492) (-3133.451) (-3135.782) [-3132.462] -- 0:03:39 14000 -- [-3140.858] (-3137.511) (-3135.257) (-3137.390) * (-3136.114) [-3139.366] (-3134.309) (-3135.815) -- 0:03:31 14500 -- (-3136.997) [-3134.380] (-3141.559) (-3141.519) * (-3135.062) (-3139.874) (-3145.196) [-3137.446] -- 0:03:23 15000 -- (-3134.028) [-3137.416] (-3133.453) (-3132.530) * [-3134.432] (-3138.522) (-3137.375) (-3135.126) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 15500 -- (-3134.460) (-3135.147) [-3129.521] (-3135.266) * (-3134.037) [-3138.301] (-3134.070) (-3130.974) -- 0:03:10 16000 -- [-3137.577] (-3134.189) (-3131.733) (-3138.433) * (-3131.577) (-3135.339) (-3136.279) [-3135.326] -- 0:03:04 16500 -- (-3135.543) [-3134.373] (-3137.970) (-3136.085) * (-3134.128) (-3136.254) [-3138.010] (-3139.314) -- 0:03:58 17000 -- (-3136.514) (-3136.032) (-3138.334) [-3134.760] * [-3135.917] (-3137.311) (-3138.238) (-3137.205) -- 0:03:51 17500 -- [-3132.272] (-3140.487) (-3137.686) (-3135.119) * [-3142.754] (-3136.925) (-3132.050) (-3133.124) -- 0:03:44 18000 -- [-3135.453] (-3141.608) (-3135.797) (-3136.053) * [-3136.058] (-3133.543) (-3136.007) (-3135.676) -- 0:03:38 18500 -- [-3136.244] (-3134.467) (-3134.685) (-3133.594) * (-3141.832) (-3133.191) (-3130.444) [-3133.200] -- 0:03:32 19000 -- (-3138.036) [-3138.049] (-3136.032) (-3139.088) * (-3136.892) (-3137.644) (-3132.353) [-3131.769] -- 0:03:26 19500 -- [-3134.409] (-3136.755) (-3136.134) (-3134.310) * [-3134.047] (-3134.507) (-3140.729) (-3132.949) -- 0:03:21 20000 -- (-3134.356) (-3134.142) (-3135.628) [-3132.344] * (-3138.280) (-3134.341) [-3135.008] (-3133.091) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 20500 -- [-3133.117] (-3133.672) (-3139.135) (-3140.498) * [-3141.904] (-3140.025) (-3135.399) (-3137.690) -- 0:03:11 21000 -- (-3135.994) (-3135.403) [-3132.717] (-3142.308) * (-3137.869) (-3138.403) (-3136.232) [-3139.849] -- 0:03:06 21500 -- (-3134.219) (-3136.228) (-3137.597) [-3139.277] * (-3136.664) (-3139.693) (-3136.374) [-3137.945] -- 0:03:47 22000 -- (-3135.920) (-3131.356) (-3135.143) [-3134.848] * (-3134.941) [-3140.662] (-3135.448) (-3134.833) -- 0:03:42 22500 -- (-3131.665) [-3130.078] (-3133.085) (-3140.560) * (-3136.602) (-3143.033) (-3138.360) [-3136.635] -- 0:03:37 23000 -- [-3132.747] (-3135.042) (-3135.183) (-3137.302) * (-3134.662) (-3137.845) (-3134.576) [-3132.220] -- 0:03:32 23500 -- (-3141.847) [-3138.075] (-3140.527) (-3139.725) * [-3133.147] (-3134.861) (-3141.387) (-3139.955) -- 0:03:27 24000 -- [-3138.253] (-3140.549) (-3133.757) (-3145.294) * [-3134.678] (-3137.409) (-3130.629) (-3137.330) -- 0:03:23 24500 -- (-3135.360) [-3140.693] (-3136.161) (-3138.755) * (-3135.179) [-3139.892] (-3133.670) (-3138.730) -- 0:03:19 25000 -- (-3139.368) [-3137.912] (-3131.658) (-3144.208) * [-3130.258] (-3132.895) (-3135.888) (-3142.752) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 25500 -- (-3134.156) (-3138.719) [-3131.689] (-3138.444) * (-3137.073) [-3138.440] (-3140.067) (-3145.852) -- 0:03:11 26000 -- (-3137.473) [-3135.269] (-3134.572) (-3144.555) * [-3135.613] (-3133.171) (-3139.235) (-3138.599) -- 0:03:07 26500 -- (-3131.925) (-3141.780) (-3139.961) [-3142.224] * (-3131.579) [-3132.717] (-3135.325) (-3135.254) -- 0:03:03 27000 -- (-3134.460) [-3136.871] (-3134.679) (-3135.438) * (-3136.223) [-3134.773] (-3135.934) (-3135.765) -- 0:03:36 27500 -- [-3136.866] (-3136.003) (-3132.130) (-3144.252) * (-3135.658) (-3132.485) [-3133.875] (-3140.861) -- 0:03:32 28000 -- (-3140.082) (-3137.144) (-3138.168) [-3134.506] * (-3141.307) [-3138.442] (-3130.624) (-3145.490) -- 0:03:28 28500 -- (-3136.054) (-3136.158) [-3131.688] (-3138.656) * [-3133.168] (-3135.516) (-3135.579) (-3134.781) -- 0:03:24 29000 -- [-3137.731] (-3135.056) (-3131.309) (-3133.886) * (-3141.910) (-3138.774) (-3141.084) [-3132.743] -- 0:03:20 29500 -- (-3144.425) [-3134.883] (-3132.535) (-3137.193) * (-3135.797) (-3135.102) (-3135.901) [-3132.232] -- 0:03:17 30000 -- (-3135.418) (-3136.116) [-3135.136] (-3134.156) * [-3137.605] (-3143.312) (-3133.728) (-3134.485) -- 0:03:14 Average standard deviation of split frequencies: 0.000000 30500 -- (-3138.759) [-3131.829] (-3137.476) (-3136.258) * (-3132.738) (-3140.375) (-3139.607) [-3130.977] -- 0:03:10 31000 -- [-3133.692] (-3139.245) (-3135.013) (-3132.869) * (-3133.236) (-3135.812) [-3134.641] (-3135.248) -- 0:03:07 31500 -- (-3135.680) (-3138.640) [-3135.497] (-3135.478) * (-3133.597) (-3136.113) (-3134.839) [-3135.245] -- 0:03:04 32000 -- (-3135.728) [-3133.373] (-3132.928) (-3136.335) * (-3134.887) (-3137.178) (-3135.257) [-3132.702] -- 0:03:31 32500 -- (-3136.328) [-3137.428] (-3131.837) (-3135.907) * [-3137.484] (-3132.111) (-3140.162) (-3133.639) -- 0:03:28 33000 -- (-3149.979) (-3135.361) (-3136.508) [-3140.339] * [-3132.703] (-3134.355) (-3135.757) (-3132.553) -- 0:03:25 33500 -- (-3132.736) (-3133.757) [-3131.513] (-3140.961) * (-3143.085) (-3134.629) [-3138.209] (-3133.228) -- 0:03:21 34000 -- (-3135.982) (-3133.491) [-3136.256] (-3136.165) * (-3137.844) (-3136.727) (-3135.189) [-3134.325] -- 0:03:18 34500 -- (-3134.975) (-3135.964) (-3137.693) [-3140.715] * (-3142.075) [-3132.622] (-3137.520) (-3136.990) -- 0:03:15 35000 -- (-3140.168) [-3135.937] (-3135.690) (-3133.104) * (-3134.230) [-3134.457] (-3134.288) (-3143.843) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 35500 -- (-3138.926) (-3139.204) (-3133.674) [-3130.447] * (-3136.365) (-3132.163) (-3135.059) [-3138.249] -- 0:03:10 36000 -- (-3137.394) (-3133.341) (-3135.003) [-3136.221] * (-3135.202) [-3133.126] (-3132.888) (-3130.629) -- 0:03:07 36500 -- (-3132.579) (-3136.496) [-3138.117] (-3136.577) * (-3136.368) [-3135.187] (-3139.354) (-3137.097) -- 0:03:04 37000 -- [-3134.488] (-3133.552) (-3135.773) (-3134.467) * (-3138.525) (-3132.889) (-3134.326) [-3133.138] -- 0:03:02 37500 -- (-3131.637) (-3134.651) (-3142.340) [-3134.053] * (-3136.800) (-3135.023) [-3132.860] (-3135.484) -- 0:03:25 38000 -- [-3132.580] (-3131.164) (-3136.406) (-3135.434) * (-3140.131) [-3132.458] (-3137.623) (-3138.417) -- 0:03:22 38500 -- (-3136.107) [-3132.855] (-3132.931) (-3136.286) * (-3136.056) [-3133.040] (-3134.763) (-3143.444) -- 0:03:19 39000 -- (-3138.589) [-3131.810] (-3135.045) (-3137.830) * (-3140.611) (-3134.182) (-3134.002) [-3135.116] -- 0:03:17 39500 -- (-3138.807) (-3130.340) (-3136.841) [-3135.355] * [-3134.219] (-3134.945) (-3133.191) (-3138.315) -- 0:03:14 40000 -- (-3133.386) (-3132.693) [-3132.912] (-3139.074) * [-3135.727] (-3132.204) (-3143.403) (-3135.275) -- 0:03:12 Average standard deviation of split frequencies: 0.000000 40500 -- (-3140.237) (-3134.893) [-3131.259] (-3135.578) * (-3142.611) [-3130.644] (-3135.483) (-3141.713) -- 0:03:09 41000 -- (-3131.735) (-3130.471) (-3136.496) [-3136.145] * (-3135.988) (-3135.127) [-3135.828] (-3139.905) -- 0:03:07 41500 -- (-3135.786) (-3133.610) (-3136.984) [-3132.842] * [-3136.787] (-3132.883) (-3136.007) (-3136.719) -- 0:03:04 42000 -- (-3132.340) (-3139.505) (-3137.586) [-3133.405] * (-3133.365) (-3132.392) [-3134.367] (-3137.256) -- 0:03:02 42500 -- (-3133.638) [-3133.092] (-3137.377) (-3130.309) * (-3138.401) [-3134.384] (-3138.237) (-3140.697) -- 0:03:00 43000 -- (-3133.782) (-3138.856) [-3133.723] (-3134.865) * (-3137.874) (-3142.256) (-3136.606) [-3134.621] -- 0:03:20 43500 -- [-3139.780] (-3135.491) (-3134.719) (-3134.925) * (-3142.789) [-3133.539] (-3133.440) (-3134.683) -- 0:03:17 44000 -- [-3131.379] (-3134.195) (-3136.620) (-3132.440) * (-3135.162) (-3135.226) (-3136.115) [-3134.274] -- 0:03:15 44500 -- (-3135.877) [-3132.335] (-3135.093) (-3134.576) * [-3135.846] (-3139.637) (-3137.874) (-3134.833) -- 0:03:13 45000 -- (-3135.033) [-3132.643] (-3137.999) (-3132.550) * (-3131.982) (-3136.962) (-3138.507) [-3133.732] -- 0:03:11 Average standard deviation of split frequencies: 0.000000 45500 -- (-3136.939) [-3131.707] (-3141.666) (-3132.032) * (-3135.500) (-3136.976) (-3136.366) [-3130.881] -- 0:03:08 46000 -- (-3139.523) (-3142.162) (-3139.281) [-3130.540] * (-3139.075) (-3133.199) [-3136.029] (-3142.509) -- 0:03:06 46500 -- (-3141.779) (-3151.157) (-3141.514) [-3133.095] * (-3137.490) (-3138.941) [-3133.349] (-3137.776) -- 0:03:04 47000 -- [-3135.468] (-3140.402) (-3137.696) (-3133.814) * (-3132.707) (-3145.744) [-3131.631] (-3145.000) -- 0:03:02 47500 -- [-3134.523] (-3139.646) (-3146.968) (-3131.314) * (-3139.704) (-3138.272) [-3133.793] (-3149.640) -- 0:03:00 48000 -- (-3135.481) (-3139.134) (-3136.888) [-3131.902] * (-3135.088) (-3136.198) [-3134.416] (-3141.382) -- 0:02:58 48500 -- (-3137.212) [-3137.042] (-3139.544) (-3139.315) * [-3132.035] (-3133.620) (-3135.693) (-3139.779) -- 0:03:16 49000 -- (-3138.301) (-3140.448) (-3139.064) [-3136.773] * (-3134.500) (-3142.806) (-3136.217) [-3132.710] -- 0:03:14 49500 -- [-3136.731] (-3140.528) (-3134.315) (-3135.303) * [-3133.003] (-3135.595) (-3136.911) (-3131.843) -- 0:03:12 50000 -- (-3137.409) (-3131.952) (-3135.649) [-3133.896] * (-3136.467) [-3130.495] (-3130.989) (-3135.137) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 50500 -- [-3135.216] (-3141.657) (-3141.893) (-3136.659) * (-3142.045) (-3136.380) (-3136.504) [-3134.088] -- 0:03:08 51000 -- (-3134.701) (-3136.730) [-3137.627] (-3137.804) * (-3138.587) (-3136.825) [-3131.872] (-3130.838) -- 0:03:06 51500 -- (-3133.509) (-3136.436) (-3132.813) [-3131.619] * [-3135.737] (-3140.759) (-3134.387) (-3136.539) -- 0:03:04 52000 -- (-3135.585) [-3139.218] (-3138.685) (-3138.477) * (-3135.869) (-3134.459) (-3134.882) [-3135.548] -- 0:03:02 52500 -- (-3136.923) (-3133.817) (-3147.512) [-3139.009] * [-3134.173] (-3130.122) (-3137.587) (-3131.563) -- 0:03:00 53000 -- [-3133.528] (-3133.829) (-3134.752) (-3136.923) * (-3141.945) (-3133.123) (-3133.715) [-3130.941] -- 0:02:58 53500 -- (-3140.180) [-3138.326] (-3139.663) (-3147.110) * (-3134.318) (-3139.950) (-3136.241) [-3130.277] -- 0:03:14 54000 -- (-3140.384) (-3135.331) [-3132.149] (-3140.388) * (-3132.730) (-3139.801) [-3133.473] (-3142.678) -- 0:03:12 54500 -- (-3134.584) [-3141.600] (-3136.130) (-3136.757) * [-3135.508] (-3136.762) (-3135.253) (-3135.895) -- 0:03:10 55000 -- (-3136.022) [-3131.132] (-3142.819) (-3139.275) * [-3134.550] (-3135.571) (-3139.640) (-3132.883) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 55500 -- (-3131.370) [-3134.563] (-3135.922) (-3133.312) * (-3133.761) [-3137.367] (-3137.604) (-3137.254) -- 0:03:07 56000 -- (-3129.709) [-3136.912] (-3136.159) (-3137.870) * [-3134.188] (-3142.197) (-3134.965) (-3135.638) -- 0:03:05 56500 -- (-3137.035) [-3132.712] (-3139.612) (-3136.965) * [-3143.094] (-3140.153) (-3133.598) (-3137.703) -- 0:03:03 57000 -- (-3137.856) (-3134.982) [-3132.016] (-3139.324) * [-3132.178] (-3139.508) (-3141.954) (-3132.659) -- 0:03:01 57500 -- (-3141.563) [-3136.475] (-3134.873) (-3142.522) * (-3137.252) [-3134.911] (-3138.422) (-3136.916) -- 0:03:00 58000 -- [-3141.431] (-3131.764) (-3134.451) (-3133.971) * (-3131.830) (-3143.381) (-3139.420) [-3133.910] -- 0:02:58 58500 -- (-3140.513) (-3133.633) [-3143.787] (-3130.965) * (-3131.344) (-3134.279) (-3138.434) [-3133.153] -- 0:02:57 59000 -- (-3136.508) (-3137.628) (-3137.864) [-3132.919] * (-3135.489) (-3135.071) [-3133.758] (-3148.731) -- 0:03:11 59500 -- (-3134.139) (-3135.043) [-3136.602] (-3134.245) * [-3134.547] (-3133.566) (-3133.749) (-3138.110) -- 0:03:09 60000 -- [-3140.254] (-3132.544) (-3133.367) (-3138.054) * (-3134.238) (-3137.160) [-3131.379] (-3143.649) -- 0:03:08 Average standard deviation of split frequencies: 0.000000 60500 -- (-3137.076) (-3136.455) (-3133.461) [-3131.221] * (-3147.099) [-3130.537] (-3133.334) (-3144.390) -- 0:03:06 61000 -- (-3137.401) (-3138.631) (-3134.387) [-3134.529] * (-3136.482) [-3134.262] (-3135.167) (-3144.500) -- 0:03:04 61500 -- (-3138.661) (-3138.650) (-3141.467) [-3138.477] * (-3138.527) (-3133.302) [-3138.105] (-3150.192) -- 0:03:03 62000 -- (-3135.244) (-3137.895) [-3133.338] (-3137.245) * (-3140.410) (-3133.421) [-3130.635] (-3140.016) -- 0:03:01 62500 -- (-3132.204) (-3134.144) [-3136.638] (-3136.217) * (-3136.242) (-3133.091) (-3140.773) [-3137.839] -- 0:03:00 63000 -- (-3139.910) [-3131.108] (-3131.271) (-3134.408) * [-3134.533] (-3137.292) (-3132.193) (-3140.206) -- 0:02:58 63500 -- (-3138.630) (-3134.468) [-3132.294] (-3135.987) * (-3132.916) (-3140.760) (-3140.074) [-3134.312] -- 0:02:56 64000 -- [-3136.996] (-3131.821) (-3136.311) (-3135.432) * (-3136.370) (-3137.035) (-3132.443) [-3138.206] -- 0:03:10 64500 -- (-3136.713) [-3133.764] (-3133.374) (-3134.738) * [-3136.807] (-3131.100) (-3136.292) (-3135.955) -- 0:03:08 65000 -- (-3136.803) (-3130.415) [-3135.179] (-3142.177) * (-3136.332) (-3134.162) [-3132.894] (-3134.227) -- 0:03:07 Average standard deviation of split frequencies: 0.000000 65500 -- [-3137.598] (-3134.055) (-3132.072) (-3137.411) * (-3138.288) (-3133.762) (-3132.322) [-3132.195] -- 0:03:05 66000 -- [-3134.327] (-3137.352) (-3138.339) (-3136.110) * [-3132.453] (-3135.818) (-3137.715) (-3135.330) -- 0:03:03 66500 -- (-3134.473) [-3132.482] (-3142.041) (-3137.307) * [-3132.042] (-3137.431) (-3136.183) (-3134.200) -- 0:03:02 67000 -- [-3136.165] (-3135.123) (-3138.049) (-3135.984) * (-3140.519) (-3134.616) [-3137.640] (-3136.944) -- 0:03:01 67500 -- (-3138.981) (-3138.881) (-3134.921) [-3133.901] * (-3144.194) [-3132.766] (-3140.874) (-3131.455) -- 0:02:59 68000 -- (-3143.009) (-3139.361) (-3139.749) [-3133.946] * (-3140.968) [-3133.149] (-3133.848) (-3131.923) -- 0:02:58 68500 -- (-3138.436) (-3136.086) [-3135.150] (-3133.853) * (-3133.013) [-3135.980] (-3135.773) (-3138.025) -- 0:02:56 69000 -- (-3137.808) (-3133.900) [-3137.938] (-3134.735) * (-3135.073) [-3136.878] (-3130.646) (-3137.303) -- 0:02:55 69500 -- [-3131.760] (-3132.555) (-3135.305) (-3139.748) * (-3133.350) (-3139.486) (-3134.808) [-3136.322] -- 0:03:07 70000 -- (-3139.161) (-3141.515) (-3132.990) [-3135.423] * (-3135.283) (-3142.095) (-3135.720) [-3131.441] -- 0:03:06 Average standard deviation of split frequencies: 0.000000 70500 -- (-3138.604) (-3139.432) [-3140.704] (-3137.708) * [-3134.949] (-3134.810) (-3138.123) (-3134.561) -- 0:03:04 71000 -- (-3151.390) [-3137.748] (-3137.304) (-3140.494) * (-3135.012) [-3132.095] (-3135.848) (-3135.658) -- 0:03:03 71500 -- (-3147.034) (-3138.859) [-3139.066] (-3137.369) * (-3140.119) (-3135.539) [-3135.682] (-3139.609) -- 0:03:01 72000 -- (-3143.677) [-3131.971] (-3132.527) (-3139.753) * (-3140.277) (-3136.957) (-3138.286) [-3139.322] -- 0:03:00 72500 -- (-3147.442) [-3133.462] (-3131.144) (-3148.381) * (-3139.678) (-3135.497) [-3138.040] (-3152.710) -- 0:02:59 73000 -- (-3135.060) (-3137.306) (-3137.257) [-3141.597] * (-3134.012) (-3132.105) (-3136.979) [-3136.998] -- 0:02:57 73500 -- (-3136.653) (-3139.342) (-3137.279) [-3136.319] * (-3133.629) (-3133.973) (-3133.536) [-3129.132] -- 0:02:56 74000 -- (-3137.419) (-3132.000) (-3141.333) [-3134.516] * [-3134.274] (-3144.535) (-3133.027) (-3134.307) -- 0:02:55 74500 -- [-3137.460] (-3134.863) (-3141.670) (-3132.745) * (-3140.583) [-3140.928] (-3132.480) (-3135.047) -- 0:03:06 75000 -- (-3136.071) (-3136.874) [-3138.041] (-3130.811) * (-3133.647) (-3135.006) (-3133.735) [-3134.596] -- 0:03:05 Average standard deviation of split frequencies: 0.000000 75500 -- (-3133.473) [-3133.239] (-3132.989) (-3135.249) * [-3135.297] (-3146.066) (-3134.474) (-3134.450) -- 0:03:03 76000 -- (-3131.996) (-3130.047) [-3132.814] (-3136.899) * [-3134.041] (-3142.220) (-3140.047) (-3133.851) -- 0:03:02 76500 -- (-3136.773) (-3140.360) (-3143.725) [-3133.737] * (-3132.707) (-3137.052) [-3140.280] (-3134.109) -- 0:03:01 77000 -- [-3134.567] (-3132.526) (-3133.616) (-3136.603) * (-3138.515) [-3139.904] (-3139.108) (-3139.157) -- 0:02:59 77500 -- (-3137.746) (-3131.437) [-3136.567] (-3141.974) * (-3137.942) [-3132.457] (-3139.048) (-3139.851) -- 0:02:58 78000 -- (-3135.690) (-3136.712) (-3138.081) [-3135.811] * [-3132.794] (-3135.898) (-3136.310) (-3138.085) -- 0:02:57 78500 -- (-3140.678) [-3132.039] (-3148.402) (-3131.434) * (-3132.893) [-3131.368] (-3144.025) (-3143.107) -- 0:02:56 79000 -- (-3130.232) (-3137.781) (-3145.363) [-3131.433] * (-3136.031) (-3134.216) (-3133.227) [-3144.007] -- 0:02:54 79500 -- (-3132.313) [-3133.723] (-3134.275) (-3133.775) * (-3136.285) (-3135.256) [-3143.248] (-3140.478) -- 0:02:53 80000 -- (-3136.035) [-3134.260] (-3136.168) (-3135.440) * (-3133.007) (-3131.293) (-3136.119) [-3133.791] -- 0:03:04 Average standard deviation of split frequencies: 0.000000 80500 -- (-3136.922) [-3129.814] (-3131.569) (-3135.332) * (-3135.237) [-3133.213] (-3141.899) (-3143.563) -- 0:03:02 81000 -- (-3137.378) (-3132.914) (-3140.649) [-3134.365] * (-3135.940) (-3133.555) (-3138.007) [-3136.246] -- 0:03:01 81500 -- (-3135.050) (-3133.202) (-3137.517) [-3139.552] * (-3140.469) (-3133.620) [-3136.463] (-3134.596) -- 0:03:00 82000 -- (-3131.513) (-3135.008) (-3138.143) [-3133.953] * (-3137.638) (-3137.344) (-3139.833) [-3132.131] -- 0:02:59 82500 -- (-3130.755) (-3136.624) [-3128.254] (-3131.506) * (-3139.109) (-3133.520) [-3135.310] (-3136.770) -- 0:02:57 83000 -- [-3133.953] (-3131.899) (-3131.940) (-3138.676) * (-3139.507) (-3138.384) (-3134.435) [-3130.877] -- 0:02:56 83500 -- (-3135.750) (-3136.019) [-3130.880] (-3135.316) * (-3138.909) [-3134.786] (-3135.277) (-3135.321) -- 0:02:55 84000 -- (-3133.488) (-3133.360) (-3137.478) [-3131.469] * (-3141.538) (-3135.617) (-3135.907) [-3136.568] -- 0:02:54 84500 -- (-3137.753) (-3131.533) (-3137.408) [-3134.229] * (-3135.527) (-3134.736) [-3137.384] (-3135.983) -- 0:02:53 85000 -- (-3138.699) (-3139.397) [-3133.175] (-3135.438) * (-3134.744) (-3135.515) (-3136.100) [-3133.053] -- 0:02:52 Average standard deviation of split frequencies: 0.000000 85500 -- (-3138.121) (-3140.102) [-3131.776] (-3134.070) * (-3130.152) (-3139.397) [-3140.654] (-3131.439) -- 0:03:01 86000 -- (-3138.623) (-3145.554) (-3132.843) [-3133.089] * [-3135.205] (-3137.361) (-3137.495) (-3133.605) -- 0:03:00 86500 -- [-3136.960] (-3140.643) (-3134.963) (-3142.130) * [-3136.474] (-3131.531) (-3136.253) (-3134.957) -- 0:02:59 87000 -- [-3132.097] (-3137.177) (-3130.404) (-3142.596) * (-3142.898) (-3134.757) [-3133.807] (-3133.149) -- 0:02:58 87500 -- (-3140.245) (-3134.392) [-3132.219] (-3134.606) * (-3138.957) (-3134.958) (-3141.977) [-3131.875] -- 0:02:57 88000 -- (-3139.792) [-3131.683] (-3133.521) (-3132.989) * (-3131.680) (-3137.328) [-3141.374] (-3132.102) -- 0:02:56 88500 -- (-3136.755) (-3135.787) [-3132.790] (-3133.632) * (-3136.566) [-3139.606] (-3139.498) (-3142.432) -- 0:02:55 89000 -- (-3136.362) [-3135.619] (-3141.720) (-3132.657) * (-3133.059) (-3135.558) [-3135.175] (-3134.501) -- 0:02:54 89500 -- (-3132.492) (-3130.581) [-3145.919] (-3133.891) * (-3130.786) (-3137.170) (-3140.524) [-3134.979] -- 0:02:52 90000 -- (-3131.779) [-3133.186] (-3137.299) (-3137.474) * (-3136.193) (-3134.852) (-3136.230) [-3136.120] -- 0:02:51 Average standard deviation of split frequencies: 0.000000 90500 -- (-3134.749) (-3135.488) (-3141.113) [-3132.809] * (-3132.982) (-3136.178) (-3133.498) [-3136.264] -- 0:02:50 91000 -- [-3131.490] (-3141.808) (-3134.857) (-3133.032) * [-3133.760] (-3131.253) (-3139.357) (-3133.478) -- 0:02:59 91500 -- [-3132.743] (-3137.888) (-3133.372) (-3132.626) * (-3144.511) [-3132.210] (-3134.122) (-3137.030) -- 0:02:58 92000 -- (-3136.172) (-3139.126) (-3134.851) [-3136.939] * (-3133.743) [-3133.289] (-3143.029) (-3138.189) -- 0:02:57 92500 -- [-3133.494] (-3137.990) (-3130.547) (-3145.856) * (-3132.343) (-3135.437) [-3138.463] (-3134.538) -- 0:02:56 93000 -- (-3137.220) (-3135.055) [-3137.632] (-3141.733) * (-3136.623) (-3131.160) [-3138.675] (-3134.697) -- 0:02:55 93500 -- (-3138.018) [-3133.493] (-3140.683) (-3133.090) * (-3139.291) (-3142.842) (-3132.979) [-3131.613] -- 0:02:54 94000 -- (-3139.645) (-3135.562) [-3135.731] (-3134.017) * [-3136.061] (-3132.536) (-3140.334) (-3137.012) -- 0:02:53 94500 -- (-3140.861) (-3136.562) (-3138.044) [-3135.867] * (-3135.237) (-3133.407) [-3132.663] (-3130.679) -- 0:02:52 95000 -- (-3139.262) (-3136.787) (-3137.497) [-3135.802] * [-3132.831] (-3130.528) (-3130.056) (-3132.224) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 95500 -- (-3133.414) (-3136.007) (-3136.817) [-3137.659] * [-3136.063] (-3132.505) (-3135.518) (-3133.695) -- 0:02:50 96000 -- (-3133.800) [-3131.663] (-3132.218) (-3135.158) * (-3137.570) (-3131.105) (-3134.700) [-3136.826] -- 0:02:58 96500 -- (-3129.423) (-3132.650) (-3143.139) [-3134.883] * (-3133.031) (-3137.699) [-3135.682] (-3136.547) -- 0:02:57 97000 -- [-3130.880] (-3138.001) (-3138.793) (-3138.441) * [-3135.921] (-3136.414) (-3139.655) (-3130.252) -- 0:02:56 97500 -- (-3133.568) (-3136.913) (-3133.182) [-3136.159] * [-3134.895] (-3136.434) (-3135.733) (-3134.332) -- 0:02:55 98000 -- [-3135.280] (-3141.605) (-3134.255) (-3134.125) * (-3139.410) (-3135.742) (-3134.960) [-3132.800] -- 0:02:54 98500 -- (-3138.529) (-3135.635) (-3133.401) [-3141.366] * (-3135.270) (-3144.375) (-3134.627) [-3131.717] -- 0:02:53 99000 -- (-3134.637) (-3148.186) (-3136.427) [-3133.244] * (-3136.713) (-3141.908) [-3139.309] (-3135.780) -- 0:02:52 99500 -- (-3140.570) [-3140.936] (-3133.848) (-3136.309) * (-3131.435) [-3133.201] (-3134.509) (-3142.246) -- 0:02:51 100000 -- (-3135.706) (-3138.293) (-3133.749) [-3136.459] * (-3136.261) (-3134.089) (-3131.094) [-3131.561] -- 0:02:51 Average standard deviation of split frequencies: 0.000000 100500 -- [-3134.551] (-3132.404) (-3137.163) (-3136.116) * [-3135.654] (-3136.628) (-3131.787) (-3138.511) -- 0:02:59 101000 -- (-3137.475) (-3135.110) (-3134.416) [-3132.861] * (-3133.529) (-3134.205) [-3136.468] (-3139.329) -- 0:02:58 101500 -- [-3133.740] (-3136.029) (-3139.925) (-3135.206) * [-3139.220] (-3136.629) (-3132.850) (-3142.432) -- 0:02:57 102000 -- (-3131.318) (-3140.880) [-3133.596] (-3130.953) * (-3135.542) (-3136.678) [-3133.543] (-3137.487) -- 0:02:56 102500 -- [-3133.286] (-3136.686) (-3135.778) (-3138.483) * [-3136.068] (-3137.488) (-3136.609) (-3138.342) -- 0:02:55 103000 -- [-3133.993] (-3134.994) (-3135.610) (-3145.209) * [-3132.648] (-3137.273) (-3134.216) (-3134.404) -- 0:02:54 103500 -- (-3139.550) (-3143.095) [-3138.606] (-3135.486) * (-3137.565) [-3134.583] (-3139.622) (-3136.729) -- 0:02:53 104000 -- (-3137.430) [-3133.878] (-3135.310) (-3134.302) * (-3135.874) (-3135.908) [-3132.544] (-3131.121) -- 0:02:52 104500 -- [-3136.618] (-3139.112) (-3131.148) (-3135.531) * (-3139.568) [-3131.267] (-3140.631) (-3134.401) -- 0:02:51 105000 -- (-3138.583) (-3137.510) [-3137.295] (-3133.142) * (-3139.714) (-3127.782) (-3135.813) [-3130.486] -- 0:02:50 Average standard deviation of split frequencies: 0.000000 105500 -- (-3134.565) (-3133.716) [-3140.228] (-3139.161) * [-3136.463] (-3140.971) (-3134.255) (-3131.249) -- 0:02:49 106000 -- (-3136.452) [-3137.297] (-3131.698) (-3136.309) * (-3138.653) [-3132.981] (-3134.734) (-3140.889) -- 0:02:57 106500 -- (-3135.901) (-3136.499) (-3135.987) [-3135.783] * (-3147.632) (-3133.073) [-3133.416] (-3133.646) -- 0:02:56 107000 -- (-3137.732) (-3146.131) (-3135.197) [-3136.667] * (-3136.420) [-3133.889] (-3133.393) (-3134.307) -- 0:02:55 107500 -- [-3140.053] (-3135.186) (-3134.541) (-3133.611) * [-3138.685] (-3130.884) (-3134.112) (-3135.753) -- 0:02:54 108000 -- (-3135.968) (-3134.795) (-3138.586) [-3132.056] * [-3142.780] (-3138.056) (-3133.212) (-3142.198) -- 0:02:53 108500 -- [-3136.749] (-3138.245) (-3141.098) (-3137.116) * (-3138.063) [-3130.325] (-3130.161) (-3139.001) -- 0:02:52 109000 -- (-3141.334) (-3131.220) [-3140.223] (-3136.610) * [-3133.749] (-3130.111) (-3131.268) (-3131.563) -- 0:02:51 109500 -- (-3136.541) (-3135.335) [-3139.309] (-3133.573) * (-3132.021) [-3132.879] (-3138.661) (-3137.215) -- 0:02:50 110000 -- (-3142.721) (-3137.351) [-3138.777] (-3148.688) * (-3139.114) (-3135.283) [-3136.532] (-3144.931) -- 0:02:49 Average standard deviation of split frequencies: 0.000000 110500 -- (-3136.192) (-3136.681) [-3137.902] (-3141.425) * (-3140.699) [-3134.457] (-3139.606) (-3136.426) -- 0:02:49 111000 -- (-3136.152) (-3131.567) (-3135.063) [-3141.195] * (-3135.250) (-3130.988) [-3134.472] (-3139.270) -- 0:02:56 111500 -- (-3132.129) [-3131.079] (-3132.741) (-3140.428) * (-3148.389) [-3134.124] (-3135.061) (-3138.715) -- 0:02:55 112000 -- (-3132.969) [-3132.472] (-3131.883) (-3139.062) * (-3145.726) (-3134.205) (-3133.598) [-3132.689] -- 0:02:54 112500 -- (-3130.928) (-3137.139) (-3134.750) [-3131.389] * [-3143.571] (-3132.709) (-3138.631) (-3132.003) -- 0:02:53 113000 -- (-3134.511) (-3141.475) [-3133.753] (-3131.346) * (-3139.739) [-3133.978] (-3145.212) (-3142.762) -- 0:02:52 113500 -- (-3136.802) (-3135.990) [-3138.137] (-3132.718) * (-3133.844) [-3137.484] (-3138.279) (-3135.831) -- 0:02:51 114000 -- (-3144.219) (-3133.531) (-3136.275) [-3132.945] * (-3133.268) (-3139.818) [-3136.310] (-3133.066) -- 0:02:50 114500 -- (-3137.380) (-3138.583) [-3135.865] (-3134.280) * (-3134.733) (-3139.824) [-3136.877] (-3138.315) -- 0:02:50 115000 -- (-3140.387) (-3145.388) (-3132.371) [-3132.602] * [-3131.334] (-3140.776) (-3132.971) (-3134.955) -- 0:02:49 Average standard deviation of split frequencies: 0.000000 115500 -- (-3138.102) [-3133.973] (-3142.668) (-3136.648) * (-3132.216) (-3143.071) (-3140.581) [-3131.437] -- 0:02:48 116000 -- (-3137.222) [-3130.850] (-3132.707) (-3133.261) * [-3136.712] (-3135.066) (-3136.829) (-3139.961) -- 0:02:47 116500 -- [-3132.696] (-3135.576) (-3134.697) (-3132.683) * (-3132.595) (-3147.947) [-3133.731] (-3134.696) -- 0:02:54 117000 -- (-3137.780) (-3141.724) (-3134.451) [-3148.741] * [-3133.174] (-3148.022) (-3132.610) (-3133.056) -- 0:02:53 117500 -- (-3134.366) (-3132.938) (-3137.680) [-3137.856] * (-3133.972) (-3135.555) [-3136.243] (-3133.405) -- 0:02:52 118000 -- (-3134.969) [-3134.018] (-3134.761) (-3136.932) * [-3137.564] (-3136.435) (-3135.926) (-3137.516) -- 0:02:51 118500 -- (-3141.540) [-3135.239] (-3134.130) (-3138.624) * (-3137.566) [-3132.168] (-3139.998) (-3135.300) -- 0:02:51 119000 -- (-3134.039) (-3139.091) [-3134.153] (-3141.689) * (-3139.339) (-3132.927) (-3134.092) [-3135.422] -- 0:02:50 119500 -- (-3133.897) (-3140.551) [-3135.955] (-3139.345) * [-3131.891] (-3134.573) (-3135.308) (-3136.495) -- 0:02:49 120000 -- (-3131.015) (-3139.157) (-3131.883) [-3137.028] * (-3139.840) (-3131.922) (-3137.074) [-3132.143] -- 0:02:48 Average standard deviation of split frequencies: 0.000000 120500 -- (-3136.147) [-3134.581] (-3136.361) (-3133.863) * [-3136.817] (-3130.790) (-3135.326) (-3133.058) -- 0:02:47 121000 -- (-3133.459) [-3136.168] (-3133.021) (-3135.999) * (-3132.680) (-3133.705) [-3133.235] (-3132.829) -- 0:02:47 121500 -- (-3133.203) [-3132.901] (-3132.316) (-3136.192) * (-3137.610) [-3136.177] (-3133.265) (-3135.788) -- 0:02:53 122000 -- (-3136.437) (-3132.380) (-3132.101) [-3138.059] * [-3137.370] (-3133.966) (-3137.715) (-3135.666) -- 0:02:52 122500 -- (-3137.109) (-3136.626) [-3134.040] (-3136.315) * (-3146.121) (-3132.380) (-3137.448) [-3136.730] -- 0:02:51 123000 -- (-3140.906) (-3131.020) (-3140.934) [-3142.748] * (-3136.072) (-3131.764) [-3138.804] (-3133.060) -- 0:02:51 123500 -- (-3137.895) (-3136.204) (-3136.831) [-3137.539] * (-3136.341) (-3135.282) (-3131.226) [-3139.767] -- 0:02:50 124000 -- (-3137.724) [-3137.909] (-3135.975) (-3137.245) * [-3136.200] (-3134.582) (-3131.092) (-3135.635) -- 0:02:49 124500 -- [-3136.381] (-3135.133) (-3137.775) (-3134.101) * [-3138.068] (-3136.758) (-3133.238) (-3135.072) -- 0:02:48 125000 -- (-3141.458) (-3132.712) [-3138.668] (-3137.614) * (-3135.380) (-3132.865) (-3142.595) [-3135.092] -- 0:02:48 Average standard deviation of split frequencies: 0.000000 125500 -- (-3131.801) (-3134.039) (-3138.658) [-3132.876] * (-3136.214) [-3136.005] (-3138.704) (-3131.627) -- 0:02:47 126000 -- (-3139.620) (-3139.749) [-3139.832] (-3136.664) * (-3133.054) [-3133.675] (-3134.745) (-3135.865) -- 0:02:46 126500 -- (-3133.313) (-3131.933) (-3137.241) [-3132.299] * (-3137.548) (-3132.680) [-3131.071] (-3132.737) -- 0:02:45 127000 -- (-3138.202) (-3133.126) (-3137.167) [-3133.164] * (-3136.435) (-3133.345) [-3131.367] (-3135.291) -- 0:02:51 127500 -- (-3137.548) (-3132.640) (-3135.674) [-3133.894] * [-3132.126] (-3136.020) (-3137.879) (-3134.682) -- 0:02:51 128000 -- (-3147.305) (-3135.384) [-3134.169] (-3137.373) * (-3137.411) [-3132.187] (-3132.701) (-3134.875) -- 0:02:50 128500 -- (-3144.691) [-3134.660] (-3129.940) (-3136.900) * (-3132.713) (-3135.910) [-3132.837] (-3134.168) -- 0:02:49 129000 -- (-3135.154) (-3134.946) (-3132.074) [-3136.113] * [-3133.986] (-3135.299) (-3134.038) (-3134.027) -- 0:02:48 129500 -- [-3134.935] (-3131.633) (-3138.866) (-3138.244) * (-3137.248) [-3135.318] (-3143.218) (-3141.870) -- 0:02:48 130000 -- (-3135.724) [-3137.469] (-3132.529) (-3132.456) * (-3135.805) (-3136.375) [-3142.223] (-3138.814) -- 0:02:47 Average standard deviation of split frequencies: 0.000000 130500 -- (-3135.886) (-3132.852) [-3134.987] (-3131.908) * (-3138.456) (-3136.189) [-3141.192] (-3132.672) -- 0:02:46 131000 -- [-3134.700] (-3134.856) (-3131.964) (-3132.994) * [-3134.784] (-3132.839) (-3136.950) (-3132.812) -- 0:02:45 131500 -- [-3133.897] (-3139.019) (-3133.512) (-3134.650) * (-3132.290) (-3134.766) (-3133.394) [-3133.004] -- 0:02:45 132000 -- [-3134.865] (-3142.643) (-3135.750) (-3137.379) * (-3131.680) [-3134.163] (-3139.501) (-3139.007) -- 0:02:50 132500 -- (-3144.714) [-3136.902] (-3139.470) (-3135.346) * [-3133.345] (-3134.941) (-3135.398) (-3136.710) -- 0:02:50 133000 -- (-3134.782) [-3133.720] (-3141.027) (-3135.503) * (-3134.896) (-3140.691) [-3134.330] (-3137.440) -- 0:02:49 133500 -- (-3132.049) (-3133.376) (-3133.098) [-3134.023] * (-3132.840) [-3134.106] (-3135.574) (-3136.620) -- 0:02:48 134000 -- (-3136.492) (-3135.720) (-3137.576) [-3135.306] * (-3138.586) (-3133.274) [-3133.588] (-3141.198) -- 0:02:48 134500 -- (-3135.826) (-3135.347) [-3137.127] (-3136.281) * [-3134.933] (-3131.939) (-3136.171) (-3136.977) -- 0:02:47 135000 -- [-3135.312] (-3134.832) (-3130.528) (-3134.514) * [-3134.794] (-3135.155) (-3137.014) (-3137.960) -- 0:02:46 Average standard deviation of split frequencies: 0.000000 135500 -- (-3137.541) (-3141.288) [-3134.166] (-3132.997) * [-3133.835] (-3138.163) (-3133.397) (-3138.050) -- 0:02:45 136000 -- (-3136.268) [-3137.225] (-3140.546) (-3139.229) * (-3139.499) (-3134.526) (-3142.790) [-3135.710] -- 0:02:45 136500 -- [-3137.959] (-3137.164) (-3133.533) (-3137.583) * (-3144.551) [-3138.217] (-3140.631) (-3136.053) -- 0:02:44 137000 -- (-3136.932) (-3133.901) (-3135.718) [-3132.003] * (-3141.780) [-3135.964] (-3140.830) (-3134.206) -- 0:02:43 137500 -- (-3141.986) (-3136.770) (-3135.376) [-3137.012] * (-3143.744) [-3136.562] (-3137.534) (-3135.795) -- 0:02:49 138000 -- (-3133.677) (-3137.749) (-3136.216) [-3134.598] * (-3137.527) (-3138.522) [-3134.134] (-3135.136) -- 0:02:48 138500 -- (-3137.522) (-3144.020) [-3133.413] (-3134.192) * (-3138.497) (-3137.559) (-3135.301) [-3140.599] -- 0:02:47 139000 -- (-3135.482) (-3136.397) (-3145.632) [-3133.033] * (-3137.261) [-3139.830] (-3132.639) (-3143.805) -- 0:02:47 139500 -- (-3136.449) (-3131.377) [-3137.806] (-3134.075) * [-3132.291] (-3135.903) (-3137.715) (-3135.975) -- 0:02:46 140000 -- (-3141.294) (-3132.902) (-3141.552) [-3134.815] * (-3131.049) (-3131.556) [-3133.525] (-3131.326) -- 0:02:45 Average standard deviation of split frequencies: 0.000000 140500 -- [-3135.216] (-3135.320) (-3147.268) (-3136.891) * [-3135.136] (-3134.890) (-3135.097) (-3135.535) -- 0:02:45 141000 -- (-3135.791) [-3131.645] (-3134.768) (-3134.583) * (-3130.910) (-3133.267) [-3131.033] (-3138.055) -- 0:02:44 141500 -- [-3132.690] (-3131.984) (-3136.929) (-3136.557) * (-3133.925) (-3133.629) (-3135.210) [-3136.687] -- 0:02:43 142000 -- (-3132.252) [-3135.152] (-3133.109) (-3139.396) * (-3133.962) (-3136.142) (-3132.856) [-3137.222] -- 0:02:43 142500 -- [-3139.058] (-3134.858) (-3138.454) (-3133.181) * (-3133.277) (-3134.030) (-3136.388) [-3134.751] -- 0:02:48 143000 -- (-3138.077) (-3133.672) (-3132.255) [-3129.699] * (-3135.145) (-3130.941) [-3132.770] (-3141.599) -- 0:02:47 143500 -- (-3144.544) (-3134.474) [-3134.925] (-3139.511) * [-3131.058] (-3138.662) (-3137.092) (-3130.419) -- 0:02:47 144000 -- (-3146.208) (-3132.792) [-3131.341] (-3134.340) * (-3138.121) (-3141.137) [-3134.400] (-3138.248) -- 0:02:46 144500 -- (-3144.407) (-3136.857) (-3135.164) [-3132.468] * (-3142.742) [-3135.954] (-3141.298) (-3138.498) -- 0:02:45 145000 -- [-3142.334] (-3145.558) (-3133.202) (-3138.114) * (-3130.957) [-3134.058] (-3133.292) (-3144.331) -- 0:02:45 Average standard deviation of split frequencies: 0.000000 145500 -- (-3144.179) [-3135.047] (-3137.733) (-3146.354) * (-3132.189) [-3131.546] (-3135.928) (-3138.692) -- 0:02:44 146000 -- (-3146.040) [-3139.729] (-3134.537) (-3139.927) * (-3136.317) (-3136.267) [-3137.972] (-3143.638) -- 0:02:43 146500 -- (-3139.255) [-3134.981] (-3134.208) (-3140.240) * (-3133.042) [-3136.325] (-3136.984) (-3134.576) -- 0:02:43 147000 -- (-3129.418) (-3138.740) (-3135.264) [-3131.920] * (-3139.714) (-3140.132) [-3132.502] (-3134.029) -- 0:02:42 147500 -- (-3131.488) [-3137.063] (-3135.471) (-3138.169) * (-3135.586) (-3133.463) (-3134.793) [-3137.903] -- 0:02:41 148000 -- (-3133.453) (-3137.058) (-3131.609) [-3133.607] * (-3135.828) (-3131.868) (-3138.851) [-3132.176] -- 0:02:46 148500 -- (-3133.780) (-3136.924) (-3132.710) [-3134.668] * [-3142.551] (-3137.082) (-3141.797) (-3135.168) -- 0:02:46 149000 -- [-3140.761] (-3137.843) (-3136.954) (-3132.253) * (-3135.388) (-3133.936) (-3131.928) [-3134.162] -- 0:02:45 149500 -- (-3148.103) [-3134.118] (-3136.956) (-3136.831) * [-3134.593] (-3137.458) (-3142.871) (-3133.074) -- 0:02:44 150000 -- (-3142.534) (-3133.049) [-3134.041] (-3135.827) * (-3131.410) (-3138.510) [-3140.953] (-3133.899) -- 0:02:44 Average standard deviation of split frequencies: 0.000000 150500 -- (-3138.770) (-3134.014) (-3133.603) [-3139.272] * [-3133.056] (-3136.347) (-3140.821) (-3134.055) -- 0:02:43 151000 -- (-3133.534) (-3136.223) [-3134.416] (-3138.453) * [-3131.408] (-3140.825) (-3138.881) (-3138.472) -- 0:02:43 151500 -- [-3136.851] (-3131.725) (-3132.291) (-3135.556) * [-3135.256] (-3139.792) (-3132.180) (-3135.090) -- 0:02:42 152000 -- (-3134.361) (-3132.176) [-3134.426] (-3134.251) * (-3135.376) [-3139.201] (-3137.704) (-3139.233) -- 0:02:41 152500 -- (-3135.279) [-3137.206] (-3133.780) (-3132.844) * (-3137.762) (-3139.699) (-3131.619) [-3132.764] -- 0:02:41 153000 -- (-3132.298) (-3139.527) [-3132.671] (-3135.008) * (-3141.041) (-3133.316) [-3136.444] (-3137.783) -- 0:02:46 153500 -- [-3133.673] (-3135.051) (-3135.768) (-3142.843) * (-3139.424) (-3131.801) [-3133.942] (-3132.013) -- 0:02:45 154000 -- [-3131.525] (-3135.282) (-3133.654) (-3136.815) * [-3139.170] (-3133.829) (-3135.691) (-3132.696) -- 0:02:44 154500 -- (-3135.163) (-3137.456) [-3135.512] (-3130.816) * (-3135.396) [-3133.620] (-3135.298) (-3135.312) -- 0:02:44 155000 -- (-3133.992) (-3138.073) (-3134.135) [-3129.227] * (-3134.444) (-3135.021) [-3134.996] (-3135.006) -- 0:02:43 Average standard deviation of split frequencies: 0.000000 155500 -- (-3138.404) (-3135.115) [-3136.570] (-3134.331) * [-3132.173] (-3139.990) (-3139.196) (-3138.302) -- 0:02:42 156000 -- (-3136.819) (-3134.005) [-3134.099] (-3135.308) * (-3139.833) [-3138.331] (-3140.558) (-3132.977) -- 0:02:42 156500 -- [-3135.817] (-3142.796) (-3136.154) (-3137.190) * [-3133.512] (-3132.762) (-3132.777) (-3140.343) -- 0:02:41 157000 -- [-3136.175] (-3136.420) (-3135.154) (-3135.950) * (-3137.400) (-3134.775) [-3131.416] (-3140.749) -- 0:02:41 157500 -- [-3132.141] (-3136.742) (-3134.511) (-3135.370) * (-3135.286) (-3130.980) [-3131.915] (-3145.914) -- 0:02:40 158000 -- [-3139.626] (-3134.716) (-3139.525) (-3139.617) * (-3134.742) [-3132.100] (-3135.703) (-3135.989) -- 0:02:39 158500 -- (-3139.431) (-3143.918) [-3139.910] (-3137.834) * (-3134.740) [-3132.396] (-3134.987) (-3138.879) -- 0:02:44 159000 -- [-3139.327] (-3139.258) (-3134.414) (-3142.939) * (-3136.041) (-3141.680) (-3137.036) [-3136.789] -- 0:02:43 159500 -- (-3139.700) [-3142.265] (-3136.584) (-3131.352) * (-3135.263) [-3135.198] (-3137.142) (-3132.911) -- 0:02:43 160000 -- (-3136.268) (-3136.973) (-3146.296) [-3132.669] * (-3135.267) (-3130.808) (-3139.461) [-3132.566] -- 0:02:42 Average standard deviation of split frequencies: 0.000000 160500 -- (-3133.120) [-3136.476] (-3135.048) (-3136.800) * (-3136.240) (-3139.126) (-3132.760) [-3136.297] -- 0:02:42 161000 -- (-3131.786) [-3133.400] (-3135.148) (-3134.836) * [-3134.216] (-3132.166) (-3132.776) (-3137.508) -- 0:02:41 161500 -- (-3141.587) (-3137.595) (-3136.018) [-3135.650] * (-3139.264) (-3135.952) (-3133.995) [-3128.986] -- 0:02:40 162000 -- [-3133.535] (-3141.584) (-3136.381) (-3135.607) * (-3143.702) (-3133.268) (-3131.748) [-3134.324] -- 0:02:40 162500 -- (-3133.848) (-3138.543) (-3130.296) [-3134.679] * (-3145.655) (-3134.662) [-3132.657] (-3132.625) -- 0:02:39 163000 -- (-3136.990) (-3141.787) (-3134.169) [-3131.999] * (-3133.350) (-3133.519) (-3133.414) [-3133.231] -- 0:02:39 163500 -- (-3140.248) [-3132.490] (-3133.455) (-3137.485) * (-3135.803) [-3137.723] (-3135.614) (-3135.005) -- 0:02:38 164000 -- (-3135.110) [-3138.604] (-3132.401) (-3136.405) * (-3132.554) (-3130.458) (-3129.828) [-3134.098] -- 0:02:43 164500 -- (-3136.192) [-3140.275] (-3133.705) (-3138.673) * [-3134.865] (-3131.681) (-3133.050) (-3134.166) -- 0:02:42 165000 -- (-3139.714) (-3136.654) (-3130.210) [-3135.332] * (-3136.781) (-3133.952) (-3137.336) [-3131.905] -- 0:02:41 Average standard deviation of split frequencies: 0.000000 165500 -- (-3142.938) (-3131.874) (-3136.289) [-3138.121] * [-3141.157] (-3134.526) (-3135.474) (-3137.229) -- 0:02:41 166000 -- (-3139.765) (-3129.590) [-3134.770] (-3131.226) * [-3136.626] (-3135.082) (-3132.652) (-3134.812) -- 0:02:40 166500 -- [-3134.591] (-3134.495) (-3136.640) (-3135.293) * (-3144.247) [-3138.883] (-3139.869) (-3132.040) -- 0:02:40 167000 -- (-3136.831) (-3132.158) [-3133.498] (-3137.828) * (-3133.934) [-3134.565] (-3134.117) (-3132.992) -- 0:02:39 167500 -- (-3135.108) [-3132.739] (-3137.979) (-3137.273) * (-3139.312) (-3134.725) (-3129.791) [-3132.238] -- 0:02:39 168000 -- (-3135.201) [-3133.786] (-3137.564) (-3136.848) * (-3139.346) (-3136.778) [-3137.663] (-3138.792) -- 0:02:38 168500 -- (-3132.248) (-3136.127) [-3137.545] (-3133.820) * (-3136.553) (-3137.766) (-3134.377) [-3135.385] -- 0:02:37 169000 -- (-3134.887) [-3139.580] (-3147.128) (-3141.753) * (-3141.183) (-3133.127) [-3134.557] (-3141.010) -- 0:02:42 169500 -- (-3135.536) (-3136.503) [-3138.334] (-3132.952) * [-3133.395] (-3133.309) (-3138.776) (-3141.493) -- 0:02:41 170000 -- (-3137.068) (-3134.063) [-3133.499] (-3134.234) * [-3132.754] (-3138.394) (-3137.265) (-3135.808) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 170500 -- (-3141.512) (-3137.082) (-3135.135) [-3141.021] * (-3138.648) [-3138.559] (-3135.692) (-3131.583) -- 0:02:40 171000 -- (-3133.211) [-3137.163] (-3134.346) (-3133.241) * (-3138.514) (-3135.583) (-3132.053) [-3133.095] -- 0:02:39 171500 -- (-3135.607) [-3136.470] (-3136.617) (-3137.262) * (-3134.117) (-3137.300) (-3137.260) [-3129.854] -- 0:02:39 172000 -- (-3136.609) (-3136.107) [-3135.947] (-3134.018) * (-3142.728) (-3133.565) (-3132.437) [-3132.227] -- 0:02:38 172500 -- (-3136.335) (-3130.750) [-3138.102] (-3136.598) * (-3138.922) (-3135.372) [-3131.342] (-3132.666) -- 0:02:38 173000 -- (-3144.604) [-3133.464] (-3138.526) (-3136.918) * (-3135.588) [-3132.612] (-3132.575) (-3138.121) -- 0:02:37 173500 -- [-3140.910] (-3135.143) (-3138.014) (-3138.704) * [-3137.282] (-3134.308) (-3138.085) (-3139.434) -- 0:02:37 174000 -- [-3134.148] (-3133.441) (-3135.428) (-3138.495) * [-3136.773] (-3136.094) (-3134.042) (-3133.712) -- 0:02:41 174500 -- (-3137.651) (-3135.666) [-3142.734] (-3138.319) * (-3134.293) (-3134.235) [-3134.850] (-3132.660) -- 0:02:40 175000 -- (-3133.571) [-3133.057] (-3140.205) (-3137.781) * (-3134.253) (-3133.758) (-3138.331) [-3135.248] -- 0:02:40 Average standard deviation of split frequencies: 0.000000 175500 -- (-3136.336) [-3136.493] (-3134.136) (-3132.681) * (-3134.747) (-3142.106) [-3134.068] (-3132.421) -- 0:02:39 176000 -- (-3138.951) (-3131.210) (-3135.102) [-3130.195] * (-3132.051) (-3137.655) [-3137.273] (-3144.076) -- 0:02:39 176500 -- (-3132.780) [-3130.052] (-3132.715) (-3137.160) * (-3132.644) (-3134.440) [-3138.192] (-3138.167) -- 0:02:38 177000 -- [-3132.812] (-3136.901) (-3133.990) (-3136.830) * (-3131.803) (-3131.963) [-3136.706] (-3132.635) -- 0:02:38 177500 -- (-3136.034) (-3136.884) [-3140.012] (-3131.929) * (-3137.157) (-3135.088) [-3133.972] (-3137.646) -- 0:02:37 178000 -- [-3133.684] (-3134.267) (-3137.181) (-3131.702) * (-3137.582) (-3139.722) [-3134.391] (-3138.499) -- 0:02:37 178500 -- (-3133.790) [-3132.892] (-3141.380) (-3132.780) * (-3138.722) (-3135.022) (-3140.610) [-3132.045] -- 0:02:36 179000 -- [-3135.349] (-3134.656) (-3138.517) (-3138.455) * (-3139.041) (-3131.694) [-3140.273] (-3137.424) -- 0:02:35 179500 -- (-3134.382) [-3135.536] (-3134.768) (-3141.710) * [-3132.980] (-3133.420) (-3133.904) (-3132.540) -- 0:02:39 180000 -- (-3137.727) (-3139.742) (-3135.904) [-3128.705] * (-3135.658) (-3141.020) (-3133.932) [-3132.422] -- 0:02:39 Average standard deviation of split frequencies: 0.000000 180500 -- (-3140.055) [-3142.253] (-3147.503) (-3134.383) * (-3144.434) (-3136.074) [-3130.950] (-3130.474) -- 0:02:38 181000 -- (-3136.947) (-3141.534) [-3138.037] (-3134.530) * [-3137.840] (-3135.883) (-3129.232) (-3135.203) -- 0:02:38 181500 -- (-3140.209) (-3135.798) (-3138.415) [-3131.086] * [-3132.948] (-3136.640) (-3136.872) (-3138.531) -- 0:02:37 182000 -- (-3138.998) (-3131.356) (-3137.267) [-3132.891] * (-3132.725) [-3129.954] (-3140.299) (-3135.292) -- 0:02:37 182500 -- (-3135.220) [-3133.362] (-3141.622) (-3137.780) * [-3133.258] (-3132.637) (-3141.126) (-3133.107) -- 0:02:36 183000 -- (-3139.338) [-3133.029] (-3134.159) (-3139.611) * (-3136.550) [-3133.679] (-3137.378) (-3135.933) -- 0:02:36 183500 -- [-3138.840] (-3135.832) (-3133.984) (-3133.360) * (-3136.039) [-3130.478] (-3133.402) (-3133.926) -- 0:02:35 184000 -- (-3136.178) (-3133.865) [-3135.646] (-3133.798) * (-3133.516) (-3136.599) (-3137.734) [-3134.612] -- 0:02:35 184500 -- [-3134.653] (-3133.508) (-3135.067) (-3132.695) * [-3132.869] (-3142.846) (-3134.714) (-3131.956) -- 0:02:34 185000 -- (-3139.381) (-3134.686) (-3140.241) [-3139.092] * (-3135.843) [-3131.062] (-3143.519) (-3135.436) -- 0:02:38 Average standard deviation of split frequencies: 0.000000 185500 -- [-3140.202] (-3133.822) (-3132.614) (-3141.114) * [-3129.172] (-3137.827) (-3139.493) (-3136.576) -- 0:02:38 186000 -- (-3137.208) [-3134.151] (-3131.192) (-3135.604) * (-3134.961) [-3132.766] (-3134.895) (-3133.415) -- 0:02:37 186500 -- (-3137.662) (-3135.447) [-3134.675] (-3135.302) * (-3133.601) (-3140.090) (-3138.977) [-3134.267] -- 0:02:37 187000 -- (-3140.895) (-3136.012) [-3139.157] (-3135.225) * (-3134.516) (-3141.610) [-3132.155] (-3131.818) -- 0:02:36 187500 -- (-3142.262) (-3131.925) (-3142.441) [-3135.031] * (-3133.465) (-3135.794) (-3134.103) [-3136.459] -- 0:02:36 188000 -- (-3137.489) (-3135.518) (-3132.577) [-3134.506] * [-3132.720] (-3137.990) (-3140.520) (-3138.113) -- 0:02:35 188500 -- (-3140.919) (-3135.912) [-3130.520] (-3133.343) * (-3131.280) (-3139.652) [-3132.612] (-3134.726) -- 0:02:34 189000 -- (-3145.055) (-3133.426) [-3134.673] (-3134.880) * [-3134.744] (-3135.275) (-3134.371) (-3134.183) -- 0:02:34 189500 -- (-3141.559) [-3137.567] (-3139.489) (-3147.184) * (-3135.416) [-3133.742] (-3135.527) (-3139.651) -- 0:02:33 190000 -- (-3138.721) [-3133.503] (-3137.636) (-3137.560) * (-3135.817) [-3140.345] (-3131.589) (-3136.201) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 190500 -- (-3137.053) [-3132.492] (-3134.259) (-3139.851) * (-3133.492) (-3132.221) (-3136.416) [-3135.462] -- 0:02:37 191000 -- (-3138.668) (-3139.130) [-3134.881] (-3144.208) * (-3134.750) (-3133.690) [-3131.420] (-3140.195) -- 0:02:36 191500 -- (-3135.707) (-3138.053) (-3134.930) [-3128.216] * (-3136.211) [-3132.586] (-3135.470) (-3140.104) -- 0:02:36 192000 -- (-3137.711) [-3132.529] (-3134.372) (-3139.399) * (-3136.038) [-3132.358] (-3137.177) (-3134.172) -- 0:02:35 192500 -- (-3139.151) (-3134.050) [-3132.409] (-3134.535) * (-3134.709) [-3136.832] (-3136.008) (-3132.466) -- 0:02:35 193000 -- [-3132.546] (-3140.061) (-3135.146) (-3135.113) * [-3133.080] (-3134.969) (-3132.880) (-3136.051) -- 0:02:34 193500 -- [-3133.527] (-3136.713) (-3132.045) (-3132.913) * (-3140.679) (-3141.410) (-3137.363) [-3133.089] -- 0:02:34 194000 -- (-3137.627) (-3134.793) [-3134.993] (-3134.070) * [-3139.040] (-3139.019) (-3134.372) (-3136.032) -- 0:02:33 194500 -- [-3136.105] (-3138.145) (-3135.308) (-3139.178) * (-3136.306) (-3136.130) [-3130.345] (-3131.685) -- 0:02:33 195000 -- (-3136.038) (-3140.613) (-3135.588) [-3132.200] * [-3131.040] (-3141.451) (-3142.041) (-3131.066) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 195500 -- (-3140.020) (-3140.559) (-3134.913) [-3133.406] * (-3135.965) (-3143.058) [-3133.089] (-3133.198) -- 0:02:36 196000 -- [-3134.530] (-3133.926) (-3138.531) (-3135.170) * (-3139.789) (-3139.386) (-3140.991) [-3134.994] -- 0:02:35 196500 -- (-3136.149) [-3132.167] (-3135.085) (-3135.035) * (-3147.275) (-3131.112) (-3134.945) [-3134.253] -- 0:02:35 197000 -- (-3137.171) (-3128.635) (-3132.681) [-3138.180] * [-3132.450] (-3132.777) (-3135.757) (-3134.705) -- 0:02:34 197500 -- (-3133.357) (-3139.523) (-3136.280) [-3138.813] * [-3133.493] (-3144.432) (-3139.821) (-3135.428) -- 0:02:34 198000 -- [-3134.199] (-3143.353) (-3139.685) (-3141.667) * (-3138.440) (-3134.457) (-3134.390) [-3132.341] -- 0:02:33 198500 -- (-3134.758) (-3137.433) [-3135.219] (-3143.465) * (-3135.573) (-3133.314) (-3136.188) [-3134.790] -- 0:02:33 199000 -- (-3134.014) (-3139.059) (-3141.776) [-3134.500] * (-3136.484) [-3138.632] (-3136.060) (-3137.192) -- 0:02:32 199500 -- [-3136.582] (-3134.560) (-3132.903) (-3136.519) * (-3140.616) (-3132.214) [-3139.135] (-3133.737) -- 0:02:32 200000 -- (-3132.951) (-3133.722) (-3133.751) [-3134.932] * (-3133.340) (-3135.812) (-3138.239) [-3133.721] -- 0:02:32 Average standard deviation of split frequencies: 0.000000 200500 -- (-3132.764) [-3141.840] (-3133.708) (-3135.939) * (-3132.736) (-3135.892) (-3144.834) [-3138.672] -- 0:02:35 201000 -- (-3136.113) (-3142.417) (-3132.340) [-3129.859] * [-3132.821] (-3132.415) (-3133.867) (-3143.521) -- 0:02:35 201500 -- (-3134.499) (-3136.960) [-3136.492] (-3138.670) * [-3138.258] (-3137.618) (-3132.983) (-3139.061) -- 0:02:34 202000 -- (-3136.774) [-3134.953] (-3131.261) (-3134.362) * (-3134.416) [-3137.813] (-3144.658) (-3134.096) -- 0:02:34 202500 -- (-3133.217) (-3133.552) [-3140.852] (-3142.399) * (-3132.463) [-3135.950] (-3138.248) (-3139.610) -- 0:02:33 203000 -- (-3131.810) (-3136.243) [-3130.313] (-3135.400) * (-3138.305) (-3132.783) [-3140.384] (-3139.096) -- 0:02:33 203500 -- [-3133.277] (-3134.844) (-3136.884) (-3138.367) * (-3131.870) [-3134.531] (-3134.694) (-3140.629) -- 0:02:32 204000 -- (-3140.553) (-3136.694) (-3140.297) [-3137.011] * [-3134.812] (-3133.837) (-3137.261) (-3137.561) -- 0:02:32 204500 -- (-3133.043) [-3133.270] (-3136.494) (-3143.654) * (-3138.719) (-3132.621) (-3134.442) [-3138.845] -- 0:02:31 205000 -- [-3140.952] (-3131.927) (-3139.756) (-3134.626) * (-3135.932) (-3133.833) (-3130.949) [-3131.713] -- 0:02:31 Average standard deviation of split frequencies: 0.000000 205500 -- [-3138.604] (-3133.016) (-3134.892) (-3131.104) * (-3135.285) (-3138.383) [-3132.283] (-3139.425) -- 0:02:34 206000 -- [-3136.794] (-3134.564) (-3138.557) (-3137.024) * [-3135.549] (-3139.102) (-3132.196) (-3136.329) -- 0:02:34 206500 -- (-3134.013) (-3134.020) (-3145.348) [-3136.857] * [-3138.224] (-3131.444) (-3132.890) (-3137.372) -- 0:02:33 207000 -- (-3146.595) (-3137.308) [-3143.145] (-3136.206) * [-3133.023] (-3136.962) (-3133.067) (-3142.840) -- 0:02:33 207500 -- (-3136.310) [-3136.983] (-3132.998) (-3134.339) * [-3135.607] (-3140.235) (-3138.596) (-3133.884) -- 0:02:32 208000 -- (-3134.533) (-3132.467) [-3134.199] (-3135.463) * (-3139.145) (-3130.924) (-3136.009) [-3135.184] -- 0:02:32 208500 -- (-3131.656) (-3136.378) (-3133.013) [-3142.353] * (-3143.214) (-3139.098) (-3137.225) [-3132.251] -- 0:02:31 209000 -- (-3132.317) [-3135.922] (-3139.645) (-3134.142) * (-3137.805) (-3139.802) [-3133.566] (-3132.249) -- 0:02:31 209500 -- (-3142.688) [-3137.117] (-3138.888) (-3137.543) * (-3136.939) (-3137.752) (-3133.801) [-3132.624] -- 0:02:30 210000 -- (-3137.319) (-3135.457) (-3140.807) [-3132.034] * (-3142.394) (-3133.905) (-3135.438) [-3137.299] -- 0:02:30 Average standard deviation of split frequencies: 0.000000 210500 -- (-3136.259) [-3132.484] (-3132.850) (-3137.158) * (-3136.553) (-3134.335) (-3136.396) [-3136.275] -- 0:02:30 211000 -- (-3132.597) [-3133.721] (-3134.168) (-3132.679) * (-3132.916) (-3130.261) (-3136.321) [-3136.776] -- 0:02:33 211500 -- (-3138.933) [-3131.495] (-3142.689) (-3137.063) * (-3138.728) [-3138.350] (-3133.416) (-3139.551) -- 0:02:32 212000 -- (-3132.658) [-3138.023] (-3133.916) (-3140.710) * (-3137.098) (-3133.288) [-3131.708] (-3136.143) -- 0:02:32 212500 -- (-3136.233) (-3139.599) [-3139.047] (-3137.175) * (-3132.169) [-3133.561] (-3140.283) (-3130.031) -- 0:02:31 213000 -- (-3140.816) (-3135.462) [-3131.344] (-3132.052) * (-3134.779) (-3136.444) [-3136.844] (-3132.817) -- 0:02:31 213500 -- (-3138.262) (-3138.710) [-3137.846] (-3137.107) * (-3132.354) (-3135.738) (-3135.482) [-3132.511] -- 0:02:31 214000 -- (-3138.710) (-3146.461) [-3133.085] (-3137.153) * (-3133.483) (-3131.185) [-3137.562] (-3143.220) -- 0:02:30 214500 -- [-3132.722] (-3133.122) (-3139.473) (-3136.084) * [-3138.647] (-3138.110) (-3136.629) (-3137.383) -- 0:02:30 215000 -- [-3133.956] (-3132.970) (-3131.622) (-3131.517) * (-3133.485) [-3135.526] (-3133.001) (-3143.193) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 215500 -- (-3137.709) [-3132.110] (-3138.000) (-3132.751) * [-3140.768] (-3144.058) (-3133.231) (-3142.648) -- 0:02:29 216000 -- (-3141.462) (-3133.047) [-3136.905] (-3137.472) * (-3139.560) (-3140.485) (-3137.293) [-3139.912] -- 0:02:28 216500 -- (-3134.460) [-3134.569] (-3141.542) (-3136.766) * [-3135.218] (-3141.557) (-3132.567) (-3132.929) -- 0:02:31 217000 -- (-3135.466) (-3133.884) [-3140.541] (-3138.879) * (-3133.987) (-3133.578) [-3133.947] (-3137.849) -- 0:02:31 217500 -- [-3134.920] (-3133.000) (-3143.170) (-3133.308) * (-3137.428) [-3140.218] (-3138.472) (-3135.243) -- 0:02:31 218000 -- (-3134.443) (-3139.073) (-3137.264) [-3134.243] * (-3135.251) [-3131.126] (-3138.953) (-3134.695) -- 0:02:30 218500 -- (-3136.863) [-3133.536] (-3134.991) (-3140.639) * [-3132.131] (-3141.707) (-3135.839) (-3141.315) -- 0:02:30 219000 -- (-3133.214) [-3135.998] (-3139.565) (-3138.583) * (-3136.254) (-3137.872) (-3133.442) [-3133.591] -- 0:02:29 219500 -- (-3132.900) (-3138.847) (-3136.819) [-3138.198] * (-3139.381) (-3134.185) [-3137.967] (-3135.631) -- 0:02:29 220000 -- (-3132.478) (-3132.884) [-3131.184] (-3131.059) * (-3133.660) (-3131.962) [-3131.680] (-3140.983) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 220500 -- (-3133.091) (-3132.931) [-3131.960] (-3140.198) * (-3132.470) [-3140.803] (-3132.674) (-3133.615) -- 0:02:28 221000 -- (-3137.204) (-3131.574) [-3130.660] (-3139.456) * [-3137.796] (-3135.536) (-3135.334) (-3135.562) -- 0:02:28 221500 -- [-3133.630] (-3134.869) (-3137.806) (-3136.904) * [-3139.848] (-3136.590) (-3140.754) (-3140.206) -- 0:02:31 222000 -- (-3139.079) [-3135.030] (-3130.181) (-3144.997) * [-3131.416] (-3133.593) (-3139.803) (-3133.724) -- 0:02:30 222500 -- (-3131.047) (-3133.873) (-3137.349) [-3134.077] * [-3130.711] (-3140.522) (-3141.456) (-3134.984) -- 0:02:30 223000 -- (-3136.860) [-3135.122] (-3134.003) (-3136.980) * (-3132.774) (-3135.206) (-3131.009) [-3135.389] -- 0:02:29 223500 -- (-3135.322) (-3132.707) (-3138.020) [-3134.246] * (-3140.516) [-3132.511] (-3137.833) (-3133.853) -- 0:02:29 224000 -- [-3137.226] (-3139.926) (-3131.413) (-3136.088) * (-3141.600) [-3138.401] (-3131.815) (-3133.940) -- 0:02:28 224500 -- (-3129.816) [-3136.899] (-3134.497) (-3134.396) * (-3139.586) [-3138.887] (-3140.125) (-3137.690) -- 0:02:28 225000 -- (-3133.960) (-3131.876) (-3136.458) [-3134.614] * (-3133.794) [-3139.368] (-3134.305) (-3136.339) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 225500 -- (-3137.155) [-3137.399] (-3130.811) (-3137.419) * (-3133.229) (-3145.592) (-3134.133) [-3133.931] -- 0:02:27 226000 -- (-3135.715) (-3146.552) (-3136.246) [-3135.522] * [-3135.243] (-3139.271) (-3138.905) (-3142.714) -- 0:02:27 226500 -- (-3132.215) (-3134.270) [-3132.110] (-3138.107) * [-3138.443] (-3135.341) (-3136.367) (-3141.397) -- 0:02:26 227000 -- [-3135.457] (-3134.013) (-3133.534) (-3136.906) * (-3132.475) [-3132.394] (-3135.101) (-3138.821) -- 0:02:29 227500 -- (-3139.526) (-3138.601) [-3138.754] (-3132.781) * [-3136.216] (-3141.602) (-3137.323) (-3134.574) -- 0:02:29 228000 -- [-3134.687] (-3144.693) (-3132.713) (-3138.014) * (-3139.932) [-3136.968] (-3138.064) (-3136.858) -- 0:02:28 228500 -- (-3134.058) (-3143.070) (-3133.478) [-3133.152] * (-3139.950) (-3135.214) (-3139.492) [-3135.006] -- 0:02:28 229000 -- [-3129.029] (-3131.715) (-3134.221) (-3138.400) * (-3132.789) [-3138.269] (-3133.644) (-3139.367) -- 0:02:28 229500 -- (-3139.846) (-3132.921) [-3136.425] (-3136.515) * (-3141.601) (-3137.144) (-3140.588) [-3132.985] -- 0:02:27 230000 -- (-3137.786) (-3139.820) (-3142.102) [-3135.623] * [-3133.049] (-3132.350) (-3151.975) (-3135.494) -- 0:02:27 Average standard deviation of split frequencies: 0.000000 230500 -- [-3131.672] (-3129.408) (-3135.325) (-3133.397) * [-3137.306] (-3141.699) (-3136.542) (-3133.914) -- 0:02:26 231000 -- (-3135.415) [-3133.162] (-3142.289) (-3135.090) * (-3139.142) (-3138.905) (-3138.354) [-3135.299] -- 0:02:26 231500 -- (-3145.679) (-3132.795) [-3135.780] (-3134.988) * (-3137.382) (-3134.245) [-3133.694] (-3143.507) -- 0:02:26 232000 -- (-3138.961) (-3138.089) (-3138.314) [-3132.654] * (-3142.883) [-3131.660] (-3130.836) (-3132.815) -- 0:02:25 232500 -- [-3134.867] (-3138.487) (-3139.878) (-3135.340) * [-3137.662] (-3136.707) (-3139.339) (-3136.704) -- 0:02:28 233000 -- [-3133.418] (-3132.850) (-3133.985) (-3137.240) * [-3134.120] (-3134.151) (-3134.192) (-3135.002) -- 0:02:28 233500 -- [-3138.383] (-3144.098) (-3132.143) (-3131.884) * [-3135.111] (-3139.679) (-3138.896) (-3134.335) -- 0:02:27 234000 -- (-3135.942) (-3138.335) (-3133.997) [-3131.886] * (-3132.961) [-3133.392] (-3133.467) (-3134.248) -- 0:02:27 234500 -- (-3134.902) [-3138.226] (-3144.984) (-3132.234) * (-3137.907) (-3133.529) (-3136.355) [-3140.551] -- 0:02:26 235000 -- (-3132.675) (-3133.738) [-3131.206] (-3131.361) * (-3132.635) [-3141.253] (-3134.000) (-3138.989) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 235500 -- (-3133.869) (-3134.603) (-3132.345) [-3136.910] * (-3135.081) [-3135.264] (-3131.375) (-3133.577) -- 0:02:26 236000 -- (-3137.857) (-3138.628) [-3132.767] (-3135.459) * [-3139.103] (-3137.066) (-3131.789) (-3131.360) -- 0:02:25 236500 -- (-3139.921) (-3144.611) (-3130.235) [-3132.561] * (-3131.224) (-3133.858) (-3137.862) [-3132.143] -- 0:02:25 237000 -- (-3130.356) [-3132.341] (-3135.538) (-3135.621) * [-3138.464] (-3144.042) (-3132.716) (-3133.483) -- 0:02:24 237500 -- (-3135.727) (-3137.796) (-3140.408) [-3139.477] * (-3132.117) [-3135.840] (-3141.427) (-3136.793) -- 0:02:27 238000 -- [-3132.175] (-3133.827) (-3145.441) (-3135.387) * [-3133.644] (-3137.564) (-3134.128) (-3139.528) -- 0:02:27 238500 -- (-3134.265) [-3140.716] (-3142.780) (-3134.846) * [-3136.635] (-3139.951) (-3137.802) (-3138.293) -- 0:02:26 239000 -- (-3134.434) [-3136.386] (-3138.521) (-3135.467) * [-3134.880] (-3135.638) (-3134.875) (-3144.178) -- 0:02:26 239500 -- [-3131.452] (-3130.924) (-3143.857) (-3139.150) * [-3136.847] (-3141.006) (-3133.481) (-3138.720) -- 0:02:26 240000 -- [-3133.815] (-3138.701) (-3139.872) (-3136.182) * (-3134.771) [-3134.175] (-3131.264) (-3134.500) -- 0:02:25 Average standard deviation of split frequencies: 0.000000 240500 -- (-3141.365) [-3132.953] (-3135.480) (-3132.044) * (-3137.813) [-3136.938] (-3132.777) (-3141.787) -- 0:02:25 241000 -- [-3137.049] (-3137.906) (-3132.571) (-3138.318) * (-3135.765) (-3140.982) [-3133.880] (-3139.094) -- 0:02:24 241500 -- (-3131.665) (-3137.537) (-3136.007) [-3132.926] * [-3131.086] (-3142.452) (-3138.008) (-3140.176) -- 0:02:24 242000 -- (-3138.123) (-3141.273) [-3134.620] (-3136.635) * [-3131.616] (-3141.570) (-3135.394) (-3134.430) -- 0:02:24 242500 -- (-3147.307) [-3140.464] (-3133.181) (-3143.086) * (-3137.738) (-3138.235) [-3133.969] (-3135.423) -- 0:02:23 243000 -- (-3147.348) [-3138.750] (-3133.289) (-3138.314) * (-3136.138) [-3134.348] (-3131.335) (-3137.599) -- 0:02:26 243500 -- (-3138.737) (-3144.684) (-3137.511) [-3139.435] * (-3137.946) [-3135.338] (-3138.632) (-3137.242) -- 0:02:26 244000 -- (-3147.948) (-3132.628) [-3136.934] (-3132.796) * (-3129.793) (-3133.332) (-3134.845) [-3134.717] -- 0:02:25 244500 -- (-3152.637) (-3136.019) [-3133.865] (-3146.106) * (-3131.934) (-3136.908) (-3133.625) [-3138.197] -- 0:02:25 245000 -- (-3146.579) (-3133.539) (-3131.951) [-3135.521] * [-3134.662] (-3138.717) (-3134.150) (-3140.524) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 245500 -- (-3145.735) (-3137.334) (-3132.778) [-3133.159] * (-3141.688) (-3138.713) (-3135.640) [-3132.204] -- 0:02:24 246000 -- (-3135.825) [-3130.003] (-3141.244) (-3132.997) * (-3135.513) (-3138.140) (-3134.072) [-3132.167] -- 0:02:24 246500 -- (-3139.291) (-3134.011) [-3141.092] (-3138.329) * (-3136.987) [-3138.364] (-3136.109) (-3134.642) -- 0:02:23 247000 -- [-3136.338] (-3135.821) (-3137.419) (-3136.058) * (-3141.237) [-3131.401] (-3143.171) (-3132.835) -- 0:02:23 247500 -- (-3143.204) (-3136.044) (-3132.963) [-3134.342] * (-3130.794) [-3131.297] (-3136.366) (-3133.373) -- 0:02:22 248000 -- (-3135.993) [-3132.005] (-3138.813) (-3133.980) * (-3137.612) [-3132.837] (-3131.642) (-3137.450) -- 0:02:25 248500 -- [-3133.945] (-3140.228) (-3136.917) (-3133.012) * (-3133.702) (-3141.569) [-3134.809] (-3137.825) -- 0:02:25 249000 -- (-3135.358) (-3134.357) (-3138.836) [-3134.331] * (-3143.152) (-3134.231) (-3132.735) [-3130.242] -- 0:02:24 249500 -- [-3138.469] (-3138.189) (-3145.356) (-3131.560) * (-3144.718) [-3135.153] (-3132.461) (-3139.199) -- 0:02:24 250000 -- (-3137.482) (-3135.771) (-3146.349) [-3132.190] * (-3147.410) [-3133.448] (-3145.633) (-3135.198) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 250500 -- (-3133.803) (-3133.847) [-3138.098] (-3133.300) * (-3133.925) (-3132.768) (-3136.222) [-3133.031] -- 0:02:23 251000 -- (-3132.095) (-3132.388) (-3141.482) [-3131.362] * (-3140.716) (-3132.772) [-3136.218] (-3132.383) -- 0:02:23 251500 -- (-3133.930) [-3137.170] (-3139.385) (-3140.418) * [-3137.322] (-3141.234) (-3134.365) (-3136.580) -- 0:02:22 252000 -- [-3142.253] (-3136.563) (-3140.855) (-3135.772) * (-3138.630) (-3142.262) (-3148.633) [-3135.031] -- 0:02:22 252500 -- (-3136.998) (-3136.701) (-3134.766) [-3134.454] * [-3136.367] (-3140.864) (-3135.844) (-3137.661) -- 0:02:22 253000 -- (-3138.280) (-3132.785) (-3134.057) [-3131.919] * (-3137.216) (-3134.665) [-3135.835] (-3134.227) -- 0:02:21 253500 -- [-3144.067] (-3131.574) (-3138.405) (-3138.349) * (-3141.430) [-3140.666] (-3136.387) (-3140.634) -- 0:02:24 254000 -- [-3130.585] (-3129.355) (-3140.386) (-3137.977) * (-3136.033) (-3134.609) [-3138.552] (-3137.891) -- 0:02:23 254500 -- (-3132.056) [-3131.661] (-3139.455) (-3138.919) * (-3134.856) [-3134.388] (-3141.691) (-3132.673) -- 0:02:23 255000 -- (-3138.389) [-3135.234] (-3139.317) (-3142.442) * (-3132.737) (-3140.093) (-3131.063) [-3131.618] -- 0:02:23 Average standard deviation of split frequencies: 0.000000 255500 -- [-3136.482] (-3132.951) (-3136.150) (-3134.435) * (-3131.015) (-3136.635) (-3138.784) [-3135.754] -- 0:02:22 256000 -- [-3132.901] (-3133.423) (-3134.596) (-3132.280) * (-3137.886) (-3132.275) (-3138.158) [-3134.060] -- 0:02:22 256500 -- [-3136.095] (-3135.532) (-3133.601) (-3132.198) * (-3146.789) [-3131.566] (-3136.179) (-3138.776) -- 0:02:22 257000 -- (-3132.782) (-3138.537) [-3131.902] (-3139.883) * (-3134.469) [-3131.898] (-3144.792) (-3133.361) -- 0:02:21 257500 -- (-3131.028) [-3135.055] (-3139.118) (-3136.046) * (-3135.496) [-3136.489] (-3136.277) (-3137.790) -- 0:02:21 258000 -- (-3132.932) (-3139.862) (-3133.582) [-3134.162] * (-3137.870) [-3139.020] (-3136.778) (-3135.434) -- 0:02:20 258500 -- (-3135.997) (-3135.011) [-3129.551] (-3135.849) * (-3133.515) [-3132.965] (-3131.919) (-3135.416) -- 0:02:23 259000 -- (-3139.556) (-3139.411) [-3135.730] (-3133.239) * (-3134.542) (-3135.192) [-3132.317] (-3140.389) -- 0:02:23 259500 -- (-3135.804) (-3141.074) [-3133.200] (-3141.010) * (-3134.357) (-3137.015) [-3132.869] (-3136.233) -- 0:02:22 260000 -- (-3134.044) [-3135.853] (-3131.681) (-3136.045) * (-3137.910) (-3137.264) [-3135.722] (-3141.838) -- 0:02:22 Average standard deviation of split frequencies: 0.000000 260500 -- (-3137.908) [-3131.049] (-3139.550) (-3137.417) * (-3133.580) (-3134.485) (-3132.060) [-3139.161] -- 0:02:21 261000 -- (-3135.181) (-3136.194) (-3134.460) [-3136.063] * (-3135.942) (-3135.663) (-3132.764) [-3134.809] -- 0:02:21 261500 -- (-3136.960) (-3133.698) (-3134.594) [-3133.329] * [-3135.313] (-3134.987) (-3136.774) (-3136.738) -- 0:02:21 262000 -- (-3136.120) [-3136.130] (-3139.092) (-3134.864) * (-3134.322) [-3139.481] (-3136.972) (-3133.372) -- 0:02:20 262500 -- (-3136.869) [-3132.329] (-3131.786) (-3136.018) * (-3132.908) [-3130.687] (-3138.979) (-3137.338) -- 0:02:20 263000 -- (-3132.299) (-3137.315) [-3131.595] (-3132.686) * [-3141.711] (-3134.043) (-3133.211) (-3146.407) -- 0:02:20 263500 -- [-3137.095] (-3138.449) (-3135.075) (-3139.148) * [-3133.081] (-3136.513) (-3139.989) (-3150.941) -- 0:02:19 264000 -- (-3139.090) [-3132.544] (-3138.732) (-3135.072) * [-3134.854] (-3134.917) (-3130.325) (-3140.319) -- 0:02:22 264500 -- (-3132.967) (-3133.447) (-3133.585) [-3137.725] * (-3138.374) [-3139.539] (-3138.820) (-3133.970) -- 0:02:21 265000 -- [-3131.008] (-3134.837) (-3133.510) (-3133.402) * (-3133.437) [-3134.905] (-3142.249) (-3132.051) -- 0:02:21 Average standard deviation of split frequencies: 0.000000 265500 -- [-3131.216] (-3141.139) (-3138.102) (-3136.845) * (-3135.930) (-3134.523) (-3134.473) [-3135.070] -- 0:02:21 266000 -- (-3142.834) (-3135.083) (-3131.761) [-3132.591] * (-3142.487) (-3132.807) (-3134.251) [-3132.405] -- 0:02:20 266500 -- (-3137.764) (-3139.011) (-3136.533) [-3134.387] * (-3138.603) [-3141.902] (-3135.328) (-3135.433) -- 0:02:20 267000 -- (-3138.660) (-3132.875) [-3132.459] (-3134.947) * (-3137.371) [-3135.538] (-3133.516) (-3135.281) -- 0:02:20 267500 -- (-3140.768) [-3134.521] (-3136.100) (-3133.898) * (-3144.045) (-3140.787) (-3132.355) [-3139.987] -- 0:02:19 268000 -- (-3135.623) [-3137.537] (-3138.894) (-3132.242) * (-3136.615) (-3136.368) (-3132.181) [-3141.381] -- 0:02:19 268500 -- (-3136.195) [-3136.048] (-3139.994) (-3137.442) * [-3135.120] (-3135.075) (-3135.008) (-3133.260) -- 0:02:18 269000 -- (-3133.831) [-3136.258] (-3139.112) (-3133.941) * [-3137.357] (-3137.230) (-3133.001) (-3137.846) -- 0:02:18 269500 -- (-3131.984) (-3131.493) (-3142.439) [-3132.265] * (-3134.664) (-3138.157) [-3134.478] (-3141.714) -- 0:02:20 270000 -- (-3135.338) [-3134.057] (-3140.836) (-3132.791) * (-3132.061) (-3131.948) [-3132.563] (-3132.026) -- 0:02:20 Average standard deviation of split frequencies: 0.000000 270500 -- [-3136.367] (-3134.843) (-3138.968) (-3132.903) * (-3132.140) (-3134.674) [-3136.368] (-3130.135) -- 0:02:20 271000 -- (-3133.015) (-3134.155) [-3137.232] (-3138.793) * (-3131.393) [-3133.822] (-3138.036) (-3134.621) -- 0:02:19 271500 -- [-3134.414] (-3137.684) (-3142.812) (-3137.079) * [-3132.273] (-3135.569) (-3132.532) (-3130.733) -- 0:02:19 272000 -- (-3140.999) (-3135.151) [-3133.465] (-3137.653) * (-3132.018) (-3136.664) (-3139.241) [-3136.893] -- 0:02:19 272500 -- (-3136.005) [-3134.294] (-3136.006) (-3139.139) * (-3137.146) (-3131.663) (-3131.553) [-3136.519] -- 0:02:18 273000 -- (-3136.350) (-3131.890) (-3131.161) [-3135.757] * (-3142.010) [-3131.155] (-3136.389) (-3133.802) -- 0:02:18 273500 -- [-3135.760] (-3138.577) (-3135.147) (-3133.003) * (-3140.146) (-3136.654) [-3135.702] (-3136.001) -- 0:02:18 274000 -- [-3133.270] (-3151.708) (-3134.254) (-3138.596) * (-3137.957) (-3134.819) (-3139.821) [-3137.645] -- 0:02:17 274500 -- [-3132.963] (-3138.451) (-3135.827) (-3133.238) * (-3140.303) [-3134.019] (-3139.996) (-3136.859) -- 0:02:20 275000 -- (-3136.191) [-3138.847] (-3133.434) (-3142.633) * (-3140.703) (-3132.395) (-3131.782) [-3134.226] -- 0:02:19 Average standard deviation of split frequencies: 0.000000 275500 -- (-3138.878) (-3137.291) [-3138.348] (-3140.107) * (-3134.592) (-3142.146) (-3132.696) [-3138.175] -- 0:02:19 276000 -- [-3135.682] (-3138.175) (-3135.648) (-3137.817) * (-3137.470) (-3142.012) [-3135.285] (-3139.373) -- 0:02:19 276500 -- (-3136.937) (-3133.612) (-3134.990) [-3133.796] * [-3133.909] (-3138.874) (-3137.424) (-3136.939) -- 0:02:18 277000 -- (-3135.807) [-3132.003] (-3134.520) (-3133.670) * (-3144.837) (-3136.868) [-3134.478] (-3131.713) -- 0:02:18 277500 -- (-3142.085) (-3133.424) (-3137.652) [-3140.016] * (-3142.035) [-3134.952] (-3136.208) (-3132.863) -- 0:02:17 278000 -- (-3138.255) (-3138.890) (-3135.398) [-3135.360] * [-3138.255] (-3133.953) (-3135.443) (-3135.983) -- 0:02:17 278500 -- (-3140.036) (-3133.170) [-3142.640] (-3138.723) * (-3138.951) (-3148.866) (-3135.389) [-3131.869] -- 0:02:17 279000 -- (-3137.109) [-3138.212] (-3140.885) (-3135.964) * (-3146.616) (-3133.042) [-3129.626] (-3138.513) -- 0:02:16 279500 -- [-3133.010] (-3138.259) (-3135.773) (-3135.925) * [-3138.764] (-3135.004) (-3132.609) (-3134.486) -- 0:02:16 280000 -- (-3132.160) (-3136.551) (-3135.643) [-3139.266] * (-3133.896) (-3134.528) [-3135.331] (-3138.248) -- 0:02:18 Average standard deviation of split frequencies: 0.000000 280500 -- (-3141.231) (-3139.414) [-3131.689] (-3140.733) * [-3135.800] (-3131.577) (-3136.358) (-3132.509) -- 0:02:18 281000 -- (-3143.477) (-3137.663) (-3131.622) [-3133.661] * [-3130.379] (-3132.731) (-3140.257) (-3138.097) -- 0:02:18 281500 -- (-3141.423) (-3143.518) [-3135.495] (-3132.547) * (-3137.071) (-3137.439) [-3132.949] (-3136.369) -- 0:02:17 282000 -- (-3137.436) (-3137.392) [-3134.892] (-3134.160) * (-3135.170) (-3142.142) (-3141.202) [-3134.379] -- 0:02:17 282500 -- (-3131.654) [-3133.465] (-3132.060) (-3140.748) * (-3134.475) [-3133.142] (-3136.919) (-3136.321) -- 0:02:17 283000 -- (-3136.039) (-3138.754) (-3132.211) [-3136.518] * (-3138.064) (-3136.105) [-3135.034] (-3140.773) -- 0:02:16 283500 -- (-3135.211) (-3139.092) [-3138.575] (-3138.841) * (-3143.158) [-3135.781] (-3138.458) (-3142.044) -- 0:02:16 284000 -- [-3133.872] (-3137.437) (-3134.100) (-3131.343) * (-3143.508) [-3128.487] (-3135.908) (-3143.352) -- 0:02:16 284500 -- [-3138.403] (-3134.414) (-3143.342) (-3133.161) * (-3133.292) (-3135.738) [-3140.876] (-3140.288) -- 0:02:15 285000 -- (-3136.478) (-3133.980) (-3137.206) [-3133.030] * [-3137.086] (-3139.579) (-3139.713) (-3142.259) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 285500 -- (-3132.656) (-3134.122) [-3131.690] (-3142.613) * (-3140.541) [-3130.239] (-3131.109) (-3137.284) -- 0:02:17 286000 -- (-3138.610) (-3134.811) [-3132.148] (-3140.731) * [-3131.343] (-3134.136) (-3133.773) (-3134.527) -- 0:02:17 286500 -- [-3133.442] (-3140.077) (-3131.587) (-3136.025) * (-3134.532) (-3134.289) (-3138.410) [-3133.784] -- 0:02:16 287000 -- [-3133.157] (-3134.455) (-3131.912) (-3135.489) * (-3136.127) (-3139.223) [-3136.272] (-3139.427) -- 0:02:16 287500 -- [-3133.701] (-3134.930) (-3131.457) (-3134.604) * (-3134.484) (-3132.809) [-3138.454] (-3136.589) -- 0:02:16 288000 -- (-3140.615) (-3133.459) [-3135.710] (-3131.981) * (-3136.818) [-3136.028] (-3134.906) (-3133.996) -- 0:02:15 288500 -- (-3131.173) (-3132.892) (-3132.484) [-3133.584] * (-3129.059) (-3145.469) (-3130.716) [-3136.547] -- 0:02:15 289000 -- (-3134.489) [-3136.794] (-3135.258) (-3137.973) * (-3131.965) (-3134.731) [-3134.777] (-3138.770) -- 0:02:15 289500 -- (-3136.116) [-3134.342] (-3133.547) (-3135.870) * (-3132.250) (-3138.109) (-3137.583) [-3136.028] -- 0:02:14 290000 -- (-3134.907) [-3142.149] (-3134.783) (-3139.583) * [-3133.656] (-3137.313) (-3142.562) (-3135.437) -- 0:02:14 Average standard deviation of split frequencies: 0.000000 290500 -- (-3135.657) (-3135.247) (-3134.612) [-3135.040] * (-3135.522) (-3135.343) (-3139.064) [-3136.209] -- 0:02:16 291000 -- [-3135.961] (-3134.727) (-3136.647) (-3136.946) * (-3137.328) (-3139.267) [-3136.743] (-3137.273) -- 0:02:16 291500 -- [-3132.766] (-3134.273) (-3133.223) (-3137.256) * (-3135.900) (-3135.376) [-3135.592] (-3140.880) -- 0:02:16 292000 -- (-3139.346) (-3135.195) (-3133.861) [-3135.359] * (-3133.131) (-3133.553) [-3136.609] (-3133.025) -- 0:02:15 292500 -- [-3132.483] (-3137.716) (-3136.427) (-3140.816) * (-3133.678) (-3138.480) (-3133.114) [-3132.762] -- 0:02:15 293000 -- (-3136.787) (-3134.434) (-3135.049) [-3133.419] * (-3133.974) (-3146.428) (-3132.708) [-3139.892] -- 0:02:15 293500 -- (-3150.697) (-3134.879) [-3135.995] (-3137.578) * [-3133.673] (-3140.063) (-3131.441) (-3131.733) -- 0:02:14 294000 -- [-3136.362] (-3136.617) (-3133.886) (-3137.461) * [-3132.420] (-3138.066) (-3133.772) (-3135.602) -- 0:02:14 294500 -- (-3138.670) [-3132.717] (-3136.681) (-3139.482) * (-3139.983) [-3136.347] (-3130.246) (-3134.343) -- 0:02:14 295000 -- (-3131.658) (-3134.688) [-3135.195] (-3140.482) * (-3138.493) [-3136.739] (-3134.306) (-3140.101) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 295500 -- [-3138.180] (-3132.318) (-3144.176) (-3144.120) * (-3137.620) [-3137.563] (-3132.811) (-3139.763) -- 0:02:13 296000 -- [-3140.894] (-3135.559) (-3135.675) (-3133.806) * [-3134.459] (-3137.327) (-3142.953) (-3139.048) -- 0:02:15 296500 -- (-3137.909) (-3142.162) (-3137.678) [-3142.097] * (-3137.807) [-3137.969] (-3135.192) (-3131.440) -- 0:02:15 297000 -- (-3129.995) (-3136.799) [-3131.644] (-3140.561) * (-3135.589) [-3141.030] (-3142.985) (-3129.684) -- 0:02:14 297500 -- (-3137.098) (-3136.338) [-3133.140] (-3136.917) * (-3132.815) (-3135.824) (-3132.432) [-3135.269] -- 0:02:14 298000 -- (-3132.420) (-3132.860) [-3136.898] (-3137.731) * (-3135.022) (-3142.931) (-3131.210) [-3134.732] -- 0:02:14 298500 -- [-3133.426] (-3132.737) (-3130.666) (-3134.223) * (-3142.765) (-3137.915) [-3134.439] (-3134.088) -- 0:02:13 299000 -- (-3140.538) (-3137.050) [-3135.245] (-3143.245) * [-3136.804] (-3133.818) (-3136.360) (-3139.065) -- 0:02:13 299500 -- (-3135.034) [-3134.446] (-3139.152) (-3135.715) * (-3142.391) [-3134.908] (-3138.692) (-3134.009) -- 0:02:13 300000 -- [-3130.983] (-3140.727) (-3138.394) (-3139.025) * (-3133.884) [-3133.737] (-3136.110) (-3136.514) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 300500 -- (-3140.655) (-3143.029) (-3133.888) [-3136.673] * (-3136.470) (-3136.794) [-3132.927] (-3138.532) -- 0:02:12 301000 -- (-3141.889) (-3136.123) (-3137.544) [-3133.274] * (-3133.662) (-3131.935) [-3135.995] (-3138.799) -- 0:02:14 301500 -- (-3138.058) (-3138.076) (-3140.475) [-3137.500] * [-3137.278] (-3132.183) (-3129.695) (-3142.295) -- 0:02:14 302000 -- (-3143.543) (-3137.879) (-3141.065) [-3136.044] * (-3143.501) (-3136.178) (-3139.140) [-3133.296] -- 0:02:14 302500 -- (-3147.168) (-3134.798) (-3137.764) [-3137.241] * (-3132.456) [-3131.337] (-3132.903) (-3139.092) -- 0:02:13 303000 -- (-3138.078) [-3137.099] (-3141.150) (-3139.482) * [-3139.226] (-3136.095) (-3133.989) (-3136.051) -- 0:02:13 303500 -- (-3136.361) (-3134.843) [-3133.732] (-3135.649) * [-3136.326] (-3131.898) (-3136.123) (-3137.490) -- 0:02:13 304000 -- (-3132.704) (-3133.212) (-3136.037) [-3137.613] * (-3132.982) [-3131.354] (-3131.081) (-3138.884) -- 0:02:12 304500 -- (-3131.399) (-3135.317) [-3132.997] (-3141.729) * [-3132.715] (-3133.295) (-3130.590) (-3141.873) -- 0:02:12 305000 -- (-3133.479) [-3132.957] (-3136.164) (-3141.098) * (-3131.993) [-3131.202] (-3135.351) (-3137.505) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 305500 -- [-3137.914] (-3133.455) (-3133.089) (-3135.365) * (-3133.006) (-3138.042) (-3134.109) [-3135.024] -- 0:02:11 306000 -- (-3144.290) [-3135.604] (-3139.921) (-3134.577) * (-3141.153) [-3131.631] (-3132.661) (-3133.000) -- 0:02:11 306500 -- (-3143.096) [-3132.066] (-3137.838) (-3143.688) * (-3134.311) (-3135.087) (-3138.145) [-3135.904] -- 0:02:13 307000 -- (-3136.682) (-3136.703) [-3138.404] (-3138.023) * (-3132.459) (-3133.879) (-3133.360) [-3136.968] -- 0:02:13 307500 -- (-3139.892) (-3139.814) (-3134.148) [-3131.885] * [-3132.364] (-3133.631) (-3132.251) (-3133.908) -- 0:02:12 308000 -- (-3132.454) (-3136.206) [-3137.123] (-3132.309) * (-3136.480) [-3137.707] (-3135.669) (-3131.348) -- 0:02:12 308500 -- [-3137.653] (-3133.301) (-3139.952) (-3133.192) * (-3134.089) (-3135.717) (-3142.835) [-3131.947] -- 0:02:12 309000 -- (-3140.339) (-3130.684) [-3132.208] (-3134.641) * (-3133.591) [-3133.703] (-3132.404) (-3133.683) -- 0:02:11 309500 -- (-3139.223) [-3133.269] (-3139.410) (-3138.181) * [-3138.468] (-3138.099) (-3137.894) (-3133.756) -- 0:02:11 310000 -- (-3143.479) (-3139.580) (-3140.006) [-3135.825] * (-3137.191) (-3136.563) (-3136.785) [-3131.518] -- 0:02:11 Average standard deviation of split frequencies: 0.000000 310500 -- [-3132.327] (-3146.470) (-3144.347) (-3136.568) * (-3136.622) [-3132.178] (-3143.461) (-3135.670) -- 0:02:11 311000 -- (-3132.321) (-3143.143) (-3144.188) [-3135.548] * (-3145.482) (-3134.823) [-3132.133] (-3138.150) -- 0:02:10 311500 -- (-3140.425) (-3137.171) [-3137.592] (-3136.350) * (-3139.655) [-3136.510] (-3132.585) (-3135.246) -- 0:02:10 312000 -- (-3134.346) (-3139.196) (-3134.758) [-3137.910] * (-3131.109) (-3138.832) [-3132.037] (-3138.322) -- 0:02:12 312500 -- [-3136.781] (-3137.236) (-3135.666) (-3135.446) * (-3139.013) [-3131.499] (-3133.307) (-3133.044) -- 0:02:12 313000 -- (-3134.211) [-3135.463] (-3137.513) (-3137.397) * (-3140.946) (-3133.368) [-3135.118] (-3134.353) -- 0:02:11 313500 -- (-3134.028) [-3138.944] (-3134.657) (-3133.971) * (-3138.336) (-3137.259) [-3131.927] (-3138.791) -- 0:02:11 314000 -- (-3139.814) [-3137.407] (-3136.989) (-3131.686) * (-3131.760) (-3138.929) [-3143.208] (-3132.421) -- 0:02:11 314500 -- (-3147.164) (-3141.389) [-3132.550] (-3131.381) * (-3129.068) (-3132.395) [-3133.612] (-3134.524) -- 0:02:10 315000 -- [-3136.454] (-3141.370) (-3134.315) (-3132.011) * (-3133.319) [-3134.477] (-3132.613) (-3133.549) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 315500 -- (-3134.819) (-3139.875) (-3138.545) [-3133.019] * (-3134.864) (-3133.185) [-3131.500] (-3132.626) -- 0:02:10 316000 -- (-3137.015) (-3131.322) [-3132.536] (-3143.855) * (-3139.899) (-3138.124) (-3132.610) [-3133.426] -- 0:02:09 316500 -- (-3141.306) (-3136.072) [-3138.040] (-3134.558) * [-3136.245] (-3143.169) (-3143.063) (-3140.160) -- 0:02:09 317000 -- (-3136.567) [-3131.777] (-3130.556) (-3131.109) * (-3134.733) [-3134.873] (-3145.326) (-3136.803) -- 0:02:11 317500 -- (-3134.212) [-3134.745] (-3137.756) (-3138.720) * (-3132.334) (-3135.879) [-3138.226] (-3135.104) -- 0:02:11 318000 -- [-3133.202] (-3137.568) (-3135.151) (-3138.653) * (-3133.086) [-3132.198] (-3138.034) (-3132.100) -- 0:02:10 318500 -- (-3135.324) [-3133.106] (-3138.533) (-3134.558) * [-3136.916] (-3140.447) (-3142.482) (-3137.237) -- 0:02:10 319000 -- (-3138.234) (-3140.544) [-3134.017] (-3131.030) * [-3135.621] (-3132.582) (-3133.679) (-3139.847) -- 0:02:10 319500 -- (-3140.712) (-3135.270) [-3140.068] (-3134.243) * (-3137.683) (-3135.014) [-3135.789] (-3137.163) -- 0:02:09 320000 -- (-3135.165) [-3133.760] (-3133.134) (-3134.082) * [-3132.788] (-3135.259) (-3140.817) (-3139.711) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 320500 -- [-3137.661] (-3134.080) (-3139.764) (-3139.657) * [-3139.042] (-3136.258) (-3135.964) (-3137.644) -- 0:02:09 321000 -- (-3143.286) [-3134.014] (-3136.655) (-3137.561) * (-3135.027) [-3130.549] (-3133.715) (-3142.006) -- 0:02:09 321500 -- (-3140.056) [-3132.113] (-3133.711) (-3137.824) * [-3137.740] (-3132.994) (-3132.143) (-3137.044) -- 0:02:08 322000 -- [-3136.864] (-3131.855) (-3138.294) (-3132.778) * (-3135.392) (-3138.596) [-3131.871] (-3135.721) -- 0:02:08 322500 -- (-3145.568) (-3138.530) [-3138.291] (-3133.539) * (-3136.174) (-3133.579) (-3131.928) [-3131.841] -- 0:02:10 323000 -- (-3139.521) (-3139.878) [-3133.404] (-3132.068) * (-3135.745) (-3134.666) (-3133.436) [-3135.011] -- 0:02:09 323500 -- (-3134.216) (-3133.989) [-3134.016] (-3133.947) * (-3134.041) (-3133.506) [-3135.503] (-3130.808) -- 0:02:09 324000 -- (-3134.766) (-3142.244) (-3133.192) [-3139.525] * [-3135.049] (-3134.347) (-3135.386) (-3133.173) -- 0:02:09 324500 -- (-3140.957) (-3135.494) (-3132.226) [-3136.635] * (-3134.901) (-3132.179) [-3133.228] (-3132.853) -- 0:02:09 325000 -- (-3136.363) (-3137.071) [-3134.040] (-3137.932) * (-3132.455) [-3133.425] (-3133.506) (-3144.223) -- 0:02:08 Average standard deviation of split frequencies: 0.000000 325500 -- (-3133.901) [-3133.200] (-3137.106) (-3139.714) * (-3133.731) [-3132.725] (-3135.427) (-3137.041) -- 0:02:08 326000 -- (-3128.776) [-3134.271] (-3142.950) (-3136.212) * (-3134.300) (-3132.081) (-3138.232) [-3133.116] -- 0:02:08 326500 -- (-3139.143) [-3138.743] (-3137.778) (-3139.043) * (-3132.498) (-3137.319) (-3134.412) [-3135.512] -- 0:02:07 327000 -- (-3132.720) (-3140.171) (-3131.570) [-3141.976] * (-3135.437) [-3135.143] (-3138.113) (-3135.071) -- 0:02:07 327500 -- (-3133.579) (-3137.692) [-3131.036] (-3134.001) * (-3130.752) (-3135.121) [-3136.602] (-3136.915) -- 0:02:07 328000 -- [-3133.628] (-3135.299) (-3136.947) (-3139.512) * [-3134.153] (-3146.391) (-3140.684) (-3135.988) -- 0:02:09 328500 -- (-3142.454) (-3139.026) (-3134.124) [-3136.291] * (-3139.389) (-3141.880) (-3134.995) [-3136.083] -- 0:02:08 329000 -- (-3136.611) (-3132.964) (-3136.343) [-3139.818] * (-3137.545) (-3136.913) [-3138.788] (-3133.930) -- 0:02:08 329500 -- (-3135.035) (-3136.617) (-3140.436) [-3138.555] * (-3137.060) (-3139.292) (-3140.752) [-3135.392] -- 0:02:08 330000 -- (-3136.463) (-3129.770) (-3136.500) [-3137.967] * [-3133.249] (-3141.199) (-3138.101) (-3136.919) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 330500 -- (-3135.681) (-3134.082) (-3133.650) [-3134.155] * (-3132.659) (-3135.587) (-3136.792) [-3137.125] -- 0:02:07 331000 -- (-3138.243) (-3133.079) [-3135.131] (-3134.235) * (-3135.970) [-3142.727] (-3133.847) (-3134.404) -- 0:02:07 331500 -- (-3136.924) [-3141.049] (-3136.623) (-3131.253) * (-3145.265) (-3140.402) (-3138.266) [-3131.745] -- 0:02:07 332000 -- (-3133.517) [-3131.461] (-3140.630) (-3138.004) * (-3137.908) [-3133.259] (-3140.191) (-3135.366) -- 0:02:06 332500 -- (-3136.261) (-3131.799) (-3136.954) [-3134.938] * [-3135.582] (-3145.641) (-3137.675) (-3132.620) -- 0:02:06 333000 -- [-3136.317] (-3134.519) (-3136.936) (-3134.187) * (-3135.330) [-3133.504] (-3134.987) (-3131.953) -- 0:02:08 333500 -- (-3139.937) (-3129.989) [-3140.436] (-3135.352) * (-3130.883) (-3143.261) (-3140.754) [-3134.212] -- 0:02:07 334000 -- (-3148.736) (-3132.932) (-3142.291) [-3143.298] * (-3133.737) (-3146.736) [-3137.739] (-3133.682) -- 0:02:07 334500 -- (-3136.689) (-3135.873) (-3132.828) [-3134.739] * (-3135.211) [-3146.183] (-3133.134) (-3137.384) -- 0:02:07 335000 -- (-3139.227) [-3137.482] (-3131.784) (-3138.240) * [-3135.756] (-3142.081) (-3134.578) (-3139.235) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 335500 -- (-3136.586) (-3133.922) (-3143.832) [-3138.107] * (-3135.442) (-3142.916) [-3131.862] (-3135.558) -- 0:02:06 336000 -- [-3132.726] (-3132.109) (-3139.990) (-3135.130) * [-3138.441] (-3139.544) (-3141.911) (-3131.426) -- 0:02:06 336500 -- [-3135.112] (-3139.995) (-3144.715) (-3138.868) * (-3134.081) (-3136.227) [-3131.577] (-3137.825) -- 0:02:06 337000 -- (-3137.527) (-3137.363) (-3137.306) [-3132.850] * [-3134.446] (-3133.945) (-3134.677) (-3134.761) -- 0:02:05 337500 -- (-3135.287) [-3134.532] (-3132.415) (-3133.296) * [-3136.949] (-3133.125) (-3135.144) (-3134.587) -- 0:02:05 338000 -- (-3134.316) (-3136.529) [-3138.177] (-3138.428) * (-3135.636) (-3135.761) [-3133.040] (-3135.655) -- 0:02:05 338500 -- (-3139.245) [-3137.629] (-3145.380) (-3132.898) * (-3133.813) (-3135.622) [-3137.364] (-3136.536) -- 0:02:07 339000 -- (-3142.718) [-3136.321] (-3131.350) (-3135.775) * [-3135.682] (-3134.013) (-3135.015) (-3137.650) -- 0:02:06 339500 -- (-3134.665) (-3134.290) (-3134.165) [-3130.535] * (-3133.266) (-3138.403) (-3135.825) [-3145.316] -- 0:02:06 340000 -- (-3131.038) [-3133.834] (-3140.445) (-3132.074) * (-3134.014) (-3138.269) [-3134.500] (-3148.659) -- 0:02:06 Average standard deviation of split frequencies: 0.000000 340500 -- (-3132.434) (-3133.809) (-3139.815) [-3138.448] * (-3133.900) [-3138.101] (-3136.229) (-3140.353) -- 0:02:05 341000 -- (-3136.369) (-3131.726) [-3136.012] (-3142.014) * (-3140.699) (-3131.164) [-3138.001] (-3146.793) -- 0:02:05 341500 -- [-3139.108] (-3139.875) (-3137.870) (-3134.629) * (-3139.266) [-3136.333] (-3135.792) (-3141.526) -- 0:02:05 342000 -- (-3143.624) (-3134.380) [-3134.051] (-3145.543) * (-3135.639) (-3136.188) [-3137.982] (-3133.481) -- 0:02:05 342500 -- (-3144.813) (-3138.133) (-3136.980) [-3136.142] * (-3128.691) (-3142.368) (-3133.658) [-3136.092] -- 0:02:04 343000 -- (-3140.995) (-3136.800) [-3132.143] (-3134.596) * (-3132.368) (-3141.193) (-3132.773) [-3131.669] -- 0:02:04 343500 -- (-3137.675) (-3132.931) [-3130.977] (-3131.486) * [-3134.375] (-3137.022) (-3135.451) (-3133.038) -- 0:02:06 344000 -- (-3131.474) (-3139.633) [-3136.583] (-3131.078) * (-3131.867) [-3135.410] (-3133.951) (-3137.549) -- 0:02:05 344500 -- (-3134.197) (-3140.572) [-3138.772] (-3133.829) * (-3135.641) (-3134.795) (-3139.626) [-3136.045] -- 0:02:05 345000 -- (-3143.806) (-3133.455) (-3133.485) [-3137.955] * (-3131.806) (-3134.250) [-3137.093] (-3136.116) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 345500 -- (-3134.377) (-3138.815) (-3133.634) [-3135.408] * (-3143.108) [-3131.227] (-3139.753) (-3150.752) -- 0:02:05 346000 -- (-3138.553) (-3139.613) [-3137.531] (-3137.885) * (-3139.284) (-3139.815) (-3134.247) [-3136.970] -- 0:02:04 346500 -- (-3140.608) (-3134.177) [-3138.195] (-3137.158) * (-3137.456) (-3136.739) (-3130.559) [-3137.019] -- 0:02:04 347000 -- (-3138.704) [-3140.054] (-3131.693) (-3141.201) * [-3133.475] (-3137.803) (-3138.681) (-3134.187) -- 0:02:04 347500 -- (-3137.824) (-3131.395) (-3133.202) [-3136.686] * (-3134.828) (-3137.422) (-3137.275) [-3130.471] -- 0:02:03 348000 -- (-3133.888) [-3136.029] (-3138.445) (-3133.969) * (-3144.306) (-3133.686) (-3135.279) [-3139.650] -- 0:02:03 348500 -- [-3139.296] (-3138.863) (-3138.158) (-3134.077) * (-3135.630) [-3134.300] (-3142.034) (-3134.912) -- 0:02:03 349000 -- (-3133.791) (-3135.508) [-3130.141] (-3136.871) * (-3132.392) (-3134.730) (-3136.262) [-3134.790] -- 0:02:04 349500 -- (-3133.008) (-3135.807) [-3136.426] (-3133.738) * (-3137.219) (-3132.246) (-3134.420) [-3136.299] -- 0:02:04 350000 -- (-3137.215) (-3143.564) (-3133.839) [-3135.520] * (-3146.254) (-3135.401) (-3145.956) [-3134.483] -- 0:02:04 Average standard deviation of split frequencies: 0.000000 350500 -- (-3135.258) (-3137.096) [-3133.042] (-3134.148) * (-3140.366) (-3138.028) (-3134.291) [-3132.968] -- 0:02:04 351000 -- (-3131.663) (-3139.492) [-3134.191] (-3136.011) * (-3137.180) (-3139.435) (-3133.510) [-3135.528] -- 0:02:03 351500 -- (-3138.388) (-3133.971) [-3136.289] (-3138.920) * (-3133.147) (-3137.307) (-3133.900) [-3130.769] -- 0:02:03 352000 -- (-3138.691) [-3132.513] (-3134.582) (-3145.560) * (-3133.271) [-3142.647] (-3133.438) (-3134.017) -- 0:02:03 352500 -- (-3138.685) [-3137.678] (-3136.924) (-3149.753) * [-3131.269] (-3140.646) (-3134.820) (-3138.978) -- 0:02:03 353000 -- (-3143.102) [-3139.303] (-3132.968) (-3146.306) * [-3132.358] (-3134.430) (-3135.257) (-3142.269) -- 0:02:02 353500 -- (-3139.423) (-3134.409) [-3137.217] (-3136.160) * [-3134.536] (-3135.538) (-3136.195) (-3141.124) -- 0:02:02 354000 -- (-3142.358) (-3137.462) (-3132.961) [-3132.220] * (-3138.431) [-3132.455] (-3136.314) (-3136.620) -- 0:02:02 354500 -- (-3135.713) (-3136.148) (-3139.793) [-3135.136] * (-3134.269) (-3130.801) (-3135.911) [-3138.572] -- 0:02:03 355000 -- (-3135.353) (-3138.026) [-3135.586] (-3133.705) * [-3135.799] (-3133.389) (-3133.390) (-3143.001) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 355500 -- (-3135.722) (-3133.572) [-3135.025] (-3132.771) * (-3141.618) (-3130.946) [-3135.805] (-3143.062) -- 0:02:03 356000 -- (-3139.518) (-3137.597) [-3133.595] (-3139.127) * (-3135.882) [-3131.692] (-3134.424) (-3145.118) -- 0:02:03 356500 -- (-3138.404) (-3131.800) [-3136.515] (-3131.718) * (-3143.658) (-3144.450) [-3133.385] (-3139.511) -- 0:02:02 357000 -- (-3133.159) [-3133.241] (-3134.246) (-3134.236) * (-3139.925) (-3135.437) [-3133.372] (-3134.593) -- 0:02:02 357500 -- (-3137.625) (-3133.131) [-3140.204] (-3134.132) * (-3135.765) (-3141.960) [-3133.404] (-3140.590) -- 0:02:02 358000 -- [-3135.828] (-3133.338) (-3135.624) (-3137.481) * (-3134.200) (-3136.233) (-3133.594) [-3133.109] -- 0:02:01 358500 -- (-3131.287) (-3138.454) [-3137.113] (-3135.652) * [-3135.258] (-3142.170) (-3136.052) (-3135.395) -- 0:02:01 359000 -- (-3130.715) (-3133.973) (-3135.884) [-3141.494] * [-3132.195] (-3140.321) (-3138.528) (-3134.350) -- 0:02:01 359500 -- (-3132.952) (-3132.838) [-3131.076] (-3137.785) * [-3134.748] (-3142.038) (-3134.032) (-3135.371) -- 0:02:02 360000 -- [-3131.680] (-3132.005) (-3139.359) (-3140.998) * (-3143.351) (-3135.397) [-3132.738] (-3139.600) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 360500 -- (-3132.936) (-3137.979) [-3138.448] (-3142.805) * (-3136.544) (-3133.247) [-3132.925] (-3136.689) -- 0:02:02 361000 -- (-3137.969) (-3135.175) [-3133.534] (-3133.156) * [-3136.699] (-3138.092) (-3135.164) (-3138.102) -- 0:02:02 361500 -- (-3144.110) [-3133.376] (-3135.072) (-3135.056) * (-3137.975) (-3144.571) (-3133.870) [-3133.993] -- 0:02:01 362000 -- (-3135.898) [-3137.032] (-3135.203) (-3134.467) * (-3137.147) (-3137.081) (-3144.903) [-3135.695] -- 0:02:01 362500 -- (-3133.934) (-3137.338) [-3133.689] (-3134.854) * (-3137.583) (-3134.674) [-3135.376] (-3145.004) -- 0:02:01 363000 -- (-3135.778) (-3141.226) (-3139.481) [-3136.570] * [-3134.052] (-3133.885) (-3146.875) (-3133.090) -- 0:02:01 363500 -- [-3138.367] (-3132.861) (-3136.646) (-3144.087) * [-3142.581] (-3133.566) (-3133.669) (-3135.294) -- 0:02:00 364000 -- [-3133.466] (-3140.383) (-3142.809) (-3139.677) * (-3134.237) [-3134.171] (-3136.480) (-3133.104) -- 0:02:00 364500 -- [-3137.332] (-3138.127) (-3137.269) (-3136.704) * (-3139.879) (-3134.301) [-3136.637] (-3135.605) -- 0:02:00 365000 -- [-3132.236] (-3135.515) (-3143.170) (-3137.177) * [-3134.513] (-3137.880) (-3135.046) (-3133.267) -- 0:02:01 Average standard deviation of split frequencies: 0.000000 365500 -- (-3134.182) [-3133.137] (-3131.103) (-3139.129) * (-3135.660) (-3139.667) (-3134.511) [-3131.665] -- 0:02:01 366000 -- (-3137.876) (-3139.313) [-3133.744] (-3137.346) * [-3134.494] (-3134.355) (-3132.835) (-3134.531) -- 0:02:01 366500 -- (-3142.741) (-3152.506) [-3135.892] (-3133.836) * [-3134.139] (-3132.528) (-3132.334) (-3141.012) -- 0:02:00 367000 -- (-3138.797) (-3137.953) [-3139.383] (-3139.803) * (-3133.198) (-3135.561) (-3136.577) [-3132.960] -- 0:02:00 367500 -- (-3135.985) [-3133.173] (-3134.261) (-3131.723) * [-3144.513] (-3135.678) (-3130.513) (-3130.890) -- 0:02:00 368000 -- [-3131.191] (-3134.433) (-3147.730) (-3133.665) * (-3141.931) (-3132.311) (-3133.196) [-3130.013] -- 0:02:00 368500 -- (-3139.812) (-3135.399) (-3137.646) [-3137.000] * (-3135.676) (-3133.181) (-3136.649) [-3137.207] -- 0:01:59 369000 -- (-3137.695) (-3140.840) (-3135.832) [-3132.699] * [-3133.793] (-3140.883) (-3136.730) (-3138.129) -- 0:01:59 369500 -- (-3134.391) [-3133.286] (-3136.337) (-3136.022) * (-3135.300) (-3143.639) (-3138.520) [-3137.973] -- 0:01:59 370000 -- (-3139.949) (-3140.060) (-3141.485) [-3134.800] * (-3137.188) [-3140.824] (-3138.957) (-3133.370) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 370500 -- [-3134.357] (-3134.585) (-3139.378) (-3138.640) * [-3138.271] (-3144.223) (-3133.319) (-3143.112) -- 0:02:00 371000 -- (-3134.427) (-3137.070) [-3133.043] (-3133.656) * [-3133.770] (-3143.144) (-3135.609) (-3137.215) -- 0:02:00 371500 -- [-3137.974] (-3138.807) (-3135.717) (-3133.519) * (-3133.183) (-3137.523) (-3133.119) [-3132.258] -- 0:02:00 372000 -- (-3133.762) (-3138.431) (-3135.213) [-3131.552] * (-3133.701) [-3138.537] (-3137.031) (-3133.389) -- 0:01:59 372500 -- [-3133.662] (-3134.695) (-3135.311) (-3132.051) * (-3131.294) [-3134.946] (-3135.205) (-3135.013) -- 0:01:59 373000 -- (-3134.523) (-3140.835) (-3131.381) [-3137.224] * (-3136.152) (-3141.362) [-3134.714] (-3132.495) -- 0:01:59 373500 -- [-3140.220] (-3135.461) (-3136.327) (-3139.258) * (-3135.031) (-3140.556) [-3135.832] (-3133.309) -- 0:01:59 374000 -- (-3133.978) [-3144.599] (-3132.356) (-3140.427) * (-3136.234) (-3133.910) (-3138.561) [-3136.537] -- 0:01:58 374500 -- (-3134.444) (-3133.498) (-3136.438) [-3131.847] * [-3136.994] (-3133.159) (-3136.019) (-3138.948) -- 0:01:58 375000 -- (-3135.553) (-3129.967) [-3135.242] (-3133.231) * [-3135.147] (-3137.864) (-3143.711) (-3132.002) -- 0:01:58 Average standard deviation of split frequencies: 0.000000 375500 -- (-3133.718) (-3142.417) [-3131.168] (-3131.502) * (-3133.535) (-3135.681) [-3134.221] (-3134.620) -- 0:01:59 376000 -- [-3129.733] (-3133.903) (-3137.234) (-3133.357) * (-3134.297) (-3132.865) [-3134.772] (-3133.320) -- 0:01:59 376500 -- (-3135.918) (-3137.990) (-3136.112) [-3137.619] * (-3131.783) [-3132.556] (-3136.840) (-3143.288) -- 0:01:59 377000 -- (-3136.345) (-3137.569) [-3136.841] (-3135.715) * [-3134.801] (-3142.223) (-3138.968) (-3136.637) -- 0:01:58 377500 -- (-3138.028) (-3138.488) [-3132.651] (-3136.967) * (-3134.481) (-3137.264) [-3140.284] (-3136.932) -- 0:01:58 378000 -- [-3131.847] (-3141.635) (-3137.540) (-3136.470) * [-3132.495] (-3133.947) (-3133.089) (-3137.415) -- 0:01:58 378500 -- [-3132.253] (-3136.063) (-3139.510) (-3131.354) * (-3136.616) (-3135.723) (-3133.949) [-3131.886] -- 0:01:58 379000 -- [-3132.308] (-3138.813) (-3135.350) (-3137.133) * (-3134.182) [-3130.743] (-3136.523) (-3134.026) -- 0:01:57 379500 -- (-3131.568) (-3137.434) (-3131.234) [-3138.807] * (-3135.484) [-3130.897] (-3143.475) (-3135.676) -- 0:01:57 380000 -- [-3129.794] (-3139.897) (-3134.831) (-3139.513) * [-3134.437] (-3131.875) (-3138.465) (-3144.291) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 380500 -- (-3135.142) (-3137.286) (-3134.712) [-3134.491] * (-3136.693) [-3132.428] (-3138.907) (-3142.455) -- 0:01:57 381000 -- (-3134.069) (-3136.470) (-3135.107) [-3137.485] * [-3137.092] (-3133.653) (-3137.398) (-3144.198) -- 0:01:58 381500 -- (-3136.700) (-3135.410) [-3133.038] (-3138.406) * [-3140.273] (-3132.154) (-3143.071) (-3137.853) -- 0:01:58 382000 -- (-3132.845) (-3138.447) (-3134.133) [-3137.624] * (-3139.618) (-3130.374) (-3138.051) [-3130.507] -- 0:01:58 382500 -- (-3139.361) [-3133.182] (-3132.439) (-3137.139) * (-3133.277) (-3134.416) (-3137.700) [-3135.382] -- 0:01:57 383000 -- [-3134.815] (-3138.217) (-3130.954) (-3133.928) * (-3139.495) (-3141.092) [-3134.187] (-3133.614) -- 0:01:57 383500 -- (-3136.030) (-3132.456) (-3138.102) [-3138.584] * (-3133.401) (-3137.700) (-3131.550) [-3132.932] -- 0:01:57 384000 -- [-3133.307] (-3136.884) (-3139.866) (-3136.223) * [-3132.784] (-3133.013) (-3130.450) (-3134.269) -- 0:01:57 384500 -- (-3133.920) [-3133.489] (-3137.131) (-3134.735) * (-3143.613) (-3133.647) [-3132.480] (-3135.312) -- 0:01:56 385000 -- (-3135.104) [-3135.786] (-3135.513) (-3133.666) * [-3138.273] (-3138.776) (-3133.945) (-3134.249) -- 0:01:56 Average standard deviation of split frequencies: 0.000000 385500 -- (-3147.389) (-3139.029) (-3134.752) [-3134.426] * (-3132.252) (-3133.399) (-3133.673) [-3132.247] -- 0:01:56 386000 -- (-3135.146) [-3135.037] (-3134.420) (-3135.857) * (-3134.072) (-3131.948) [-3133.750] (-3135.209) -- 0:01:57 386500 -- (-3135.573) (-3137.849) [-3134.483] (-3135.515) * (-3134.767) (-3135.432) (-3133.794) [-3131.275] -- 0:01:57 387000 -- (-3142.130) (-3130.670) [-3131.931] (-3133.840) * [-3137.287] (-3134.626) (-3132.762) (-3139.627) -- 0:01:57 387500 -- [-3136.241] (-3135.160) (-3137.395) (-3146.680) * (-3136.619) [-3136.368] (-3143.327) (-3138.792) -- 0:01:56 388000 -- (-3135.049) [-3129.572] (-3133.588) (-3133.431) * (-3140.404) [-3133.714] (-3136.271) (-3133.965) -- 0:01:56 388500 -- (-3136.063) (-3137.731) [-3139.490] (-3136.054) * (-3137.080) (-3134.235) [-3137.190] (-3142.206) -- 0:01:56 389000 -- (-3133.440) [-3138.900] (-3139.520) (-3139.608) * [-3135.499] (-3136.939) (-3132.603) (-3142.023) -- 0:01:56 389500 -- [-3132.147] (-3139.003) (-3134.499) (-3136.249) * (-3138.656) [-3134.857] (-3135.532) (-3145.757) -- 0:01:55 390000 -- (-3133.206) (-3138.023) (-3131.919) [-3135.246] * (-3139.310) (-3143.018) [-3133.746] (-3134.562) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 390500 -- [-3136.619] (-3138.044) (-3135.823) (-3140.925) * (-3136.337) (-3136.088) (-3137.446) [-3133.374] -- 0:01:55 391000 -- [-3134.158] (-3135.910) (-3135.756) (-3137.620) * (-3136.397) (-3139.234) [-3135.867] (-3132.474) -- 0:01:55 391500 -- (-3135.998) (-3133.983) [-3133.428] (-3140.226) * (-3139.679) [-3133.912] (-3139.894) (-3137.637) -- 0:01:56 392000 -- (-3138.702) (-3137.015) [-3132.789] (-3141.438) * (-3132.936) (-3137.337) (-3135.070) [-3132.370] -- 0:01:56 392500 -- [-3135.751] (-3133.038) (-3132.737) (-3137.167) * (-3139.714) (-3133.895) (-3132.306) [-3134.388] -- 0:01:56 393000 -- (-3134.676) (-3133.890) (-3147.747) [-3132.760] * (-3132.599) (-3136.744) (-3138.620) [-3136.718] -- 0:01:55 393500 -- (-3136.627) [-3136.426] (-3141.346) (-3136.228) * (-3133.420) (-3137.240) [-3136.551] (-3136.435) -- 0:01:55 394000 -- (-3135.885) [-3139.422] (-3140.714) (-3135.906) * (-3133.282) (-3136.037) (-3135.813) [-3129.175] -- 0:01:55 394500 -- (-3136.090) (-3140.542) (-3138.773) [-3137.585] * (-3134.942) [-3131.043] (-3134.667) (-3136.992) -- 0:01:55 395000 -- [-3141.577] (-3140.063) (-3134.575) (-3141.166) * [-3131.144] (-3137.566) (-3142.702) (-3133.844) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 395500 -- (-3137.854) [-3132.043] (-3138.199) (-3139.451) * (-3130.138) [-3138.463] (-3142.770) (-3136.866) -- 0:01:54 396000 -- (-3137.787) [-3138.525] (-3136.049) (-3145.958) * (-3130.217) (-3134.459) [-3133.992] (-3138.975) -- 0:01:54 396500 -- (-3132.465) (-3138.768) (-3138.984) [-3139.697] * (-3140.387) [-3136.851] (-3135.880) (-3140.478) -- 0:01:55 397000 -- [-3129.574] (-3135.303) (-3138.770) (-3133.438) * (-3137.353) (-3139.144) [-3141.470] (-3138.219) -- 0:01:55 397500 -- (-3134.937) (-3132.109) [-3140.037] (-3132.265) * (-3139.429) (-3137.761) (-3134.441) [-3131.017] -- 0:01:55 398000 -- (-3138.353) (-3135.325) (-3134.112) [-3133.598] * (-3133.038) (-3147.599) [-3131.077] (-3139.841) -- 0:01:54 398500 -- (-3139.071) (-3134.778) (-3132.724) [-3133.569] * (-3138.234) (-3134.406) (-3142.090) [-3138.994] -- 0:01:54 399000 -- (-3139.679) [-3139.354] (-3132.549) (-3129.809) * (-3135.995) (-3135.810) [-3133.436] (-3133.907) -- 0:01:54 399500 -- [-3132.185] (-3137.340) (-3133.675) (-3135.543) * [-3132.923] (-3134.978) (-3137.719) (-3135.563) -- 0:01:54 400000 -- (-3134.907) [-3134.795] (-3135.656) (-3135.451) * (-3137.855) (-3131.296) [-3136.443] (-3135.212) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 400500 -- (-3142.656) (-3146.249) (-3134.985) [-3136.192] * (-3137.632) [-3133.548] (-3133.202) (-3137.957) -- 0:01:53 401000 -- [-3140.178] (-3132.030) (-3134.925) (-3135.321) * (-3136.338) [-3133.325] (-3132.038) (-3135.991) -- 0:01:53 401500 -- (-3135.459) (-3131.766) (-3142.368) [-3133.106] * [-3135.797] (-3135.109) (-3132.980) (-3131.911) -- 0:01:53 402000 -- [-3137.324] (-3134.351) (-3140.735) (-3133.356) * (-3131.155) (-3141.901) [-3135.043] (-3142.583) -- 0:01:54 402500 -- (-3137.603) (-3135.890) (-3140.147) [-3133.250] * [-3134.729] (-3139.520) (-3135.388) (-3135.657) -- 0:01:54 403000 -- [-3134.128] (-3139.459) (-3138.183) (-3137.638) * (-3137.927) [-3132.527] (-3135.615) (-3133.290) -- 0:01:54 403500 -- (-3135.416) (-3135.251) [-3139.264] (-3136.007) * [-3138.751] (-3134.708) (-3140.884) (-3137.642) -- 0:01:53 404000 -- (-3136.724) [-3135.743] (-3137.749) (-3133.131) * (-3141.845) (-3138.097) [-3132.825] (-3137.047) -- 0:01:53 404500 -- [-3136.639] (-3136.141) (-3137.986) (-3134.491) * (-3137.439) (-3132.121) (-3137.330) [-3132.535] -- 0:01:53 405000 -- (-3140.619) (-3134.172) (-3138.270) [-3134.124] * (-3142.480) (-3141.693) (-3142.183) [-3135.887] -- 0:01:53 Average standard deviation of split frequencies: 0.000000 405500 -- (-3148.857) [-3137.741] (-3136.144) (-3137.593) * (-3140.161) (-3140.692) [-3135.604] (-3132.563) -- 0:01:52 406000 -- (-3137.042) (-3130.749) [-3139.237] (-3135.809) * (-3138.354) (-3136.442) (-3138.363) [-3132.241] -- 0:01:52 406500 -- [-3133.141] (-3138.435) (-3133.151) (-3132.861) * (-3134.354) (-3135.317) (-3129.152) [-3137.521] -- 0:01:52 407000 -- (-3135.786) [-3135.843] (-3138.041) (-3133.347) * (-3135.940) (-3136.076) (-3131.096) [-3131.523] -- 0:01:52 407500 -- (-3133.482) (-3141.271) (-3141.966) [-3138.196] * (-3133.840) (-3136.518) [-3132.339] (-3134.565) -- 0:01:53 408000 -- (-3131.193) (-3135.920) (-3139.296) [-3134.942] * [-3137.597] (-3134.115) (-3132.616) (-3131.135) -- 0:01:53 408500 -- [-3130.404] (-3140.079) (-3138.854) (-3136.385) * (-3139.398) (-3129.822) (-3134.501) [-3134.860] -- 0:01:52 409000 -- [-3132.068] (-3136.487) (-3136.556) (-3135.072) * (-3142.138) (-3137.011) [-3136.882] (-3135.179) -- 0:01:52 409500 -- [-3134.510] (-3137.093) (-3147.893) (-3133.109) * (-3136.570) [-3131.639] (-3133.415) (-3135.354) -- 0:01:52 410000 -- (-3136.209) (-3134.850) (-3132.136) [-3131.373] * [-3132.677] (-3143.985) (-3134.339) (-3135.594) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 410500 -- (-3132.530) [-3132.222] (-3133.264) (-3132.988) * [-3138.332] (-3139.087) (-3132.824) (-3131.515) -- 0:01:52 411000 -- (-3134.990) [-3139.210] (-3132.945) (-3133.023) * [-3139.795] (-3134.883) (-3132.038) (-3129.535) -- 0:01:51 411500 -- [-3135.049] (-3143.633) (-3133.404) (-3133.809) * (-3134.705) (-3132.116) (-3138.772) [-3135.423] -- 0:01:51 412000 -- (-3137.267) [-3134.081] (-3138.445) (-3138.443) * [-3138.255] (-3133.003) (-3139.918) (-3134.335) -- 0:01:51 412500 -- (-3134.179) [-3132.198] (-3135.742) (-3134.892) * (-3138.803) (-3148.197) [-3133.974] (-3140.014) -- 0:01:52 413000 -- [-3135.379] (-3131.079) (-3141.975) (-3140.092) * (-3135.195) [-3136.278] (-3138.158) (-3129.996) -- 0:01:52 413500 -- (-3137.829) [-3137.444] (-3136.162) (-3134.714) * (-3132.269) (-3130.229) (-3138.789) [-3131.792] -- 0:01:52 414000 -- (-3133.932) (-3135.033) (-3137.722) [-3132.008] * [-3133.126] (-3134.460) (-3140.512) (-3130.384) -- 0:01:51 414500 -- (-3132.807) (-3140.439) [-3131.129] (-3132.372) * [-3135.635] (-3136.043) (-3141.767) (-3135.973) -- 0:01:51 415000 -- [-3129.808] (-3134.958) (-3131.440) (-3132.604) * [-3131.469] (-3138.889) (-3137.989) (-3145.063) -- 0:01:51 Average standard deviation of split frequencies: 0.000000 415500 -- (-3134.186) [-3134.329] (-3135.074) (-3132.959) * (-3132.998) (-3134.184) (-3139.318) [-3145.146] -- 0:01:51 416000 -- [-3137.315] (-3134.772) (-3137.681) (-3137.958) * [-3132.861] (-3133.740) (-3133.114) (-3136.854) -- 0:01:50 416500 -- (-3135.902) (-3133.530) [-3134.709] (-3134.350) * (-3134.251) [-3132.739] (-3134.704) (-3138.794) -- 0:01:50 417000 -- (-3138.001) [-3134.367] (-3133.407) (-3134.221) * (-3136.880) (-3134.612) (-3138.446) [-3138.619] -- 0:01:50 417500 -- (-3141.925) [-3133.568] (-3140.629) (-3133.529) * (-3135.380) [-3134.717] (-3135.437) (-3139.037) -- 0:01:50 418000 -- (-3136.348) (-3138.059) [-3130.169] (-3146.192) * [-3131.554] (-3137.250) (-3131.889) (-3133.371) -- 0:01:51 418500 -- (-3132.144) (-3136.719) [-3132.656] (-3140.929) * [-3136.109] (-3134.809) (-3134.802) (-3132.016) -- 0:01:51 419000 -- (-3131.644) (-3130.500) (-3136.998) [-3133.429] * [-3137.914] (-3134.770) (-3134.442) (-3136.869) -- 0:01:50 419500 -- (-3137.757) (-3132.108) [-3137.344] (-3145.199) * [-3139.409] (-3134.820) (-3136.887) (-3132.446) -- 0:01:50 420000 -- (-3133.536) (-3139.140) [-3132.532] (-3141.278) * (-3141.691) (-3136.492) (-3134.821) [-3132.771] -- 0:01:50 Average standard deviation of split frequencies: 0.000000 420500 -- [-3134.585] (-3132.129) (-3134.846) (-3135.073) * (-3134.628) (-3131.866) [-3136.435] (-3134.583) -- 0:01:50 421000 -- [-3135.778] (-3130.976) (-3136.670) (-3140.917) * (-3138.503) (-3134.536) [-3134.541] (-3135.161) -- 0:01:50 421500 -- (-3140.031) [-3130.969] (-3144.316) (-3139.440) * (-3132.859) [-3131.524] (-3135.311) (-3133.970) -- 0:01:49 422000 -- (-3140.819) [-3141.069] (-3139.154) (-3131.880) * (-3140.914) [-3133.152] (-3134.724) (-3134.466) -- 0:01:49 422500 -- (-3132.538) (-3138.466) [-3133.872] (-3133.459) * [-3139.428] (-3136.083) (-3141.488) (-3147.058) -- 0:01:49 423000 -- (-3134.647) (-3135.751) [-3137.907] (-3132.505) * (-3133.261) [-3136.058] (-3142.883) (-3130.265) -- 0:01:49 423500 -- (-3133.717) [-3134.990] (-3136.512) (-3132.354) * (-3136.817) [-3133.144] (-3141.119) (-3136.632) -- 0:01:50 424000 -- (-3134.835) [-3136.435] (-3135.307) (-3137.861) * (-3138.314) (-3142.362) (-3134.518) [-3135.800] -- 0:01:50 424500 -- [-3136.835] (-3136.489) (-3133.672) (-3140.006) * (-3133.598) [-3137.827] (-3137.385) (-3133.992) -- 0:01:49 425000 -- (-3139.170) (-3137.963) [-3136.757] (-3133.803) * (-3136.215) (-3132.437) [-3136.050] (-3134.532) -- 0:01:49 Average standard deviation of split frequencies: 0.000000 425500 -- (-3133.705) [-3137.247] (-3139.650) (-3136.055) * (-3131.242) (-3132.981) [-3133.567] (-3134.772) -- 0:01:49 426000 -- [-3133.334] (-3137.083) (-3139.514) (-3136.213) * [-3131.504] (-3136.916) (-3135.716) (-3131.936) -- 0:01:49 426500 -- (-3143.791) [-3137.228] (-3135.277) (-3142.469) * [-3133.158] (-3136.712) (-3144.673) (-3133.210) -- 0:01:48 427000 -- (-3133.762) (-3140.236) [-3132.266] (-3141.317) * [-3134.171] (-3133.940) (-3136.619) (-3133.700) -- 0:01:48 427500 -- (-3132.589) (-3136.983) [-3130.593] (-3137.699) * (-3132.580) [-3133.534] (-3134.059) (-3143.603) -- 0:01:48 428000 -- (-3132.985) (-3131.756) (-3136.145) [-3139.965] * (-3132.714) (-3138.698) (-3135.616) [-3143.390] -- 0:01:48 428500 -- [-3133.070] (-3137.932) (-3130.776) (-3135.686) * [-3134.651] (-3140.343) (-3132.774) (-3134.476) -- 0:01:49 429000 -- [-3132.457] (-3134.928) (-3132.421) (-3139.313) * (-3140.382) (-3133.505) (-3136.723) [-3133.998] -- 0:01:49 429500 -- (-3141.568) (-3132.935) [-3137.409] (-3139.103) * [-3134.414] (-3129.939) (-3137.933) (-3133.799) -- 0:01:48 430000 -- [-3135.147] (-3136.593) (-3132.776) (-3136.480) * (-3144.722) (-3134.583) (-3130.930) [-3135.091] -- 0:01:48 Average standard deviation of split frequencies: 0.000000 430500 -- (-3134.413) (-3130.768) [-3141.505] (-3134.454) * (-3135.579) (-3133.625) (-3136.720) [-3137.852] -- 0:01:48 431000 -- (-3133.960) [-3132.471] (-3129.857) (-3137.948) * (-3140.698) [-3133.521] (-3134.977) (-3140.480) -- 0:01:48 431500 -- (-3137.895) (-3132.318) (-3136.309) [-3131.381] * (-3135.077) [-3133.849] (-3140.106) (-3136.233) -- 0:01:48 432000 -- [-3140.606] (-3132.868) (-3139.509) (-3136.291) * (-3131.961) (-3140.970) (-3137.324) [-3136.946] -- 0:01:47 432500 -- (-3136.241) [-3135.306] (-3139.551) (-3136.549) * (-3136.196) [-3135.580] (-3134.612) (-3138.348) -- 0:01:47 433000 -- (-3134.236) (-3134.900) (-3148.671) [-3134.525] * (-3133.084) (-3136.717) [-3132.929] (-3136.926) -- 0:01:47 433500 -- (-3134.245) (-3133.393) [-3138.738] (-3143.316) * (-3133.655) (-3131.520) (-3140.081) [-3136.671] -- 0:01:47 434000 -- (-3133.813) [-3133.908] (-3137.462) (-3137.104) * (-3135.876) [-3134.493] (-3133.776) (-3137.380) -- 0:01:48 434500 -- (-3135.351) (-3134.791) [-3133.096] (-3133.982) * (-3147.457) (-3130.947) (-3132.802) [-3133.837] -- 0:01:48 435000 -- (-3132.514) [-3132.761] (-3140.163) (-3134.964) * (-3135.443) (-3134.406) (-3134.084) [-3136.501] -- 0:01:47 Average standard deviation of split frequencies: 0.000000 435500 -- (-3141.775) [-3131.749] (-3134.347) (-3136.382) * [-3134.301] (-3136.994) (-3136.601) (-3136.467) -- 0:01:47 436000 -- (-3140.291) (-3134.649) [-3140.228] (-3133.251) * [-3138.866] (-3132.148) (-3138.920) (-3132.569) -- 0:01:47 436500 -- (-3139.711) [-3138.749] (-3134.896) (-3140.126) * (-3134.805) (-3147.238) [-3135.924] (-3136.565) -- 0:01:47 437000 -- (-3134.826) [-3133.618] (-3136.012) (-3137.104) * (-3138.333) (-3135.512) [-3143.774] (-3135.911) -- 0:01:46 437500 -- [-3135.413] (-3136.906) (-3134.756) (-3131.921) * (-3135.016) (-3130.673) (-3136.006) [-3136.905] -- 0:01:46 438000 -- [-3137.808] (-3138.483) (-3133.018) (-3136.622) * (-3137.012) (-3131.333) [-3134.809] (-3131.942) -- 0:01:46 438500 -- (-3137.376) [-3139.569] (-3138.623) (-3136.942) * (-3134.100) [-3140.509] (-3136.643) (-3136.535) -- 0:01:46 439000 -- (-3135.612) (-3133.943) [-3132.643] (-3134.206) * (-3134.380) (-3140.459) (-3143.347) [-3131.989] -- 0:01:46 439500 -- [-3133.479] (-3131.582) (-3135.422) (-3139.619) * [-3136.261] (-3142.566) (-3136.575) (-3135.714) -- 0:01:47 440000 -- [-3133.227] (-3135.779) (-3139.253) (-3142.088) * (-3133.732) (-3134.075) (-3136.456) [-3130.007] -- 0:01:46 Average standard deviation of split frequencies: 0.000000 440500 -- (-3133.744) [-3136.481] (-3135.021) (-3140.242) * (-3131.057) (-3137.022) [-3132.842] (-3133.210) -- 0:01:46 441000 -- [-3135.024] (-3136.171) (-3140.285) (-3135.224) * (-3133.551) (-3142.228) [-3131.444] (-3134.633) -- 0:01:46 441500 -- (-3140.286) (-3138.945) [-3133.519] (-3140.219) * (-3137.298) (-3138.872) (-3132.931) [-3136.223] -- 0:01:46 442000 -- (-3145.775) (-3134.892) [-3135.511] (-3136.223) * (-3133.649) (-3138.207) [-3134.947] (-3134.552) -- 0:01:46 442500 -- (-3136.218) (-3133.000) (-3136.059) [-3135.135] * (-3136.294) (-3138.188) (-3134.866) [-3138.847] -- 0:01:45 443000 -- (-3140.204) [-3129.857] (-3140.660) (-3134.839) * [-3138.383] (-3136.548) (-3132.129) (-3137.267) -- 0:01:45 443500 -- [-3133.381] (-3133.413) (-3135.962) (-3137.882) * [-3136.054] (-3136.692) (-3134.724) (-3142.758) -- 0:01:45 444000 -- (-3133.056) (-3135.602) (-3142.305) [-3135.449] * (-3132.477) (-3136.692) (-3138.060) [-3133.681] -- 0:01:45 444500 -- [-3138.368] (-3136.699) (-3142.750) (-3129.620) * (-3133.602) (-3132.011) [-3133.507] (-3134.843) -- 0:01:46 445000 -- [-3139.443] (-3132.389) (-3140.630) (-3135.098) * [-3130.992] (-3135.521) (-3135.054) (-3135.800) -- 0:01:46 Average standard deviation of split frequencies: 0.000000 445500 -- (-3134.798) [-3140.754] (-3134.936) (-3134.742) * (-3136.449) (-3136.184) (-3133.978) [-3131.735] -- 0:01:45 446000 -- (-3135.704) (-3135.688) [-3134.204] (-3140.952) * (-3140.893) (-3133.389) (-3139.141) [-3132.613] -- 0:01:45 446500 -- [-3139.379] (-3135.187) (-3132.823) (-3132.594) * (-3138.068) (-3134.759) (-3142.554) [-3139.498] -- 0:01:45 447000 -- [-3132.464] (-3132.807) (-3136.588) (-3133.034) * (-3136.300) (-3137.929) (-3148.335) [-3130.474] -- 0:01:45 447500 -- (-3135.658) (-3140.254) [-3135.135] (-3136.697) * (-3130.376) [-3137.285] (-3144.848) (-3132.330) -- 0:01:44 448000 -- [-3133.246] (-3135.223) (-3138.617) (-3145.316) * [-3136.654] (-3141.252) (-3144.448) (-3140.635) -- 0:01:44 448500 -- (-3136.127) (-3135.496) [-3140.258] (-3140.733) * [-3139.678] (-3141.260) (-3134.205) (-3137.554) -- 0:01:44 449000 -- (-3134.901) (-3133.393) [-3132.001] (-3146.581) * [-3135.757] (-3136.382) (-3148.318) (-3141.423) -- 0:01:44 449500 -- (-3138.886) (-3135.522) (-3139.915) [-3139.222] * [-3138.157] (-3137.769) (-3136.112) (-3137.805) -- 0:01:44 450000 -- (-3135.539) (-3132.561) [-3131.777] (-3135.729) * (-3131.821) [-3138.042] (-3136.044) (-3135.976) -- 0:01:45 Average standard deviation of split frequencies: 0.000000 450500 -- (-3132.753) [-3132.254] (-3131.615) (-3141.115) * (-3133.932) [-3133.472] (-3142.792) (-3132.700) -- 0:01:44 451000 -- [-3133.900] (-3139.355) (-3138.235) (-3136.736) * (-3139.438) (-3135.371) [-3139.957] (-3133.845) -- 0:01:44 451500 -- (-3137.827) [-3139.200] (-3132.976) (-3141.620) * [-3132.062] (-3141.200) (-3132.952) (-3133.822) -- 0:01:44 452000 -- (-3134.599) [-3143.039] (-3135.558) (-3139.468) * [-3134.245] (-3136.892) (-3133.167) (-3138.596) -- 0:01:44 452500 -- (-3133.849) (-3135.367) [-3139.151] (-3131.444) * (-3135.558) (-3132.813) (-3139.962) [-3133.147] -- 0:01:44 453000 -- (-3136.082) [-3135.208] (-3142.631) (-3137.231) * (-3130.982) (-3133.688) (-3132.509) [-3136.602] -- 0:01:43 453500 -- [-3133.931] (-3137.566) (-3132.314) (-3139.235) * (-3135.713) [-3133.440] (-3136.490) (-3138.942) -- 0:01:43 454000 -- (-3134.692) (-3139.122) [-3138.217] (-3145.670) * (-3137.961) (-3134.207) [-3135.605] (-3136.994) -- 0:01:43 454500 -- [-3132.262] (-3134.382) (-3140.387) (-3134.287) * (-3136.120) (-3136.396) [-3136.677] (-3134.358) -- 0:01:43 455000 -- (-3136.002) (-3135.824) (-3141.946) [-3130.936] * [-3132.463] (-3138.552) (-3135.164) (-3133.729) -- 0:01:44 Average standard deviation of split frequencies: 0.000000 455500 -- (-3135.261) (-3134.277) [-3132.774] (-3139.445) * (-3130.717) (-3140.617) [-3138.959] (-3137.385) -- 0:01:43 456000 -- [-3130.824] (-3138.221) (-3137.421) (-3132.089) * (-3132.851) (-3130.920) [-3134.446] (-3133.887) -- 0:01:43 456500 -- (-3135.267) [-3132.214] (-3130.685) (-3136.219) * [-3134.920] (-3135.942) (-3131.141) (-3138.982) -- 0:01:43 457000 -- (-3131.659) [-3134.045] (-3133.968) (-3139.634) * (-3133.549) (-3139.056) [-3133.464] (-3134.391) -- 0:01:43 457500 -- (-3133.000) (-3132.118) [-3133.620] (-3140.175) * [-3131.418] (-3140.035) (-3138.083) (-3139.051) -- 0:01:43 458000 -- (-3138.400) (-3139.032) [-3136.127] (-3132.030) * (-3134.785) (-3135.309) [-3134.017] (-3145.163) -- 0:01:42 458500 -- [-3139.134] (-3133.459) (-3133.307) (-3132.441) * [-3131.399] (-3134.412) (-3135.509) (-3131.180) -- 0:01:42 459000 -- (-3134.740) (-3137.358) [-3134.108] (-3131.403) * [-3131.091] (-3134.634) (-3134.311) (-3141.241) -- 0:01:42 459500 -- (-3132.748) (-3139.620) (-3130.550) [-3130.112] * (-3142.185) (-3135.825) (-3137.214) [-3136.129] -- 0:01:42 460000 -- (-3131.995) (-3138.319) (-3131.535) [-3133.069] * (-3136.540) (-3137.041) [-3135.610] (-3133.059) -- 0:01:42 Average standard deviation of split frequencies: 0.000000 460500 -- (-3134.679) (-3140.463) (-3134.732) [-3141.527] * (-3135.781) (-3136.519) (-3136.437) [-3135.355] -- 0:01:43 461000 -- (-3133.152) (-3136.254) [-3133.808] (-3139.740) * [-3133.111] (-3137.005) (-3134.853) (-3136.420) -- 0:01:42 461500 -- (-3138.383) (-3132.500) [-3135.371] (-3136.034) * (-3135.392) (-3133.577) (-3135.243) [-3136.814] -- 0:01:42 462000 -- (-3136.403) (-3147.091) [-3135.679] (-3135.851) * (-3139.177) (-3134.581) (-3138.706) [-3135.544] -- 0:01:42 462500 -- (-3138.174) (-3133.473) (-3136.642) [-3132.476] * (-3140.061) [-3137.019] (-3134.718) (-3134.235) -- 0:01:42 463000 -- (-3137.581) [-3133.955] (-3142.661) (-3132.091) * [-3131.409] (-3135.907) (-3138.472) (-3136.505) -- 0:01:42 463500 -- (-3132.355) (-3139.765) (-3134.270) [-3135.897] * [-3133.717] (-3131.479) (-3135.287) (-3135.180) -- 0:01:41 464000 -- (-3137.093) (-3132.839) [-3136.900] (-3132.437) * [-3129.182] (-3135.861) (-3140.664) (-3137.287) -- 0:01:41 464500 -- [-3137.461] (-3134.180) (-3134.559) (-3131.768) * (-3135.804) (-3135.685) [-3136.064] (-3136.177) -- 0:01:41 465000 -- (-3143.180) (-3132.870) (-3137.530) [-3134.281] * (-3138.503) (-3136.879) [-3135.197] (-3137.193) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 465500 -- (-3142.543) (-3133.465) (-3132.806) [-3134.275] * [-3135.930] (-3131.305) (-3131.232) (-3134.916) -- 0:01:41 466000 -- (-3136.953) (-3129.156) (-3132.419) [-3132.710] * (-3131.381) (-3130.009) [-3135.062] (-3130.599) -- 0:01:41 466500 -- (-3138.956) (-3139.450) [-3135.770] (-3134.820) * (-3132.901) [-3130.882] (-3139.516) (-3132.466) -- 0:01:41 467000 -- (-3137.196) (-3130.474) (-3136.010) [-3135.951] * (-3134.823) [-3134.355] (-3131.605) (-3132.659) -- 0:01:41 467500 -- (-3140.977) [-3133.495] (-3135.471) (-3133.991) * (-3140.420) (-3138.601) (-3137.363) [-3136.603] -- 0:01:41 468000 -- (-3140.435) (-3138.430) [-3134.098] (-3135.259) * (-3137.792) (-3144.312) [-3132.929] (-3136.030) -- 0:01:41 468500 -- [-3138.212] (-3137.269) (-3136.564) (-3133.126) * (-3138.004) (-3132.994) (-3138.265) [-3138.777] -- 0:01:40 469000 -- (-3135.314) [-3135.991] (-3135.724) (-3132.897) * (-3144.975) (-3139.194) [-3136.104] (-3131.485) -- 0:01:40 469500 -- (-3136.772) (-3141.561) [-3139.346] (-3140.697) * [-3137.224] (-3134.959) (-3136.957) (-3132.277) -- 0:01:40 470000 -- [-3132.951] (-3139.019) (-3136.056) (-3137.573) * [-3133.057] (-3134.359) (-3140.157) (-3135.252) -- 0:01:40 Average standard deviation of split frequencies: 0.000000 470500 -- [-3133.001] (-3130.251) (-3138.032) (-3134.502) * (-3135.475) (-3137.097) [-3133.108] (-3136.962) -- 0:01:40 471000 -- [-3134.974] (-3135.808) (-3133.910) (-3133.510) * [-3135.586] (-3132.816) (-3137.826) (-3135.554) -- 0:01:41 471500 -- (-3141.261) (-3140.160) (-3134.733) [-3129.057] * [-3133.717] (-3137.121) (-3132.746) (-3134.275) -- 0:01:40 472000 -- (-3137.570) (-3143.329) [-3130.457] (-3137.762) * [-3133.783] (-3136.255) (-3147.383) (-3131.996) -- 0:01:40 472500 -- (-3137.209) (-3142.235) (-3136.828) [-3133.343] * [-3132.074] (-3134.199) (-3137.287) (-3142.050) -- 0:01:40 473000 -- [-3134.367] (-3138.759) (-3134.435) (-3135.368) * (-3137.006) (-3136.235) (-3135.038) [-3139.603] -- 0:01:40 473500 -- (-3138.238) (-3135.910) [-3135.009] (-3139.812) * (-3140.024) [-3132.454] (-3134.274) (-3138.960) -- 0:01:40 474000 -- (-3136.534) (-3142.611) [-3130.856] (-3139.458) * [-3134.965] (-3135.826) (-3141.404) (-3138.767) -- 0:01:39 474500 -- (-3137.579) (-3144.866) (-3135.488) [-3133.853] * (-3137.650) [-3138.099] (-3138.613) (-3135.051) -- 0:01:39 475000 -- [-3136.758] (-3131.929) (-3139.747) (-3139.296) * (-3139.041) (-3136.544) (-3132.363) [-3136.184] -- 0:01:39 Average standard deviation of split frequencies: 0.000000 475500 -- (-3132.624) [-3132.337] (-3136.748) (-3135.983) * (-3137.111) (-3135.283) [-3131.948] (-3135.949) -- 0:01:39 476000 -- (-3137.582) (-3133.051) [-3134.693] (-3134.957) * (-3140.078) (-3139.096) [-3135.511] (-3138.029) -- 0:01:39 476500 -- (-3136.931) (-3132.043) (-3138.510) [-3135.011] * (-3137.389) (-3136.464) (-3133.564) [-3132.777] -- 0:01:39 477000 -- (-3134.064) (-3135.265) (-3134.708) [-3134.273] * (-3137.665) (-3139.146) [-3134.865] (-3136.967) -- 0:01:39 477500 -- (-3137.227) (-3134.703) (-3133.289) [-3132.982] * [-3130.869] (-3137.079) (-3144.486) (-3136.281) -- 0:01:39 478000 -- (-3130.147) (-3138.468) (-3134.124) [-3131.245] * (-3133.424) (-3146.892) [-3136.459] (-3136.058) -- 0:01:39 478500 -- [-3137.069] (-3132.709) (-3142.383) (-3151.564) * [-3139.038] (-3142.242) (-3137.265) (-3137.595) -- 0:01:39 479000 -- (-3136.420) (-3136.307) (-3135.258) [-3133.688] * (-3137.403) [-3135.405] (-3139.031) (-3137.673) -- 0:01:38 479500 -- (-3138.215) (-3140.949) [-3133.658] (-3136.061) * (-3133.639) [-3137.073] (-3133.694) (-3138.097) -- 0:01:38 480000 -- (-3136.203) (-3134.464) [-3134.280] (-3132.931) * (-3137.761) [-3133.698] (-3132.642) (-3138.114) -- 0:01:38 Average standard deviation of split frequencies: 0.000000 480500 -- (-3131.650) (-3135.477) [-3139.130] (-3135.706) * (-3134.218) (-3135.240) [-3135.560] (-3132.118) -- 0:01:38 481000 -- (-3136.769) (-3139.614) (-3136.645) [-3133.496] * (-3132.829) (-3136.240) (-3143.707) [-3133.043] -- 0:01:38 481500 -- (-3132.889) (-3134.760) [-3133.699] (-3132.022) * [-3135.800] (-3137.552) (-3134.575) (-3134.150) -- 0:01:39 482000 -- [-3131.616] (-3134.115) (-3132.628) (-3135.672) * (-3132.539) (-3141.782) [-3132.409] (-3138.967) -- 0:01:38 482500 -- (-3132.157) (-3132.716) (-3135.692) [-3135.658] * (-3140.082) (-3136.074) (-3137.617) [-3137.400] -- 0:01:38 483000 -- (-3142.157) [-3133.773] (-3133.558) (-3137.790) * (-3130.719) (-3135.640) (-3135.459) [-3132.200] -- 0:01:38 483500 -- (-3141.329) (-3132.200) (-3133.148) [-3138.500] * [-3137.959] (-3138.479) (-3136.202) (-3136.757) -- 0:01:38 484000 -- (-3132.165) (-3133.863) (-3133.831) [-3134.283] * (-3135.910) (-3142.318) (-3137.291) [-3136.607] -- 0:01:38 484500 -- [-3133.335] (-3134.315) (-3137.301) (-3138.190) * (-3137.719) (-3140.555) [-3139.513] (-3137.745) -- 0:01:37 485000 -- (-3136.072) [-3135.312] (-3140.154) (-3135.752) * [-3134.743] (-3138.734) (-3136.188) (-3139.371) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 485500 -- (-3137.961) [-3134.313] (-3142.589) (-3131.952) * [-3139.419] (-3133.555) (-3135.173) (-3136.167) -- 0:01:37 486000 -- (-3134.840) [-3132.900] (-3135.696) (-3131.690) * (-3141.763) (-3135.218) [-3137.885] (-3134.915) -- 0:01:37 486500 -- (-3135.696) (-3133.477) [-3133.523] (-3134.713) * (-3139.697) (-3146.506) (-3133.002) [-3132.179] -- 0:01:37 487000 -- (-3132.663) [-3133.741] (-3136.464) (-3133.501) * (-3136.552) (-3134.318) [-3134.324] (-3137.819) -- 0:01:37 487500 -- (-3157.200) (-3136.369) (-3140.355) [-3139.418] * (-3139.926) (-3134.968) (-3135.787) [-3136.360] -- 0:01:37 488000 -- (-3137.386) [-3136.843] (-3141.268) (-3139.367) * (-3135.763) [-3134.989] (-3136.495) (-3134.739) -- 0:01:37 488500 -- (-3141.831) (-3133.423) [-3133.513] (-3137.058) * (-3133.571) (-3134.869) [-3132.336] (-3138.006) -- 0:01:37 489000 -- [-3138.368] (-3130.141) (-3137.136) (-3136.527) * [-3134.666] (-3139.717) (-3138.707) (-3135.755) -- 0:01:37 489500 -- (-3135.710) (-3139.612) [-3135.818] (-3138.330) * (-3131.758) (-3132.250) (-3134.618) [-3135.129] -- 0:01:36 490000 -- (-3139.930) [-3134.012] (-3142.020) (-3137.163) * (-3137.513) (-3136.227) [-3133.317] (-3135.565) -- 0:01:36 Average standard deviation of split frequencies: 0.000000 490500 -- (-3141.156) (-3135.101) [-3132.862] (-3143.354) * (-3140.283) [-3133.648] (-3138.443) (-3138.165) -- 0:01:36 491000 -- (-3136.446) [-3136.855] (-3134.569) (-3136.526) * (-3134.520) [-3131.825] (-3140.165) (-3138.624) -- 0:01:36 491500 -- (-3133.998) (-3141.265) (-3131.727) [-3134.630] * [-3131.994] (-3133.217) (-3135.249) (-3137.565) -- 0:01:36 492000 -- (-3146.879) [-3133.739] (-3138.761) (-3137.912) * (-3132.892) (-3134.534) (-3132.792) [-3138.123] -- 0:01:37 492500 -- (-3137.834) (-3133.371) (-3137.498) [-3130.999] * [-3135.979] (-3143.843) (-3136.999) (-3133.879) -- 0:01:36 493000 -- [-3131.977] (-3136.820) (-3130.855) (-3132.959) * (-3141.200) (-3137.987) (-3141.922) [-3131.424] -- 0:01:36 493500 -- (-3133.570) (-3135.839) (-3135.181) [-3135.539] * (-3134.994) [-3134.880] (-3135.006) (-3135.698) -- 0:01:36 494000 -- (-3136.260) (-3139.607) (-3136.457) [-3137.824] * [-3134.470] (-3139.818) (-3131.909) (-3133.884) -- 0:01:36 494500 -- [-3132.971] (-3145.284) (-3131.354) (-3140.289) * (-3139.213) (-3139.182) (-3131.338) [-3132.516] -- 0:01:36 495000 -- (-3136.705) (-3141.693) (-3133.983) [-3137.901] * [-3131.912] (-3141.232) (-3131.836) (-3138.345) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 495500 -- (-3133.152) (-3143.492) [-3132.279] (-3133.736) * [-3138.828] (-3137.554) (-3133.079) (-3134.779) -- 0:01:35 496000 -- (-3131.315) (-3141.359) [-3134.834] (-3136.507) * (-3139.454) [-3134.240] (-3136.467) (-3142.424) -- 0:01:35 496500 -- [-3131.553] (-3135.855) (-3140.959) (-3134.637) * (-3138.643) (-3136.454) [-3134.083] (-3133.734) -- 0:01:35 497000 -- (-3131.461) (-3141.348) [-3133.823] (-3138.360) * (-3132.784) (-3141.812) [-3130.279] (-3135.907) -- 0:01:35 497500 -- [-3134.748] (-3137.973) (-3136.998) (-3135.015) * (-3138.101) (-3133.006) (-3140.247) [-3133.499] -- 0:01:35 498000 -- [-3138.913] (-3139.890) (-3142.174) (-3140.906) * (-3132.339) [-3132.601] (-3130.999) (-3138.741) -- 0:01:35 498500 -- [-3138.299] (-3137.173) (-3138.036) (-3133.072) * (-3135.972) (-3134.053) [-3136.870] (-3136.845) -- 0:01:35 499000 -- (-3141.051) (-3138.746) (-3137.838) [-3137.482] * (-3132.327) [-3133.866] (-3138.574) (-3138.717) -- 0:01:35 499500 -- (-3141.121) (-3137.977) (-3142.057) [-3138.816] * (-3135.790) [-3135.655] (-3131.281) (-3136.154) -- 0:01:35 500000 -- (-3137.900) (-3138.470) (-3139.760) [-3132.557] * [-3132.076] (-3132.659) (-3135.958) (-3136.195) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 500500 -- (-3134.116) (-3136.208) [-3134.550] (-3136.451) * (-3135.224) (-3135.791) [-3131.480] (-3140.865) -- 0:01:34 501000 -- [-3135.169] (-3135.409) (-3135.892) (-3135.289) * [-3137.589] (-3139.863) (-3139.256) (-3134.715) -- 0:01:34 501500 -- (-3140.972) (-3139.412) (-3140.560) [-3134.155] * (-3136.590) (-3138.595) (-3134.892) [-3131.597] -- 0:01:34 502000 -- (-3142.945) (-3133.227) [-3133.878] (-3135.334) * (-3137.266) (-3143.230) [-3135.833] (-3130.797) -- 0:01:34 502500 -- (-3142.180) (-3135.877) [-3131.633] (-3136.835) * (-3139.574) [-3130.650] (-3137.719) (-3135.776) -- 0:01:34 503000 -- (-3146.093) (-3135.913) (-3135.509) [-3130.398] * [-3139.528] (-3141.296) (-3136.403) (-3135.086) -- 0:01:34 503500 -- (-3135.359) (-3135.349) [-3133.194] (-3130.893) * [-3136.227] (-3132.997) (-3139.230) (-3143.124) -- 0:01:34 504000 -- [-3132.888] (-3137.807) (-3131.896) (-3138.292) * (-3140.571) (-3136.513) (-3134.401) [-3143.269] -- 0:01:34 504500 -- (-3130.970) (-3133.889) [-3133.955] (-3143.137) * (-3142.207) (-3136.118) [-3136.181] (-3140.963) -- 0:01:34 505000 -- [-3133.669] (-3139.503) (-3139.723) (-3137.866) * (-3136.431) [-3131.883] (-3133.404) (-3140.852) -- 0:01:34 Average standard deviation of split frequencies: 0.000000 505500 -- (-3135.581) (-3131.009) (-3138.868) [-3131.621] * (-3131.902) [-3136.776] (-3134.916) (-3138.814) -- 0:01:33 506000 -- (-3138.684) [-3132.873] (-3134.813) (-3132.904) * [-3131.402] (-3141.420) (-3132.003) (-3135.511) -- 0:01:33 506500 -- (-3133.307) [-3137.164] (-3135.204) (-3132.725) * (-3138.559) [-3136.646] (-3140.955) (-3133.332) -- 0:01:33 507000 -- [-3139.889] (-3135.394) (-3142.116) (-3137.434) * (-3139.185) (-3133.740) (-3142.933) [-3137.575] -- 0:01:33 507500 -- (-3142.254) (-3135.415) [-3135.420] (-3136.454) * (-3136.094) (-3138.662) [-3138.186] (-3135.350) -- 0:01:33 508000 -- (-3137.120) [-3132.891] (-3136.011) (-3136.031) * (-3132.852) (-3143.117) [-3139.105] (-3135.487) -- 0:01:33 508500 -- (-3137.626) (-3137.415) [-3130.682] (-3135.818) * (-3132.302) (-3134.642) [-3132.542] (-3135.976) -- 0:01:33 509000 -- (-3137.058) (-3141.456) [-3135.012] (-3135.599) * [-3131.751] (-3135.163) (-3140.035) (-3148.595) -- 0:01:33 509500 -- (-3134.791) [-3133.310] (-3137.362) (-3133.680) * (-3131.973) (-3145.209) [-3137.652] (-3135.029) -- 0:01:33 510000 -- [-3134.110] (-3135.244) (-3133.266) (-3136.443) * [-3138.550] (-3138.516) (-3136.137) (-3139.532) -- 0:01:33 Average standard deviation of split frequencies: 0.000000 510500 -- (-3134.399) [-3134.953] (-3138.236) (-3140.737) * (-3133.516) [-3132.191] (-3142.782) (-3136.131) -- 0:01:33 511000 -- (-3138.371) [-3136.548] (-3134.967) (-3138.538) * (-3134.934) [-3134.324] (-3132.319) (-3131.635) -- 0:01:32 511500 -- (-3138.277) (-3138.018) (-3133.185) [-3140.130] * [-3133.807] (-3135.909) (-3141.562) (-3136.422) -- 0:01:32 512000 -- (-3140.766) [-3133.186] (-3133.729) (-3135.300) * [-3132.760] (-3132.615) (-3141.440) (-3134.688) -- 0:01:32 512500 -- [-3132.630] (-3135.117) (-3139.632) (-3134.700) * [-3132.937] (-3139.477) (-3137.588) (-3135.518) -- 0:01:32 513000 -- (-3135.270) [-3137.109] (-3136.382) (-3136.480) * [-3134.102] (-3132.408) (-3130.945) (-3133.842) -- 0:01:32 513500 -- (-3135.918) (-3134.744) [-3134.095] (-3132.986) * [-3133.924] (-3135.523) (-3135.830) (-3134.890) -- 0:01:32 514000 -- [-3132.421] (-3134.733) (-3133.390) (-3134.909) * (-3135.161) [-3131.920] (-3131.831) (-3141.593) -- 0:01:32 514500 -- (-3136.768) (-3134.107) [-3139.519] (-3133.726) * [-3131.634] (-3136.262) (-3139.043) (-3139.087) -- 0:01:32 515000 -- (-3134.120) (-3145.424) [-3139.710] (-3137.108) * (-3134.366) [-3135.303] (-3141.388) (-3132.647) -- 0:01:32 Average standard deviation of split frequencies: 0.000000 515500 -- (-3136.053) [-3135.605] (-3139.140) (-3142.829) * [-3141.562] (-3137.218) (-3142.195) (-3136.353) -- 0:01:32 516000 -- (-3132.272) (-3134.977) [-3139.623] (-3143.354) * (-3137.175) [-3134.729] (-3135.749) (-3140.556) -- 0:01:31 516500 -- [-3135.421] (-3135.683) (-3132.730) (-3135.191) * (-3137.360) (-3136.033) (-3144.453) [-3134.391] -- 0:01:31 517000 -- (-3135.763) (-3140.356) [-3134.600] (-3132.486) * (-3133.900) (-3133.895) [-3134.312] (-3137.222) -- 0:01:31 517500 -- (-3139.313) (-3135.200) (-3141.615) [-3141.469] * [-3135.676] (-3130.535) (-3136.199) (-3131.110) -- 0:01:31 518000 -- (-3139.992) (-3139.553) [-3137.340] (-3135.848) * (-3130.343) [-3135.065] (-3143.814) (-3137.104) -- 0:01:31 518500 -- (-3139.388) (-3131.936) [-3135.542] (-3133.960) * (-3140.613) (-3134.864) (-3139.759) [-3132.687] -- 0:01:31 519000 -- (-3139.108) [-3136.056] (-3136.118) (-3140.000) * (-3139.530) [-3134.548] (-3140.281) (-3134.094) -- 0:01:31 519500 -- (-3145.847) (-3133.618) (-3140.439) [-3131.082] * [-3137.171] (-3139.801) (-3144.318) (-3138.125) -- 0:01:31 520000 -- [-3135.173] (-3134.945) (-3135.509) (-3133.275) * (-3134.785) [-3138.313] (-3136.574) (-3140.410) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 520500 -- (-3137.628) (-3140.008) (-3144.558) [-3132.473] * [-3134.260] (-3137.585) (-3132.632) (-3132.367) -- 0:01:31 521000 -- [-3131.075] (-3137.033) (-3140.201) (-3137.625) * (-3136.063) (-3133.587) [-3135.800] (-3137.061) -- 0:01:31 521500 -- (-3140.175) (-3139.397) [-3131.625] (-3132.553) * (-3134.946) (-3137.383) (-3139.967) [-3141.929] -- 0:01:30 522000 -- (-3135.759) [-3133.563] (-3138.132) (-3134.275) * (-3139.545) (-3134.844) (-3136.391) [-3133.424] -- 0:01:30 522500 -- (-3132.713) (-3133.858) [-3138.817] (-3135.427) * (-3135.859) (-3130.198) [-3136.765] (-3135.013) -- 0:01:30 523000 -- (-3136.426) [-3135.474] (-3141.467) (-3132.460) * (-3137.360) (-3137.394) [-3136.192] (-3133.880) -- 0:01:30 523500 -- (-3139.887) (-3130.692) (-3141.403) [-3131.148] * (-3144.170) (-3133.204) (-3135.481) [-3131.661] -- 0:01:30 524000 -- (-3138.254) [-3129.852] (-3140.790) (-3130.693) * (-3137.147) [-3131.564] (-3139.672) (-3137.365) -- 0:01:30 524500 -- (-3136.462) [-3132.346] (-3139.324) (-3134.032) * (-3130.768) [-3134.565] (-3134.954) (-3137.748) -- 0:01:30 525000 -- (-3135.020) (-3137.373) [-3141.842] (-3135.482) * (-3132.381) [-3134.075] (-3135.718) (-3133.544) -- 0:01:30 Average standard deviation of split frequencies: 0.000000 525500 -- (-3133.218) (-3137.787) [-3132.368] (-3135.760) * (-3134.915) (-3141.290) [-3135.889] (-3132.648) -- 0:01:30 526000 -- (-3143.912) (-3138.262) (-3132.507) [-3133.310] * [-3137.113] (-3133.568) (-3132.891) (-3135.090) -- 0:01:30 526500 -- [-3133.497] (-3135.611) (-3133.700) (-3136.570) * (-3132.557) (-3139.069) [-3137.954] (-3134.537) -- 0:01:29 527000 -- (-3137.193) [-3133.663] (-3138.768) (-3138.778) * (-3135.977) [-3137.977] (-3139.251) (-3135.542) -- 0:01:29 527500 -- (-3139.060) (-3131.991) [-3131.804] (-3135.111) * [-3133.569] (-3132.906) (-3146.445) (-3136.158) -- 0:01:29 528000 -- (-3136.155) (-3141.461) (-3134.453) [-3134.950] * (-3134.108) (-3142.449) [-3136.380] (-3131.548) -- 0:01:29 528500 -- [-3133.927] (-3139.872) (-3133.109) (-3135.757) * [-3136.178] (-3137.459) (-3139.999) (-3135.344) -- 0:01:29 529000 -- (-3131.916) (-3140.985) [-3138.091] (-3132.994) * [-3134.963] (-3139.182) (-3136.346) (-3135.879) -- 0:01:29 529500 -- [-3135.462] (-3134.014) (-3135.406) (-3140.170) * (-3141.999) [-3137.219] (-3135.939) (-3133.446) -- 0:01:29 530000 -- (-3138.912) (-3134.178) (-3133.505) [-3132.067] * (-3134.426) [-3134.493] (-3139.669) (-3133.045) -- 0:01:29 Average standard deviation of split frequencies: 0.000000 530500 -- [-3133.084] (-3138.110) (-3135.400) (-3135.656) * [-3133.590] (-3133.364) (-3140.162) (-3131.656) -- 0:01:29 531000 -- (-3134.881) (-3137.585) (-3135.686) [-3135.528] * (-3132.919) (-3135.559) (-3140.958) [-3135.277] -- 0:01:29 531500 -- (-3133.803) (-3136.670) (-3136.978) [-3136.599] * (-3134.210) [-3134.541] (-3141.618) (-3135.240) -- 0:01:29 532000 -- (-3136.388) (-3133.924) [-3132.067] (-3134.860) * (-3136.593) [-3135.363] (-3139.502) (-3137.788) -- 0:01:28 532500 -- (-3134.297) [-3140.229] (-3134.918) (-3140.113) * [-3138.150] (-3136.456) (-3135.879) (-3138.510) -- 0:01:28 533000 -- [-3130.870] (-3136.622) (-3132.298) (-3141.907) * (-3136.144) [-3136.206] (-3139.385) (-3136.545) -- 0:01:28 533500 -- (-3136.321) [-3136.813] (-3135.310) (-3137.674) * (-3137.886) [-3132.442] (-3134.495) (-3133.700) -- 0:01:28 534000 -- (-3135.092) (-3135.729) (-3133.061) [-3133.429] * (-3133.481) [-3135.064] (-3137.543) (-3137.975) -- 0:01:28 534500 -- [-3134.799] (-3134.748) (-3136.830) (-3137.291) * [-3132.229] (-3139.968) (-3139.052) (-3130.205) -- 0:01:28 535000 -- (-3130.306) [-3137.893] (-3141.653) (-3135.724) * (-3138.719) (-3134.716) (-3137.416) [-3135.597] -- 0:01:28 Average standard deviation of split frequencies: 0.000000 535500 -- (-3134.126) (-3136.134) (-3139.916) [-3140.466] * (-3140.437) (-3132.743) (-3135.125) [-3136.872] -- 0:01:28 536000 -- (-3138.721) (-3136.870) (-3142.001) [-3141.308] * (-3133.863) (-3135.098) (-3136.853) [-3133.581] -- 0:01:28 536500 -- (-3131.325) [-3135.836] (-3136.844) (-3133.065) * (-3141.878) (-3138.568) (-3137.272) [-3133.858] -- 0:01:28 537000 -- [-3136.349] (-3137.436) (-3134.036) (-3135.240) * [-3142.453] (-3140.275) (-3141.896) (-3134.904) -- 0:01:27 537500 -- (-3134.438) [-3134.555] (-3133.196) (-3131.839) * (-3141.163) (-3133.739) (-3137.858) [-3132.103] -- 0:01:27 538000 -- [-3133.769] (-3147.856) (-3132.893) (-3137.663) * (-3137.580) [-3135.146] (-3135.772) (-3134.584) -- 0:01:27 538500 -- (-3137.694) (-3136.262) (-3137.601) [-3143.981] * (-3131.426) (-3134.719) [-3138.550] (-3136.511) -- 0:01:27 539000 -- (-3136.396) (-3133.743) (-3135.161) [-3139.167] * (-3131.342) (-3133.426) (-3133.935) [-3135.674] -- 0:01:27 539500 -- (-3139.499) (-3137.338) [-3136.428] (-3141.905) * (-3138.458) (-3135.046) (-3131.843) [-3140.391] -- 0:01:27 540000 -- (-3138.838) (-3134.935) [-3140.068] (-3135.253) * [-3139.362] (-3131.826) (-3136.531) (-3133.211) -- 0:01:27 Average standard deviation of split frequencies: 0.000000 540500 -- (-3137.529) [-3133.375] (-3134.230) (-3134.591) * (-3132.611) [-3132.118] (-3133.706) (-3136.915) -- 0:01:27 541000 -- (-3134.621) [-3132.987] (-3143.323) (-3136.132) * [-3132.762] (-3133.738) (-3140.135) (-3139.341) -- 0:01:27 541500 -- [-3138.599] (-3136.810) (-3133.541) (-3137.716) * (-3138.150) [-3131.934] (-3135.641) (-3135.245) -- 0:01:27 542000 -- (-3132.285) (-3134.079) (-3140.358) [-3133.479] * (-3135.401) (-3134.606) (-3138.650) [-3135.080] -- 0:01:27 542500 -- [-3133.114] (-3135.377) (-3131.500) (-3137.323) * (-3134.661) [-3133.407] (-3139.051) (-3144.539) -- 0:01:26 543000 -- (-3137.387) (-3134.708) (-3138.421) [-3137.961] * (-3138.547) [-3134.256] (-3140.204) (-3134.319) -- 0:01:26 543500 -- (-3135.404) (-3142.640) (-3134.843) [-3131.071] * (-3133.735) (-3132.201) (-3148.976) [-3134.978] -- 0:01:26 544000 -- [-3134.238] (-3140.153) (-3137.694) (-3137.218) * (-3136.409) [-3137.011] (-3139.213) (-3140.418) -- 0:01:26 544500 -- (-3138.891) [-3134.648] (-3142.931) (-3135.889) * (-3133.562) (-3134.668) (-3140.060) [-3134.559] -- 0:01:27 545000 -- [-3135.788] (-3143.895) (-3137.223) (-3139.737) * (-3136.374) [-3136.334] (-3138.033) (-3135.786) -- 0:01:26 Average standard deviation of split frequencies: 0.000000 545500 -- (-3129.472) (-3132.923) (-3136.546) [-3133.047] * (-3135.334) (-3138.849) [-3135.948] (-3132.051) -- 0:01:26 546000 -- [-3133.135] (-3134.388) (-3142.177) (-3137.933) * (-3139.990) (-3135.364) [-3132.858] (-3134.249) -- 0:01:26 546500 -- [-3133.917] (-3133.540) (-3141.320) (-3140.042) * [-3135.357] (-3136.711) (-3136.140) (-3142.483) -- 0:01:26 547000 -- (-3135.910) (-3133.480) (-3133.431) [-3137.816] * (-3139.631) (-3136.398) (-3132.025) [-3138.693] -- 0:01:26 547500 -- (-3139.939) (-3139.669) (-3138.020) [-3135.330] * (-3142.401) (-3130.706) [-3131.522] (-3134.332) -- 0:01:25 548000 -- [-3130.565] (-3136.097) (-3131.575) (-3138.835) * (-3137.347) (-3143.132) [-3133.043] (-3133.697) -- 0:01:25 548500 -- (-3131.341) [-3133.662] (-3138.538) (-3133.625) * [-3132.796] (-3135.152) (-3132.517) (-3145.279) -- 0:01:25 549000 -- (-3131.244) (-3132.887) (-3136.829) [-3131.745] * (-3133.502) (-3131.985) [-3139.613] (-3135.788) -- 0:01:25 549500 -- (-3133.207) (-3136.236) (-3133.860) [-3134.982] * [-3137.063] (-3132.043) (-3137.058) (-3136.754) -- 0:01:25 550000 -- (-3131.462) [-3132.966] (-3135.430) (-3144.501) * (-3139.268) (-3140.751) [-3134.448] (-3138.950) -- 0:01:25 Average standard deviation of split frequencies: 0.000000 550500 -- (-3139.436) [-3133.218] (-3134.769) (-3142.667) * (-3140.787) [-3140.259] (-3137.372) (-3136.946) -- 0:01:25 551000 -- [-3134.958] (-3139.467) (-3136.593) (-3136.911) * [-3133.372] (-3142.230) (-3139.641) (-3136.137) -- 0:01:25 551500 -- (-3142.261) (-3135.519) (-3131.057) [-3132.826] * (-3138.761) [-3139.320] (-3143.058) (-3131.431) -- 0:01:25 552000 -- (-3135.475) (-3133.615) [-3138.707] (-3135.708) * (-3135.240) (-3135.874) (-3137.472) [-3133.051] -- 0:01:25 552500 -- [-3137.855] (-3139.648) (-3134.598) (-3135.126) * (-3137.824) (-3131.832) (-3131.946) [-3136.374] -- 0:01:25 553000 -- (-3134.256) (-3141.099) (-3140.369) [-3135.229] * [-3135.492] (-3140.572) (-3133.096) (-3136.777) -- 0:01:24 553500 -- [-3135.638] (-3144.497) (-3144.456) (-3135.915) * (-3138.195) (-3136.058) [-3137.048] (-3137.036) -- 0:01:24 554000 -- (-3141.368) [-3135.956] (-3135.084) (-3141.225) * (-3140.812) (-3135.682) [-3130.606] (-3138.062) -- 0:01:24 554500 -- (-3134.265) (-3133.984) [-3132.848] (-3139.738) * (-3135.016) [-3137.631] (-3137.768) (-3137.844) -- 0:01:24 555000 -- [-3137.469] (-3140.170) (-3135.090) (-3134.271) * [-3130.613] (-3138.647) (-3136.411) (-3136.891) -- 0:01:24 Average standard deviation of split frequencies: 0.000000 555500 -- (-3131.749) [-3130.940] (-3131.902) (-3138.081) * (-3135.483) [-3131.387] (-3136.765) (-3136.580) -- 0:01:24 556000 -- (-3142.085) [-3136.248] (-3145.192) (-3138.575) * (-3131.791) (-3134.170) [-3138.595] (-3135.682) -- 0:01:24 556500 -- (-3132.443) (-3132.885) (-3134.926) [-3135.973] * [-3134.657] (-3133.425) (-3134.788) (-3131.541) -- 0:01:24 557000 -- (-3140.274) [-3134.420] (-3130.756) (-3134.232) * [-3135.501] (-3140.564) (-3140.320) (-3135.215) -- 0:01:24 557500 -- [-3132.533] (-3132.283) (-3135.667) (-3139.091) * [-3135.209] (-3133.348) (-3138.224) (-3136.878) -- 0:01:24 558000 -- (-3135.229) (-3132.408) [-3139.265] (-3138.229) * [-3132.944] (-3135.875) (-3140.580) (-3133.468) -- 0:01:23 558500 -- (-3134.678) (-3138.484) (-3135.555) [-3138.125] * (-3138.737) (-3143.599) [-3133.506] (-3135.788) -- 0:01:23 559000 -- (-3140.631) (-3134.691) (-3136.757) [-3131.369] * (-3139.133) (-3140.305) (-3131.467) [-3135.395] -- 0:01:23 559500 -- (-3136.488) (-3132.007) [-3138.622] (-3134.153) * [-3132.221] (-3131.666) (-3132.475) (-3143.542) -- 0:01:23 560000 -- (-3133.403) [-3134.399] (-3132.589) (-3138.090) * [-3130.710] (-3136.238) (-3134.491) (-3142.306) -- 0:01:23 Average standard deviation of split frequencies: 0.000000 560500 -- (-3131.754) (-3131.959) (-3140.083) [-3136.045] * [-3134.340] (-3135.512) (-3135.113) (-3136.091) -- 0:01:23 561000 -- (-3132.051) (-3134.685) [-3135.775] (-3136.265) * [-3133.455] (-3133.436) (-3130.736) (-3136.370) -- 0:01:23 561500 -- [-3135.074] (-3133.693) (-3140.303) (-3134.168) * [-3134.143] (-3135.492) (-3137.305) (-3131.855) -- 0:01:23 562000 -- [-3134.823] (-3135.691) (-3131.221) (-3135.710) * [-3129.144] (-3132.122) (-3136.633) (-3134.781) -- 0:01:23 562500 -- [-3130.525] (-3140.089) (-3140.340) (-3136.744) * (-3131.708) (-3140.450) (-3138.602) [-3131.774] -- 0:01:23 563000 -- (-3143.983) (-3136.652) [-3134.720] (-3132.875) * [-3134.370] (-3134.577) (-3134.590) (-3138.536) -- 0:01:23 563500 -- (-3136.572) [-3131.330] (-3131.170) (-3146.338) * (-3133.116) (-3137.699) [-3134.918] (-3135.459) -- 0:01:22 564000 -- [-3132.418] (-3136.071) (-3130.675) (-3138.437) * (-3136.699) (-3132.442) [-3136.719] (-3138.073) -- 0:01:22 564500 -- [-3133.243] (-3132.600) (-3133.949) (-3138.480) * [-3136.016] (-3134.179) (-3139.136) (-3136.182) -- 0:01:22 565000 -- (-3131.220) (-3132.155) [-3134.435] (-3138.851) * [-3131.349] (-3132.568) (-3135.604) (-3137.249) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 565500 -- (-3132.827) [-3132.292] (-3137.700) (-3134.348) * [-3134.580] (-3137.735) (-3140.588) (-3140.796) -- 0:01:22 566000 -- (-3137.411) (-3135.809) (-3132.841) [-3134.473] * (-3143.282) (-3137.515) [-3138.746] (-3142.343) -- 0:01:22 566500 -- (-3129.997) (-3137.065) (-3139.511) [-3132.690] * (-3136.703) (-3132.513) [-3136.892] (-3144.310) -- 0:01:22 567000 -- (-3132.939) (-3136.427) [-3139.101] (-3132.583) * (-3136.095) [-3133.985] (-3135.577) (-3138.489) -- 0:01:22 567500 -- (-3138.858) (-3140.701) (-3135.673) [-3132.982] * (-3137.692) (-3141.989) (-3142.388) [-3141.888] -- 0:01:22 568000 -- (-3140.623) (-3140.436) (-3134.896) [-3133.503] * (-3138.923) [-3134.673] (-3137.005) (-3139.950) -- 0:01:22 568500 -- (-3135.352) (-3135.343) (-3141.508) [-3132.442] * (-3142.684) (-3137.010) [-3138.724] (-3138.820) -- 0:01:21 569000 -- (-3138.996) [-3139.809] (-3133.776) (-3137.302) * (-3135.663) (-3136.019) [-3135.222] (-3141.424) -- 0:01:21 569500 -- [-3137.733] (-3134.073) (-3132.169) (-3133.709) * [-3135.260] (-3135.562) (-3130.060) (-3142.878) -- 0:01:21 570000 -- [-3131.741] (-3137.751) (-3139.571) (-3133.967) * (-3130.386) (-3132.205) [-3136.174] (-3139.990) -- 0:01:21 Average standard deviation of split frequencies: 0.000000 570500 -- (-3133.169) [-3135.320] (-3137.349) (-3135.536) * (-3140.759) [-3133.817] (-3137.373) (-3136.466) -- 0:01:21 571000 -- (-3138.988) [-3133.844] (-3131.525) (-3138.116) * (-3132.113) (-3135.696) [-3133.228] (-3140.760) -- 0:01:21 571500 -- (-3136.422) (-3137.929) (-3135.801) [-3136.050] * (-3134.201) (-3131.526) [-3134.691] (-3138.020) -- 0:01:21 572000 -- [-3145.374] (-3135.046) (-3136.285) (-3135.517) * (-3139.638) (-3137.394) (-3132.935) [-3140.089] -- 0:01:21 572500 -- (-3141.554) (-3134.069) (-3131.660) [-3140.734] * (-3132.189) (-3135.993) [-3131.720] (-3134.024) -- 0:01:21 573000 -- [-3137.781] (-3137.325) (-3132.628) (-3136.471) * [-3135.203] (-3137.725) (-3130.875) (-3136.381) -- 0:01:21 573500 -- [-3139.655] (-3139.299) (-3136.111) (-3134.250) * (-3133.639) (-3133.707) (-3137.049) [-3129.621] -- 0:01:21 574000 -- [-3132.020] (-3129.861) (-3137.154) (-3136.088) * (-3132.470) (-3138.626) [-3134.981] (-3141.982) -- 0:01:20 574500 -- (-3137.059) [-3132.678] (-3141.775) (-3133.591) * (-3138.357) (-3134.868) (-3131.588) [-3139.699] -- 0:01:20 575000 -- (-3137.618) (-3139.836) [-3136.139] (-3132.148) * (-3132.494) (-3142.585) [-3135.834] (-3133.889) -- 0:01:20 Average standard deviation of split frequencies: 0.000000 575500 -- [-3132.113] (-3139.721) (-3142.998) (-3139.530) * (-3133.258) (-3141.649) [-3136.511] (-3139.035) -- 0:01:20 576000 -- [-3138.931] (-3140.503) (-3134.198) (-3135.135) * (-3137.592) (-3133.429) (-3137.993) [-3131.441] -- 0:01:20 576500 -- (-3139.880) [-3131.295] (-3135.991) (-3136.713) * [-3136.703] (-3138.214) (-3138.815) (-3139.281) -- 0:01:20 577000 -- (-3137.969) [-3131.048] (-3132.927) (-3135.385) * (-3140.743) (-3136.170) [-3134.414] (-3132.657) -- 0:01:20 577500 -- (-3133.819) (-3136.981) [-3132.566] (-3133.870) * (-3133.592) (-3137.727) [-3134.293] (-3132.233) -- 0:01:20 578000 -- [-3132.286] (-3138.523) (-3141.843) (-3132.080) * (-3134.252) (-3131.072) (-3136.265) [-3136.749] -- 0:01:20 578500 -- [-3134.970] (-3140.013) (-3130.803) (-3139.548) * [-3136.758] (-3141.654) (-3134.194) (-3134.744) -- 0:01:20 579000 -- (-3140.190) (-3134.620) [-3134.751] (-3134.765) * (-3135.675) (-3136.962) (-3134.730) [-3132.317] -- 0:01:19 579500 -- (-3137.072) (-3138.112) [-3134.168] (-3135.433) * (-3141.666) (-3132.938) (-3138.324) [-3131.616] -- 0:01:19 580000 -- (-3139.837) (-3138.375) [-3136.768] (-3134.879) * [-3136.382] (-3137.582) (-3142.355) (-3141.983) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 580500 -- (-3135.763) (-3142.303) [-3133.612] (-3137.941) * [-3131.434] (-3133.822) (-3131.113) (-3138.673) -- 0:01:19 581000 -- (-3140.221) (-3141.903) (-3134.367) [-3137.738] * [-3132.655] (-3133.171) (-3131.598) (-3135.678) -- 0:01:19 581500 -- (-3140.282) (-3140.220) (-3134.254) [-3134.259] * [-3133.782] (-3130.605) (-3132.333) (-3134.606) -- 0:01:19 582000 -- (-3137.109) (-3138.233) (-3138.724) [-3139.257] * [-3132.293] (-3140.611) (-3134.930) (-3137.377) -- 0:01:19 582500 -- (-3141.010) (-3135.632) [-3138.427] (-3135.883) * (-3133.995) (-3140.197) (-3133.201) [-3138.183] -- 0:01:19 583000 -- (-3134.919) (-3143.964) (-3136.600) [-3135.320] * (-3132.411) (-3140.046) (-3133.064) [-3139.273] -- 0:01:19 583500 -- (-3135.168) [-3134.906] (-3132.545) (-3133.177) * (-3136.478) [-3133.421] (-3136.915) (-3137.969) -- 0:01:19 584000 -- (-3138.976) (-3131.346) (-3133.259) [-3139.950] * [-3135.438] (-3136.558) (-3135.793) (-3138.086) -- 0:01:19 584500 -- (-3136.025) (-3138.552) (-3140.330) [-3133.662] * [-3131.061] (-3138.745) (-3137.014) (-3136.022) -- 0:01:18 585000 -- (-3134.563) [-3135.180] (-3144.887) (-3133.810) * [-3132.284] (-3139.601) (-3131.677) (-3139.027) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 585500 -- (-3136.291) (-3134.380) (-3141.768) [-3131.839] * [-3137.937] (-3142.967) (-3140.968) (-3144.139) -- 0:01:18 586000 -- (-3145.214) (-3132.031) (-3141.782) [-3134.112] * [-3134.926] (-3133.348) (-3140.419) (-3138.551) -- 0:01:18 586500 -- (-3136.111) (-3132.518) [-3136.509] (-3136.765) * [-3137.567] (-3141.987) (-3136.417) (-3136.476) -- 0:01:18 587000 -- (-3133.968) [-3135.451] (-3135.630) (-3134.394) * (-3140.508) (-3145.227) (-3138.533) [-3140.260] -- 0:01:18 587500 -- [-3134.107] (-3137.645) (-3141.360) (-3134.601) * (-3135.346) (-3136.187) (-3135.400) [-3135.491] -- 0:01:18 588000 -- (-3143.421) (-3139.985) [-3129.804] (-3139.184) * (-3132.972) (-3140.321) (-3135.149) [-3138.649] -- 0:01:18 588500 -- (-3137.120) (-3145.523) [-3133.292] (-3136.065) * (-3134.112) (-3143.354) (-3137.886) [-3137.703] -- 0:01:18 589000 -- (-3136.731) (-3134.090) (-3130.902) [-3136.388] * (-3136.659) (-3137.392) [-3134.715] (-3131.759) -- 0:01:18 589500 -- (-3137.825) [-3132.615] (-3132.453) (-3134.605) * [-3134.311] (-3139.111) (-3135.285) (-3143.715) -- 0:01:17 590000 -- (-3135.630) (-3138.344) [-3133.718] (-3136.402) * (-3136.062) [-3138.165] (-3130.683) (-3137.902) -- 0:01:17 Average standard deviation of split frequencies: 0.000000 590500 -- [-3133.505] (-3132.408) (-3131.575) (-3141.317) * [-3137.717] (-3136.360) (-3137.949) (-3133.076) -- 0:01:17 591000 -- (-3134.527) (-3135.509) [-3136.082] (-3137.535) * [-3136.050] (-3138.735) (-3140.578) (-3133.743) -- 0:01:17 591500 -- (-3138.442) [-3136.791] (-3130.259) (-3135.206) * (-3134.022) [-3132.823] (-3137.392) (-3133.055) -- 0:01:17 592000 -- [-3136.245] (-3135.299) (-3132.394) (-3137.923) * (-3139.992) (-3136.409) (-3133.923) [-3135.058] -- 0:01:17 592500 -- [-3135.311] (-3135.536) (-3135.766) (-3134.986) * (-3135.625) (-3134.729) (-3133.026) [-3132.460] -- 0:01:17 593000 -- [-3132.043] (-3134.739) (-3137.820) (-3136.381) * (-3133.068) (-3144.032) (-3139.044) [-3137.973] -- 0:01:17 593500 -- (-3133.223) (-3139.085) [-3138.005] (-3131.197) * (-3136.254) (-3132.236) [-3135.395] (-3134.780) -- 0:01:17 594000 -- (-3132.335) [-3138.089] (-3133.780) (-3132.354) * (-3138.492) (-3136.989) [-3132.930] (-3133.624) -- 0:01:17 594500 -- (-3137.568) [-3134.558] (-3135.513) (-3135.877) * (-3137.720) (-3140.735) (-3137.011) [-3132.335] -- 0:01:17 595000 -- (-3137.160) [-3134.651] (-3130.471) (-3137.652) * (-3140.085) (-3140.224) [-3135.978] (-3130.340) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 595500 -- (-3136.620) (-3140.022) [-3140.900] (-3132.500) * (-3136.235) (-3132.859) [-3134.010] (-3145.404) -- 0:01:16 596000 -- (-3133.344) (-3141.594) [-3134.700] (-3133.123) * (-3137.054) (-3133.869) [-3131.765] (-3135.042) -- 0:01:16 596500 -- (-3132.926) (-3135.121) (-3134.745) [-3132.195] * [-3131.341] (-3139.683) (-3135.193) (-3134.216) -- 0:01:16 597000 -- (-3142.638) [-3133.713] (-3135.734) (-3141.906) * [-3130.576] (-3141.444) (-3129.535) (-3136.495) -- 0:01:16 597500 -- (-3140.748) (-3131.185) [-3133.191] (-3147.322) * (-3132.902) (-3135.649) [-3131.050] (-3136.367) -- 0:01:16 598000 -- (-3140.314) (-3133.371) (-3139.009) [-3136.063] * (-3135.658) (-3139.871) [-3133.190] (-3136.839) -- 0:01:16 598500 -- [-3129.052] (-3144.268) (-3134.692) (-3136.668) * (-3136.138) (-3132.699) (-3133.501) [-3136.483] -- 0:01:16 599000 -- (-3141.938) (-3138.236) (-3134.302) [-3142.498] * (-3133.473) (-3131.446) (-3133.967) [-3136.193] -- 0:01:16 599500 -- [-3134.518] (-3135.726) (-3132.093) (-3132.754) * [-3133.601] (-3134.110) (-3134.324) (-3135.168) -- 0:01:16 600000 -- (-3141.239) (-3134.954) [-3132.209] (-3137.944) * (-3134.349) (-3135.849) [-3136.362] (-3134.733) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 600500 -- (-3137.142) (-3137.382) (-3134.806) [-3140.851] * (-3137.200) [-3131.052] (-3141.899) (-3133.672) -- 0:01:15 601000 -- [-3130.011] (-3134.735) (-3135.392) (-3138.245) * (-3138.841) (-3135.377) [-3136.845] (-3136.072) -- 0:01:15 601500 -- (-3134.809) [-3137.386] (-3136.966) (-3133.576) * [-3133.311] (-3136.302) (-3136.064) (-3133.201) -- 0:01:15 602000 -- (-3133.682) [-3136.276] (-3139.406) (-3137.998) * (-3133.408) (-3138.418) (-3135.837) [-3131.242] -- 0:01:15 602500 -- (-3138.182) [-3132.891] (-3136.721) (-3137.028) * [-3135.382] (-3137.450) (-3134.991) (-3138.010) -- 0:01:15 603000 -- (-3143.984) (-3135.318) (-3142.984) [-3132.454] * (-3133.479) (-3145.079) (-3135.056) [-3134.532] -- 0:01:15 603500 -- (-3141.182) (-3138.562) (-3137.225) [-3134.329] * (-3135.863) [-3132.493] (-3139.857) (-3140.184) -- 0:01:15 604000 -- [-3135.800] (-3144.492) (-3134.330) (-3133.873) * [-3132.854] (-3134.078) (-3133.957) (-3132.485) -- 0:01:15 604500 -- (-3133.750) (-3140.062) (-3132.136) [-3135.822] * (-3141.611) (-3136.507) [-3137.552] (-3135.820) -- 0:01:15 605000 -- [-3130.591] (-3139.617) (-3134.862) (-3140.423) * (-3135.299) (-3140.207) [-3132.443] (-3135.271) -- 0:01:15 Average standard deviation of split frequencies: 0.000000 605500 -- [-3136.856] (-3135.500) (-3139.547) (-3133.969) * (-3132.712) [-3136.773] (-3133.745) (-3137.602) -- 0:01:14 606000 -- (-3143.540) (-3133.046) [-3131.178] (-3140.699) * (-3132.263) (-3140.847) [-3130.866] (-3140.298) -- 0:01:14 606500 -- (-3141.357) (-3134.774) [-3135.472] (-3139.780) * [-3135.892] (-3135.868) (-3134.214) (-3135.863) -- 0:01:14 607000 -- (-3136.504) [-3138.050] (-3134.159) (-3139.677) * (-3135.974) [-3136.859] (-3138.033) (-3129.604) -- 0:01:14 607500 -- (-3133.302) [-3129.904] (-3137.315) (-3140.577) * (-3137.957) (-3138.773) [-3136.158] (-3135.029) -- 0:01:14 608000 -- (-3135.057) (-3141.964) [-3136.169] (-3138.547) * (-3132.224) (-3133.739) (-3136.997) [-3137.972] -- 0:01:14 608500 -- [-3137.573] (-3140.136) (-3140.073) (-3141.449) * [-3132.391] (-3139.301) (-3136.295) (-3131.706) -- 0:01:14 609000 -- (-3130.649) [-3136.578] (-3134.186) (-3132.283) * (-3135.279) [-3133.447] (-3134.011) (-3130.266) -- 0:01:14 609500 -- (-3132.236) [-3139.394] (-3131.351) (-3135.669) * [-3135.442] (-3133.999) (-3138.398) (-3133.308) -- 0:01:14 610000 -- [-3135.746] (-3139.237) (-3133.568) (-3139.711) * (-3141.189) (-3130.459) [-3135.656] (-3134.535) -- 0:01:14 Average standard deviation of split frequencies: 0.000000 610500 -- (-3135.534) [-3135.885] (-3130.034) (-3134.607) * [-3134.962] (-3145.071) (-3135.691) (-3137.800) -- 0:01:14 611000 -- [-3134.101] (-3134.739) (-3134.323) (-3140.570) * (-3138.973) (-3134.774) (-3136.032) [-3132.217] -- 0:01:13 611500 -- (-3142.760) (-3133.896) (-3136.405) [-3135.721] * (-3133.564) (-3132.307) (-3135.646) [-3133.133] -- 0:01:13 612000 -- (-3148.004) (-3136.972) [-3142.240] (-3137.567) * (-3135.702) (-3136.476) [-3131.697] (-3143.919) -- 0:01:13 612500 -- (-3140.529) [-3138.768] (-3135.035) (-3136.466) * [-3142.753] (-3136.239) (-3134.069) (-3132.208) -- 0:01:13 613000 -- [-3135.943] (-3132.174) (-3133.507) (-3135.930) * (-3136.019) (-3132.067) [-3135.849] (-3130.910) -- 0:01:13 613500 -- (-3135.109) [-3131.732] (-3133.921) (-3132.148) * (-3135.524) [-3135.226] (-3147.423) (-3132.671) -- 0:01:13 614000 -- (-3140.162) (-3139.916) (-3132.415) [-3138.365] * (-3135.933) (-3133.136) [-3134.558] (-3133.579) -- 0:01:13 614500 -- (-3142.469) (-3135.423) (-3133.702) [-3136.532] * (-3133.569) (-3139.765) [-3139.994] (-3132.820) -- 0:01:13 615000 -- (-3138.100) (-3142.542) [-3132.025] (-3131.926) * (-3135.203) [-3134.207] (-3139.386) (-3134.285) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 615500 -- (-3136.111) (-3142.689) [-3138.704] (-3137.466) * [-3132.799] (-3134.290) (-3140.071) (-3133.239) -- 0:01:13 616000 -- (-3133.817) [-3135.123] (-3133.905) (-3144.239) * (-3131.197) (-3135.027) (-3145.704) [-3134.233] -- 0:01:12 616500 -- (-3131.947) (-3135.930) (-3136.359) [-3132.055] * (-3134.333) [-3140.288] (-3132.532) (-3137.027) -- 0:01:12 617000 -- [-3132.863] (-3130.742) (-3137.647) (-3138.851) * (-3140.929) (-3138.327) (-3139.362) [-3138.647] -- 0:01:12 617500 -- [-3136.468] (-3135.945) (-3138.886) (-3139.221) * (-3131.893) (-3132.017) (-3131.345) [-3146.581] -- 0:01:12 618000 -- (-3132.903) (-3139.973) [-3135.135] (-3143.090) * [-3134.128] (-3133.432) (-3136.712) (-3139.060) -- 0:01:12 618500 -- [-3134.161] (-3131.598) (-3134.832) (-3144.280) * (-3137.388) (-3133.843) [-3138.099] (-3146.077) -- 0:01:12 619000 -- (-3131.996) (-3133.418) (-3132.183) [-3139.546] * [-3133.113] (-3137.627) (-3137.679) (-3145.364) -- 0:01:12 619500 -- (-3142.709) [-3133.950] (-3137.412) (-3137.359) * [-3137.332] (-3135.633) (-3134.388) (-3144.330) -- 0:01:12 620000 -- (-3131.187) (-3133.904) [-3137.578] (-3137.758) * [-3139.072] (-3135.080) (-3132.298) (-3138.798) -- 0:01:12 Average standard deviation of split frequencies: 0.000000 620500 -- (-3135.013) (-3134.777) [-3133.866] (-3134.329) * (-3134.324) [-3136.364] (-3133.607) (-3133.634) -- 0:01:12 621000 -- [-3137.146] (-3137.522) (-3134.887) (-3144.611) * [-3141.267] (-3138.854) (-3134.829) (-3137.444) -- 0:01:12 621500 -- (-3131.114) [-3138.224] (-3132.186) (-3134.353) * (-3133.440) (-3132.109) [-3131.858] (-3139.057) -- 0:01:11 622000 -- (-3138.061) [-3135.077] (-3136.920) (-3135.627) * (-3136.567) [-3131.710] (-3137.482) (-3136.252) -- 0:01:11 622500 -- (-3134.565) [-3134.635] (-3134.575) (-3135.251) * (-3140.538) (-3140.600) [-3134.391] (-3133.502) -- 0:01:11 623000 -- [-3133.404] (-3133.497) (-3146.536) (-3142.093) * (-3135.626) (-3141.252) [-3131.490] (-3141.655) -- 0:01:11 623500 -- (-3133.253) (-3136.777) (-3134.097) [-3131.231] * (-3141.069) [-3135.885] (-3134.558) (-3139.071) -- 0:01:11 624000 -- (-3132.339) [-3129.881] (-3136.905) (-3139.046) * (-3140.300) (-3144.281) (-3140.388) [-3138.539] -- 0:01:11 624500 -- (-3135.185) (-3131.052) [-3141.632] (-3136.516) * [-3135.633] (-3133.635) (-3144.234) (-3135.455) -- 0:01:11 625000 -- (-3135.023) (-3139.543) (-3138.438) [-3132.495] * [-3136.295] (-3129.852) (-3139.274) (-3136.252) -- 0:01:11 Average standard deviation of split frequencies: 0.000000 625500 -- (-3132.647) (-3136.347) [-3132.600] (-3135.174) * (-3132.190) [-3136.379] (-3135.794) (-3134.615) -- 0:01:11 626000 -- [-3141.347] (-3137.891) (-3135.269) (-3134.946) * (-3140.503) [-3137.106] (-3132.507) (-3134.707) -- 0:01:11 626500 -- (-3133.356) (-3134.901) (-3146.847) [-3131.909] * [-3132.421] (-3135.498) (-3133.970) (-3136.666) -- 0:01:10 627000 -- (-3138.728) (-3136.243) [-3140.095] (-3140.846) * (-3137.478) [-3140.511] (-3137.822) (-3136.957) -- 0:01:10 627500 -- [-3141.002] (-3133.031) (-3139.168) (-3137.433) * (-3136.035) (-3140.077) (-3134.710) [-3133.860] -- 0:01:10 628000 -- [-3136.052] (-3136.846) (-3133.641) (-3131.139) * (-3132.029) (-3129.956) (-3135.257) [-3129.680] -- 0:01:10 628500 -- (-3141.537) (-3139.779) (-3135.930) [-3133.711] * (-3135.602) (-3134.699) (-3131.216) [-3129.666] -- 0:01:10 629000 -- (-3134.229) [-3136.133] (-3138.059) (-3136.137) * (-3137.831) (-3140.787) [-3133.187] (-3144.022) -- 0:01:10 629500 -- (-3135.931) (-3136.645) [-3132.062] (-3132.786) * (-3139.423) (-3141.839) (-3136.679) [-3138.273] -- 0:01:10 630000 -- (-3140.769) [-3129.939] (-3135.708) (-3135.141) * (-3141.585) (-3143.026) (-3131.112) [-3130.750] -- 0:01:10 Average standard deviation of split frequencies: 0.000000 630500 -- [-3132.747] (-3135.401) (-3143.994) (-3141.662) * [-3138.042] (-3139.988) (-3145.389) (-3137.541) -- 0:01:10 631000 -- (-3135.649) [-3134.560] (-3138.650) (-3132.942) * (-3132.327) [-3134.073] (-3136.622) (-3146.681) -- 0:01:10 631500 -- (-3140.042) (-3134.506) (-3140.388) [-3131.225] * (-3134.494) [-3130.200] (-3138.451) (-3133.775) -- 0:01:10 632000 -- (-3137.269) (-3133.763) [-3132.615] (-3133.754) * (-3133.486) (-3134.836) [-3133.297] (-3136.332) -- 0:01:09 632500 -- (-3136.877) [-3134.708] (-3134.742) (-3133.641) * (-3136.786) (-3138.176) (-3134.117) [-3131.872] -- 0:01:09 633000 -- (-3137.737) (-3136.897) (-3132.961) [-3131.887] * (-3141.784) [-3134.609] (-3134.874) (-3130.276) -- 0:01:09 633500 -- [-3135.887] (-3144.763) (-3134.885) (-3134.379) * [-3135.523] (-3135.132) (-3131.465) (-3135.950) -- 0:01:09 634000 -- (-3136.039) (-3139.980) (-3142.187) [-3135.009] * [-3133.139] (-3135.571) (-3133.282) (-3132.441) -- 0:01:09 634500 -- [-3135.830] (-3142.241) (-3136.974) (-3136.061) * (-3132.151) (-3136.589) [-3131.671] (-3138.957) -- 0:01:09 635000 -- (-3131.408) [-3140.926] (-3133.757) (-3136.161) * (-3134.777) [-3133.560] (-3134.427) (-3134.053) -- 0:01:09 Average standard deviation of split frequencies: 0.000000 635500 -- (-3136.455) (-3138.817) [-3133.556] (-3132.815) * (-3135.540) (-3134.944) [-3134.879] (-3138.858) -- 0:01:09 636000 -- (-3135.212) (-3140.396) (-3137.551) [-3133.033] * [-3136.242] (-3135.274) (-3132.411) (-3138.897) -- 0:01:09 636500 -- [-3132.885] (-3135.714) (-3138.717) (-3134.603) * (-3134.929) (-3135.703) (-3133.173) [-3134.986] -- 0:01:09 637000 -- [-3138.815] (-3135.833) (-3134.392) (-3140.829) * (-3140.146) (-3135.138) (-3133.053) [-3130.297] -- 0:01:08 637500 -- (-3133.112) [-3134.153] (-3137.738) (-3133.518) * (-3143.787) (-3134.546) [-3131.225] (-3136.766) -- 0:01:08 638000 -- (-3133.458) (-3134.229) (-3134.403) [-3134.461] * (-3142.365) (-3138.056) (-3137.214) [-3132.240] -- 0:01:08 638500 -- [-3130.600] (-3136.170) (-3135.020) (-3141.139) * (-3139.110) [-3137.207] (-3135.271) (-3133.030) -- 0:01:08 639000 -- (-3135.606) (-3139.382) [-3132.969] (-3132.715) * (-3139.444) (-3136.340) [-3129.980] (-3136.157) -- 0:01:08 639500 -- (-3134.324) (-3138.357) (-3133.226) [-3140.645] * (-3131.292) (-3141.056) [-3135.978] (-3135.736) -- 0:01:08 640000 -- [-3132.211] (-3133.359) (-3131.357) (-3138.536) * (-3141.359) (-3134.221) (-3138.626) [-3133.871] -- 0:01:08 Average standard deviation of split frequencies: 0.000000 640500 -- [-3131.964] (-3135.635) (-3140.066) (-3136.547) * (-3133.253) [-3141.120] (-3144.966) (-3134.540) -- 0:01:08 641000 -- (-3133.806) (-3137.292) [-3132.461] (-3139.735) * [-3133.541] (-3135.934) (-3140.072) (-3137.437) -- 0:01:08 641500 -- (-3129.793) (-3136.883) [-3133.478] (-3132.531) * [-3136.950] (-3137.366) (-3139.085) (-3140.597) -- 0:01:08 642000 -- [-3131.702] (-3134.431) (-3138.354) (-3130.550) * (-3141.498) (-3134.482) [-3132.311] (-3141.825) -- 0:01:08 642500 -- (-3133.023) [-3134.103] (-3137.195) (-3134.461) * (-3140.794) (-3137.319) (-3133.359) [-3132.688] -- 0:01:07 643000 -- (-3136.271) (-3136.804) (-3140.800) [-3136.709] * [-3132.977] (-3139.479) (-3131.693) (-3138.180) -- 0:01:07 643500 -- (-3136.528) (-3136.810) [-3136.846] (-3134.181) * (-3140.695) (-3135.555) (-3132.729) [-3132.544] -- 0:01:07 644000 -- [-3136.767] (-3133.116) (-3136.806) (-3132.207) * (-3141.706) (-3138.924) [-3134.885] (-3140.689) -- 0:01:07 644500 -- [-3139.322] (-3133.643) (-3136.231) (-3131.016) * (-3141.137) [-3138.888] (-3132.508) (-3134.013) -- 0:01:07 645000 -- [-3133.221] (-3135.474) (-3138.305) (-3138.590) * (-3135.816) (-3137.022) [-3133.204] (-3137.570) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 645500 -- [-3136.332] (-3134.376) (-3139.771) (-3139.269) * [-3132.520] (-3144.569) (-3134.929) (-3129.174) -- 0:01:07 646000 -- (-3133.231) (-3136.129) [-3139.233] (-3136.379) * [-3131.100] (-3141.155) (-3142.208) (-3134.863) -- 0:01:07 646500 -- [-3131.677] (-3131.451) (-3137.758) (-3137.134) * [-3131.911] (-3137.801) (-3143.399) (-3138.177) -- 0:01:07 647000 -- (-3133.802) (-3137.007) [-3131.518] (-3137.337) * (-3134.753) (-3134.480) (-3133.816) [-3131.938] -- 0:01:07 647500 -- (-3133.038) (-3135.504) [-3131.746] (-3140.293) * (-3135.829) [-3131.128] (-3132.531) (-3132.353) -- 0:01:06 648000 -- [-3134.034] (-3142.492) (-3131.746) (-3136.073) * (-3139.818) [-3136.448] (-3135.271) (-3133.020) -- 0:01:06 648500 -- (-3133.972) [-3134.146] (-3131.957) (-3142.054) * (-3142.798) [-3136.355] (-3133.354) (-3130.112) -- 0:01:06 649000 -- (-3135.455) (-3136.637) [-3135.485] (-3137.503) * [-3134.665] (-3131.595) (-3143.002) (-3136.923) -- 0:01:06 649500 -- [-3133.594] (-3133.890) (-3138.002) (-3137.363) * (-3137.141) (-3133.205) (-3136.890) [-3134.949] -- 0:01:06 650000 -- [-3134.539] (-3137.546) (-3135.841) (-3140.553) * (-3137.254) (-3136.880) (-3134.474) [-3136.134] -- 0:01:06 Average standard deviation of split frequencies: 0.000000 650500 -- (-3134.384) (-3148.712) (-3136.070) [-3136.542] * (-3132.653) (-3134.163) (-3135.692) [-3136.202] -- 0:01:06 651000 -- [-3136.382] (-3135.280) (-3135.586) (-3136.651) * (-3134.452) (-3142.125) (-3134.856) [-3139.175] -- 0:01:06 651500 -- (-3134.016) [-3137.235] (-3134.952) (-3134.473) * [-3132.206] (-3132.222) (-3135.334) (-3143.723) -- 0:01:06 652000 -- (-3137.483) (-3137.104) [-3131.219] (-3140.561) * (-3133.364) (-3134.506) (-3130.582) [-3138.631] -- 0:01:06 652500 -- (-3136.125) [-3133.520] (-3136.142) (-3132.481) * (-3137.820) (-3139.626) [-3130.896] (-3136.929) -- 0:01:06 653000 -- (-3134.383) (-3132.192) [-3139.338] (-3133.927) * (-3140.421) [-3131.474] (-3136.944) (-3130.712) -- 0:01:05 653500 -- (-3133.382) (-3136.788) [-3135.316] (-3138.557) * (-3132.167) (-3139.675) (-3136.144) [-3132.516] -- 0:01:05 654000 -- (-3138.250) [-3133.865] (-3142.051) (-3143.633) * (-3141.052) (-3133.406) [-3132.281] (-3133.255) -- 0:01:05 654500 -- (-3140.041) [-3131.911] (-3138.106) (-3136.365) * (-3137.155) [-3131.303] (-3137.441) (-3136.675) -- 0:01:05 655000 -- (-3137.478) [-3132.568] (-3140.303) (-3133.896) * (-3132.980) (-3137.120) (-3132.010) [-3143.387] -- 0:01:05 Average standard deviation of split frequencies: 0.000000 655500 -- (-3140.729) (-3134.939) (-3135.553) [-3134.252] * (-3142.288) (-3138.054) [-3133.718] (-3134.591) -- 0:01:05 656000 -- (-3139.061) (-3140.149) (-3139.387) [-3134.957] * [-3133.570] (-3138.821) (-3137.087) (-3132.140) -- 0:01:05 656500 -- (-3133.347) [-3133.301] (-3136.846) (-3136.245) * (-3133.023) [-3132.158] (-3133.159) (-3140.073) -- 0:01:05 657000 -- (-3135.632) (-3137.558) [-3134.679] (-3135.240) * (-3137.803) (-3145.226) [-3131.640] (-3140.204) -- 0:01:05 657500 -- (-3136.428) [-3133.091] (-3135.974) (-3137.019) * [-3132.166] (-3134.870) (-3138.999) (-3140.482) -- 0:01:05 658000 -- (-3136.732) (-3137.595) [-3129.653] (-3135.983) * (-3135.085) (-3137.172) (-3134.467) [-3139.994] -- 0:01:04 658500 -- [-3133.093] (-3132.944) (-3137.828) (-3135.160) * (-3136.920) [-3137.064] (-3136.428) (-3138.919) -- 0:01:04 659000 -- (-3133.293) (-3134.630) [-3135.146] (-3135.227) * (-3137.346) (-3136.575) [-3134.743] (-3132.502) -- 0:01:04 659500 -- [-3130.734] (-3136.146) (-3140.954) (-3139.204) * (-3134.738) (-3133.140) [-3134.172] (-3136.408) -- 0:01:04 660000 -- [-3131.918] (-3133.488) (-3134.200) (-3139.180) * (-3136.947) (-3134.020) [-3132.771] (-3138.075) -- 0:01:04 Average standard deviation of split frequencies: 0.000000 660500 -- [-3131.548] (-3138.246) (-3132.697) (-3141.942) * (-3136.758) (-3135.041) (-3134.368) [-3136.608] -- 0:01:04 661000 -- (-3136.208) (-3142.527) [-3134.249] (-3132.759) * (-3132.086) [-3134.268] (-3141.159) (-3137.169) -- 0:01:04 661500 -- [-3132.393] (-3132.753) (-3135.917) (-3139.799) * [-3137.302] (-3135.236) (-3135.758) (-3131.396) -- 0:01:04 662000 -- (-3134.614) (-3131.570) [-3134.769] (-3141.341) * (-3139.581) (-3134.530) [-3135.274] (-3134.849) -- 0:01:04 662500 -- (-3133.216) (-3139.065) [-3136.633] (-3136.722) * (-3132.703) [-3131.608] (-3132.847) (-3141.892) -- 0:01:04 663000 -- (-3137.587) (-3133.218) [-3137.355] (-3139.453) * (-3135.646) [-3133.035] (-3140.944) (-3142.655) -- 0:01:04 663500 -- (-3133.205) (-3130.942) [-3136.807] (-3138.342) * (-3134.943) (-3134.533) [-3137.902] (-3138.982) -- 0:01:03 664000 -- (-3138.384) [-3134.518] (-3135.814) (-3142.975) * [-3135.496] (-3133.400) (-3137.611) (-3136.649) -- 0:01:03 664500 -- (-3140.465) (-3137.871) [-3138.153] (-3137.316) * (-3135.982) (-3137.292) [-3132.388] (-3131.114) -- 0:01:03 665000 -- (-3142.484) (-3137.609) (-3139.359) [-3135.918] * (-3135.712) [-3137.755] (-3134.269) (-3133.669) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 665500 -- (-3150.296) [-3136.559] (-3135.057) (-3135.803) * (-3136.303) (-3140.372) (-3139.579) [-3136.855] -- 0:01:03 666000 -- (-3142.351) [-3137.743] (-3137.235) (-3141.650) * [-3131.219] (-3135.959) (-3135.541) (-3140.539) -- 0:01:03 666500 -- (-3139.719) [-3137.298] (-3132.587) (-3144.898) * (-3142.527) (-3134.935) (-3140.932) [-3140.396] -- 0:01:03 667000 -- (-3129.741) (-3134.627) [-3132.757] (-3138.277) * [-3140.218] (-3131.372) (-3133.398) (-3138.127) -- 0:01:03 667500 -- (-3141.484) (-3132.984) (-3133.066) [-3133.841] * (-3149.681) (-3133.522) [-3135.438] (-3134.063) -- 0:01:03 668000 -- [-3131.744] (-3134.702) (-3136.171) (-3129.118) * [-3135.359] (-3135.955) (-3136.303) (-3136.423) -- 0:01:03 668500 -- [-3134.552] (-3134.620) (-3137.940) (-3135.132) * (-3139.481) [-3135.453] (-3135.665) (-3142.262) -- 0:01:02 669000 -- (-3131.820) [-3138.212] (-3132.822) (-3136.505) * (-3140.174) (-3137.760) (-3142.364) [-3139.235] -- 0:01:02 669500 -- [-3140.838] (-3137.105) (-3134.028) (-3141.896) * [-3143.386] (-3138.343) (-3140.392) (-3134.062) -- 0:01:02 670000 -- (-3142.198) [-3134.092] (-3141.022) (-3144.008) * (-3133.550) (-3139.507) (-3137.438) [-3134.905] -- 0:01:02 Average standard deviation of split frequencies: 0.000000 670500 -- (-3136.871) (-3136.213) (-3137.010) [-3133.220] * (-3137.792) [-3131.125] (-3143.296) (-3140.371) -- 0:01:02 671000 -- (-3137.153) (-3137.413) [-3137.680] (-3137.907) * (-3145.057) (-3135.655) [-3129.832] (-3136.253) -- 0:01:02 671500 -- (-3142.010) [-3139.371] (-3135.559) (-3138.731) * (-3137.417) (-3139.842) [-3135.730] (-3136.416) -- 0:01:02 672000 -- (-3132.071) (-3132.131) [-3132.975] (-3139.013) * (-3134.729) (-3134.276) [-3135.371] (-3134.119) -- 0:01:02 672500 -- [-3135.620] (-3138.334) (-3136.494) (-3135.193) * (-3132.693) (-3131.893) [-3135.267] (-3136.635) -- 0:01:02 673000 -- (-3140.085) (-3133.396) (-3132.150) [-3131.844] * [-3136.397] (-3138.702) (-3146.622) (-3133.446) -- 0:01:02 673500 -- (-3131.424) (-3133.034) [-3134.748] (-3132.233) * (-3136.594) [-3135.171] (-3137.414) (-3134.014) -- 0:01:02 674000 -- (-3134.676) [-3131.167] (-3135.116) (-3138.974) * [-3132.326] (-3135.925) (-3131.025) (-3139.485) -- 0:01:01 674500 -- (-3134.408) (-3135.298) (-3133.282) [-3133.666] * (-3133.344) (-3134.562) [-3137.596] (-3135.202) -- 0:01:01 675000 -- [-3135.914] (-3136.526) (-3136.582) (-3134.701) * [-3131.600] (-3132.791) (-3130.208) (-3135.105) -- 0:01:01 Average standard deviation of split frequencies: 0.000000 675500 -- [-3131.158] (-3142.210) (-3133.667) (-3137.570) * (-3131.367) (-3135.548) [-3131.012] (-3130.841) -- 0:01:01 676000 -- (-3137.765) (-3140.899) [-3139.351] (-3136.081) * (-3139.022) (-3131.436) (-3135.606) [-3133.192] -- 0:01:01 676500 -- (-3134.119) (-3136.951) [-3137.489] (-3137.090) * (-3130.905) [-3132.805] (-3140.308) (-3139.068) -- 0:01:01 677000 -- (-3142.098) (-3135.203) [-3133.430] (-3142.752) * (-3134.635) [-3133.549] (-3144.135) (-3137.267) -- 0:01:01 677500 -- (-3137.252) (-3133.774) (-3138.436) [-3135.918] * (-3141.692) [-3134.663] (-3135.924) (-3139.810) -- 0:01:01 678000 -- (-3135.182) (-3134.931) (-3135.498) [-3131.430] * (-3137.276) (-3142.391) [-3137.837] (-3134.983) -- 0:01:01 678500 -- [-3141.738] (-3135.260) (-3138.364) (-3138.217) * (-3140.033) (-3138.586) (-3135.168) [-3132.169] -- 0:01:01 679000 -- (-3136.401) (-3133.574) [-3133.227] (-3136.382) * (-3133.778) [-3134.970] (-3135.133) (-3133.292) -- 0:01:00 679500 -- (-3135.058) [-3136.390] (-3133.116) (-3137.207) * (-3135.715) (-3142.562) (-3135.303) [-3133.342] -- 0:01:00 680000 -- (-3137.916) (-3136.021) [-3129.334] (-3137.107) * [-3138.472] (-3139.801) (-3138.515) (-3137.717) -- 0:01:00 Average standard deviation of split frequencies: 0.000000 680500 -- (-3136.929) (-3136.534) (-3138.862) [-3135.534] * (-3134.533) (-3133.802) (-3140.649) [-3138.829] -- 0:01:00 681000 -- [-3133.481] (-3143.983) (-3134.599) (-3137.542) * (-3133.311) [-3134.936] (-3135.265) (-3136.113) -- 0:01:00 681500 -- (-3138.337) (-3135.765) [-3133.023] (-3143.069) * [-3140.086] (-3136.346) (-3135.442) (-3136.115) -- 0:01:00 682000 -- (-3142.903) [-3133.380] (-3129.336) (-3131.444) * (-3133.304) (-3147.652) [-3137.166] (-3134.895) -- 0:01:00 682500 -- (-3138.257) (-3136.626) [-3130.287] (-3131.197) * (-3134.667) (-3141.222) (-3136.594) [-3135.140] -- 0:01:00 683000 -- (-3136.511) [-3133.976] (-3129.098) (-3132.725) * (-3137.753) (-3142.563) (-3142.068) [-3142.854] -- 0:01:00 683500 -- (-3138.629) (-3135.374) [-3133.273] (-3132.284) * [-3140.829] (-3133.758) (-3136.204) (-3140.730) -- 0:01:00 684000 -- (-3136.947) [-3130.781] (-3135.512) (-3135.195) * (-3136.258) [-3136.241] (-3134.393) (-3137.624) -- 0:01:00 684500 -- [-3134.167] (-3135.971) (-3133.005) (-3141.339) * (-3135.770) (-3139.238) (-3140.268) [-3130.279] -- 0:00:59 685000 -- (-3141.999) (-3131.327) [-3145.306] (-3135.279) * (-3136.887) (-3140.028) [-3130.591] (-3132.826) -- 0:00:59 Average standard deviation of split frequencies: 0.000000 685500 -- (-3135.746) (-3131.621) (-3139.693) [-3131.211] * (-3131.806) (-3140.477) [-3134.603] (-3136.534) -- 0:00:59 686000 -- (-3140.521) (-3133.544) (-3135.426) [-3132.841] * (-3136.400) (-3139.927) (-3137.778) [-3131.670] -- 0:00:59 686500 -- (-3143.053) [-3135.089] (-3137.005) (-3134.411) * (-3143.888) (-3145.925) [-3133.611] (-3132.955) -- 0:00:59 687000 -- (-3149.691) (-3141.250) (-3131.361) [-3133.626] * (-3142.532) (-3138.707) [-3131.758] (-3138.943) -- 0:00:59 687500 -- (-3144.274) (-3139.763) [-3136.200] (-3132.560) * (-3138.908) [-3136.943] (-3140.105) (-3132.809) -- 0:00:59 688000 -- (-3135.566) (-3137.610) (-3141.462) [-3132.414] * (-3135.513) (-3133.952) (-3144.956) [-3135.020] -- 0:00:59 688500 -- (-3132.723) [-3134.383] (-3135.245) (-3137.509) * [-3134.408] (-3137.142) (-3140.574) (-3134.005) -- 0:00:59 689000 -- (-3143.209) (-3137.074) (-3139.312) [-3132.280] * [-3137.532] (-3138.798) (-3133.036) (-3129.496) -- 0:00:59 689500 -- (-3138.805) [-3140.211] (-3138.191) (-3133.483) * (-3134.185) [-3130.476] (-3136.129) (-3138.195) -- 0:00:58 690000 -- (-3137.339) (-3136.973) [-3140.542] (-3136.224) * (-3134.204) (-3132.489) (-3134.333) [-3132.285] -- 0:00:58 Average standard deviation of split frequencies: 0.000000 690500 -- (-3138.522) [-3133.647] (-3137.700) (-3135.559) * (-3136.719) (-3131.404) (-3135.591) [-3132.580] -- 0:00:58 691000 -- [-3137.955] (-3136.893) (-3132.457) (-3135.815) * [-3140.674] (-3138.274) (-3131.784) (-3136.412) -- 0:00:58 691500 -- (-3132.388) (-3142.449) (-3138.949) [-3134.992] * (-3131.418) (-3135.837) [-3133.083] (-3133.466) -- 0:00:58 692000 -- (-3135.373) [-3137.405] (-3145.904) (-3145.775) * (-3132.688) (-3136.176) [-3134.318] (-3136.553) -- 0:00:58 692500 -- (-3135.941) (-3140.858) (-3136.613) [-3131.422] * [-3134.034] (-3133.592) (-3136.309) (-3144.551) -- 0:00:58 693000 -- (-3136.817) (-3137.218) (-3133.966) [-3131.532] * (-3140.579) [-3133.746] (-3136.716) (-3134.267) -- 0:00:58 693500 -- (-3133.299) [-3141.830] (-3135.793) (-3134.432) * (-3132.381) (-3138.808) [-3135.245] (-3134.018) -- 0:00:58 694000 -- (-3133.002) [-3145.573] (-3146.542) (-3132.033) * (-3143.466) [-3134.090] (-3135.063) (-3141.069) -- 0:00:58 694500 -- [-3133.444] (-3134.368) (-3134.860) (-3139.618) * (-3142.749) (-3135.158) [-3137.581] (-3143.424) -- 0:00:58 695000 -- (-3136.434) [-3142.433] (-3133.018) (-3132.263) * (-3137.829) (-3136.798) (-3135.208) [-3138.585] -- 0:00:57 Average standard deviation of split frequencies: 0.000000 695500 -- (-3136.846) (-3141.735) [-3133.817] (-3135.744) * (-3133.476) [-3134.274] (-3133.759) (-3132.874) -- 0:00:57 696000 -- [-3129.935] (-3139.410) (-3137.007) (-3141.067) * (-3133.128) (-3132.172) [-3133.634] (-3132.985) -- 0:00:57 696500 -- (-3134.971) (-3134.733) [-3131.602] (-3138.337) * [-3136.778] (-3136.032) (-3134.110) (-3135.692) -- 0:00:57 697000 -- [-3136.084] (-3138.106) (-3139.124) (-3142.636) * (-3134.831) (-3141.320) (-3136.979) [-3133.404] -- 0:00:57 697500 -- (-3136.782) (-3130.320) [-3140.497] (-3133.049) * (-3136.210) (-3135.134) (-3140.538) [-3135.818] -- 0:00:57 698000 -- (-3134.153) (-3137.924) (-3134.355) [-3134.698] * (-3140.978) [-3132.175] (-3136.524) (-3132.634) -- 0:00:57 698500 -- (-3133.127) (-3132.798) (-3139.894) [-3133.007] * (-3135.910) [-3136.340] (-3139.394) (-3138.773) -- 0:00:57 699000 -- (-3138.170) (-3132.602) [-3133.502] (-3138.803) * (-3139.801) [-3133.617] (-3138.018) (-3136.476) -- 0:00:57 699500 -- [-3136.134] (-3135.565) (-3137.039) (-3137.433) * [-3135.660] (-3138.162) (-3141.013) (-3136.481) -- 0:00:57 700000 -- (-3140.966) (-3132.390) [-3136.380] (-3143.835) * (-3139.248) (-3141.813) [-3135.568] (-3134.583) -- 0:00:57 Average standard deviation of split frequencies: 0.000000 700500 -- [-3137.934] (-3136.974) (-3133.988) (-3140.438) * (-3132.862) [-3136.602] (-3135.086) (-3138.674) -- 0:00:56 701000 -- [-3129.764] (-3135.227) (-3137.815) (-3136.229) * (-3132.756) [-3134.106] (-3138.514) (-3135.217) -- 0:00:56 701500 -- (-3134.333) (-3131.878) (-3133.997) [-3137.721] * (-3136.237) (-3140.620) [-3133.597] (-3134.502) -- 0:00:56 702000 -- [-3132.373] (-3132.097) (-3137.195) (-3134.470) * [-3132.131] (-3134.209) (-3131.429) (-3133.767) -- 0:00:56 702500 -- (-3134.224) (-3135.551) [-3133.552] (-3139.469) * [-3137.293] (-3143.289) (-3135.481) (-3141.779) -- 0:00:56 703000 -- [-3136.576] (-3133.579) (-3129.854) (-3132.459) * [-3134.012] (-3133.916) (-3133.825) (-3133.077) -- 0:00:56 703500 -- (-3133.544) [-3139.176] (-3135.906) (-3134.597) * [-3134.608] (-3134.141) (-3133.940) (-3135.445) -- 0:00:56 704000 -- (-3132.808) (-3137.146) [-3134.465] (-3135.313) * (-3133.481) [-3133.677] (-3134.490) (-3137.548) -- 0:00:56 704500 -- (-3136.725) (-3135.302) [-3134.101] (-3130.691) * (-3137.954) [-3134.900] (-3138.627) (-3131.400) -- 0:00:56 705000 -- [-3132.779] (-3131.663) (-3135.805) (-3137.440) * (-3133.942) (-3135.086) (-3137.458) [-3132.550] -- 0:00:56 Average standard deviation of split frequencies: 0.000000 705500 -- (-3140.547) [-3131.176] (-3143.829) (-3137.062) * [-3145.141] (-3134.473) (-3133.304) (-3132.466) -- 0:00:55 706000 -- (-3136.361) [-3132.130] (-3146.565) (-3138.675) * (-3135.525) (-3132.818) (-3134.583) [-3131.142] -- 0:00:55 706500 -- (-3129.384) [-3134.323] (-3137.069) (-3139.372) * (-3138.314) (-3139.656) (-3132.794) [-3133.973] -- 0:00:55 707000 -- (-3135.656) [-3136.182] (-3138.842) (-3138.075) * (-3132.477) (-3139.782) (-3136.828) [-3144.532] -- 0:00:55 707500 -- (-3134.925) (-3132.836) (-3142.437) [-3135.298] * (-3140.002) (-3142.765) [-3139.623] (-3136.405) -- 0:00:55 708000 -- (-3140.660) [-3133.122] (-3141.699) (-3133.959) * [-3130.763] (-3134.489) (-3134.656) (-3139.886) -- 0:00:55 708500 -- (-3142.493) (-3137.846) [-3134.111] (-3139.938) * [-3132.213] (-3139.876) (-3134.165) (-3139.407) -- 0:00:55 709000 -- (-3138.521) (-3142.083) (-3138.652) [-3132.986] * (-3143.451) (-3137.547) (-3137.425) [-3138.872] -- 0:00:55 709500 -- (-3140.273) (-3139.945) (-3137.731) [-3132.109] * (-3139.073) (-3134.571) [-3132.555] (-3134.825) -- 0:00:55 710000 -- (-3137.946) [-3141.390] (-3135.480) (-3136.856) * [-3139.947] (-3139.142) (-3134.753) (-3133.000) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 710500 -- (-3139.085) (-3142.844) [-3137.888] (-3135.802) * [-3132.884] (-3134.798) (-3139.004) (-3135.763) -- 0:00:55 711000 -- (-3141.158) (-3135.446) [-3132.530] (-3135.133) * [-3132.250] (-3139.445) (-3134.977) (-3133.450) -- 0:00:54 711500 -- (-3139.179) (-3136.540) [-3137.138] (-3134.938) * (-3132.357) [-3137.850] (-3133.897) (-3136.968) -- 0:00:54 712000 -- (-3141.125) (-3135.595) [-3135.921] (-3133.294) * (-3134.716) (-3139.237) (-3130.638) [-3131.851] -- 0:00:54 712500 -- (-3140.064) (-3135.548) (-3134.597) [-3136.315] * (-3133.972) [-3140.425] (-3142.719) (-3132.804) -- 0:00:54 713000 -- [-3135.487] (-3140.978) (-3137.292) (-3133.218) * (-3135.048) (-3136.957) [-3135.200] (-3133.837) -- 0:00:54 713500 -- (-3134.785) [-3134.038] (-3139.096) (-3132.549) * (-3135.327) (-3135.459) (-3136.542) [-3140.855] -- 0:00:54 714000 -- (-3134.933) (-3132.256) [-3135.158] (-3132.861) * (-3134.891) [-3133.400] (-3141.225) (-3136.077) -- 0:00:54 714500 -- [-3137.956] (-3132.912) (-3136.658) (-3143.250) * (-3132.620) [-3138.526] (-3136.341) (-3136.886) -- 0:00:54 715000 -- (-3138.156) [-3141.485] (-3139.046) (-3134.043) * (-3133.549) (-3135.875) (-3138.388) [-3135.481] -- 0:00:54 Average standard deviation of split frequencies: 0.000000 715500 -- (-3134.376) [-3136.416] (-3134.985) (-3137.310) * (-3137.067) [-3133.923] (-3139.889) (-3134.813) -- 0:00:54 716000 -- (-3134.843) [-3134.806] (-3133.678) (-3136.219) * [-3134.054] (-3136.568) (-3130.922) (-3138.342) -- 0:00:53 716500 -- [-3137.813] (-3138.099) (-3134.564) (-3133.284) * (-3133.530) [-3136.204] (-3140.174) (-3145.602) -- 0:00:53 717000 -- (-3133.373) [-3133.512] (-3133.571) (-3135.233) * (-3137.548) (-3131.510) (-3133.284) [-3138.309] -- 0:00:53 717500 -- [-3133.855] (-3133.662) (-3135.699) (-3142.483) * (-3137.668) (-3136.577) [-3136.815] (-3138.272) -- 0:00:53 718000 -- (-3132.020) [-3138.317] (-3132.693) (-3137.780) * (-3139.444) (-3132.922) (-3133.507) [-3130.631] -- 0:00:53 718500 -- (-3137.460) (-3141.763) (-3132.295) [-3135.757] * [-3133.835] (-3135.013) (-3139.983) (-3133.258) -- 0:00:53 719000 -- [-3133.751] (-3132.608) (-3136.540) (-3144.704) * (-3133.927) (-3136.572) (-3145.396) [-3134.627] -- 0:00:53 719500 -- (-3136.208) (-3136.119) (-3132.682) [-3132.280] * (-3137.099) (-3131.488) [-3132.112] (-3135.223) -- 0:00:53 720000 -- (-3140.337) (-3137.815) [-3133.398] (-3139.959) * (-3144.092) [-3131.163] (-3134.869) (-3133.187) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 720500 -- (-3135.820) [-3131.422] (-3139.381) (-3133.125) * [-3133.414] (-3140.643) (-3133.445) (-3135.437) -- 0:00:53 721000 -- (-3132.318) [-3140.900] (-3140.783) (-3134.505) * (-3138.219) (-3139.506) [-3134.639] (-3134.949) -- 0:00:53 721500 -- [-3135.402] (-3131.523) (-3138.324) (-3138.951) * [-3135.144] (-3142.849) (-3132.993) (-3133.549) -- 0:00:52 722000 -- (-3135.857) (-3137.506) (-3138.853) [-3140.055] * (-3137.350) (-3140.600) [-3137.661] (-3142.920) -- 0:00:52 722500 -- [-3132.199] (-3132.415) (-3134.807) (-3134.411) * (-3135.738) (-3138.169) [-3133.065] (-3136.737) -- 0:00:52 723000 -- [-3132.464] (-3139.287) (-3136.988) (-3136.780) * [-3133.860] (-3143.550) (-3136.540) (-3131.353) -- 0:00:52 723500 -- (-3136.393) [-3130.787] (-3134.005) (-3134.057) * (-3138.329) (-3139.190) [-3131.131] (-3135.346) -- 0:00:52 724000 -- (-3134.084) [-3132.434] (-3137.767) (-3129.593) * (-3135.964) (-3139.745) [-3138.164] (-3129.916) -- 0:00:52 724500 -- (-3135.376) (-3138.322) (-3134.713) [-3132.585] * (-3135.264) [-3132.564] (-3140.523) (-3133.048) -- 0:00:52 725000 -- [-3135.957] (-3139.344) (-3130.280) (-3138.081) * (-3133.901) (-3140.002) (-3134.290) [-3136.404] -- 0:00:52 Average standard deviation of split frequencies: 0.000000 725500 -- (-3135.633) (-3145.552) (-3133.538) [-3135.486] * [-3136.014] (-3139.514) (-3136.111) (-3137.792) -- 0:00:52 726000 -- (-3137.851) (-3139.944) (-3138.220) [-3138.082] * (-3134.965) [-3133.924] (-3133.440) (-3133.544) -- 0:00:52 726500 -- (-3136.341) (-3134.199) [-3132.815] (-3134.553) * [-3132.745] (-3129.845) (-3131.176) (-3144.341) -- 0:00:51 727000 -- [-3132.212] (-3133.507) (-3130.428) (-3140.487) * [-3131.765] (-3131.770) (-3137.563) (-3132.788) -- 0:00:51 727500 -- (-3141.896) [-3137.092] (-3132.753) (-3138.370) * (-3132.633) [-3137.541] (-3131.242) (-3133.877) -- 0:00:51 728000 -- [-3138.039] (-3137.549) (-3130.962) (-3131.889) * (-3133.459) (-3132.165) [-3135.667] (-3140.419) -- 0:00:51 728500 -- [-3131.843] (-3138.094) (-3136.969) (-3134.743) * (-3133.394) [-3134.374] (-3137.182) (-3139.445) -- 0:00:51 729000 -- (-3135.381) [-3141.277] (-3134.895) (-3132.712) * (-3135.196) (-3128.765) [-3138.387] (-3133.995) -- 0:00:51 729500 -- [-3139.490] (-3140.131) (-3140.775) (-3135.273) * (-3137.087) [-3131.538] (-3137.878) (-3131.611) -- 0:00:51 730000 -- [-3134.934] (-3134.823) (-3133.141) (-3135.841) * (-3135.112) (-3129.847) (-3134.331) [-3134.951] -- 0:00:51 Average standard deviation of split frequencies: 0.000000 730500 -- [-3132.396] (-3137.182) (-3136.368) (-3135.958) * (-3133.603) (-3139.027) (-3135.865) [-3131.995] -- 0:00:51 731000 -- (-3138.110) (-3142.405) (-3139.897) [-3132.714] * [-3142.258] (-3133.783) (-3139.602) (-3135.739) -- 0:00:51 731500 -- (-3135.870) (-3135.662) [-3135.314] (-3135.778) * (-3133.384) [-3131.912] (-3132.349) (-3135.818) -- 0:00:51 732000 -- (-3132.168) [-3137.174] (-3137.180) (-3140.596) * (-3139.289) (-3134.259) (-3137.661) [-3137.997] -- 0:00:50 732500 -- (-3134.241) (-3133.728) (-3135.072) [-3136.749] * [-3136.663] (-3136.426) (-3134.183) (-3136.409) -- 0:00:50 733000 -- (-3138.957) (-3132.368) [-3135.273] (-3137.757) * (-3136.966) (-3134.837) [-3132.995] (-3133.067) -- 0:00:50 733500 -- (-3137.360) [-3132.701] (-3141.201) (-3134.214) * (-3133.892) (-3137.562) [-3135.998] (-3134.257) -- 0:00:50 734000 -- (-3144.268) (-3133.000) [-3134.370] (-3142.098) * [-3133.803] (-3134.913) (-3131.922) (-3141.767) -- 0:00:50 734500 -- (-3141.107) (-3140.820) (-3138.077) [-3135.051] * (-3134.860) (-3136.415) (-3142.801) [-3138.283] -- 0:00:50 735000 -- [-3137.545] (-3135.975) (-3131.810) (-3140.608) * (-3136.918) (-3136.868) (-3142.847) [-3137.448] -- 0:00:50 Average standard deviation of split frequencies: 0.000000 735500 -- (-3136.146) [-3134.530] (-3136.357) (-3136.909) * (-3134.794) (-3135.422) (-3132.113) [-3135.383] -- 0:00:50 736000 -- [-3132.937] (-3138.158) (-3138.069) (-3134.984) * (-3135.244) (-3131.983) [-3134.239] (-3133.721) -- 0:00:50 736500 -- (-3136.342) (-3132.190) [-3132.429] (-3138.303) * (-3140.137) [-3129.635] (-3134.944) (-3131.666) -- 0:00:50 737000 -- (-3130.746) (-3135.657) (-3132.155) [-3135.400] * (-3136.645) [-3132.808] (-3131.508) (-3139.195) -- 0:00:49 737500 -- (-3132.644) (-3138.032) [-3131.601] (-3135.555) * [-3132.073] (-3145.241) (-3138.081) (-3142.577) -- 0:00:49 738000 -- (-3140.827) [-3135.855] (-3139.866) (-3136.177) * (-3133.637) [-3137.875] (-3129.614) (-3139.686) -- 0:00:49 738500 -- (-3131.036) (-3136.214) [-3129.927] (-3135.565) * (-3133.893) (-3140.148) [-3130.856] (-3131.366) -- 0:00:49 739000 -- (-3130.175) [-3132.804] (-3146.963) (-3135.698) * [-3131.265] (-3134.078) (-3137.074) (-3135.929) -- 0:00:49 739500 -- (-3140.433) (-3139.797) [-3135.880] (-3139.870) * (-3132.429) (-3147.546) [-3134.733] (-3134.243) -- 0:00:49 740000 -- (-3134.132) [-3132.560] (-3139.619) (-3134.073) * (-3136.872) [-3133.681] (-3140.824) (-3134.671) -- 0:00:49 Average standard deviation of split frequencies: 0.000000 740500 -- (-3135.241) (-3141.121) [-3138.060] (-3135.236) * (-3137.795) [-3136.509] (-3133.911) (-3137.102) -- 0:00:49 741000 -- (-3135.300) [-3137.005] (-3135.873) (-3135.015) * (-3136.532) (-3133.654) [-3136.599] (-3135.821) -- 0:00:49 741500 -- (-3134.720) (-3141.980) [-3133.399] (-3135.467) * [-3135.132] (-3138.460) (-3131.777) (-3133.197) -- 0:00:49 742000 -- [-3138.062] (-3135.043) (-3138.826) (-3138.423) * (-3142.118) (-3134.484) (-3137.400) [-3136.193] -- 0:00:49 742500 -- [-3132.859] (-3137.232) (-3139.103) (-3140.087) * (-3134.476) (-3134.257) [-3132.831] (-3133.378) -- 0:00:48 743000 -- (-3139.702) (-3132.948) [-3136.038] (-3133.871) * [-3135.210] (-3134.135) (-3138.238) (-3133.815) -- 0:00:48 743500 -- [-3138.458] (-3130.390) (-3141.340) (-3133.462) * (-3133.012) (-3135.574) (-3132.555) [-3133.486] -- 0:00:48 744000 -- (-3134.743) (-3136.476) [-3133.148] (-3132.586) * (-3132.589) (-3141.486) (-3134.044) [-3132.583] -- 0:00:48 744500 -- [-3139.770] (-3133.722) (-3133.978) (-3132.682) * (-3133.451) [-3136.783] (-3134.679) (-3137.059) -- 0:00:48 745000 -- (-3138.928) [-3132.839] (-3132.963) (-3132.712) * (-3133.775) (-3137.355) [-3131.077] (-3144.345) -- 0:00:48 Average standard deviation of split frequencies: 0.000000 745500 -- (-3135.317) (-3133.424) [-3135.679] (-3139.623) * [-3130.866] (-3134.908) (-3139.050) (-3134.430) -- 0:00:48 746000 -- (-3138.449) (-3135.777) [-3135.012] (-3140.514) * (-3144.656) (-3136.673) [-3133.438] (-3140.241) -- 0:00:48 746500 -- (-3135.788) (-3134.071) (-3136.502) [-3134.527] * (-3133.278) [-3132.952] (-3131.506) (-3136.621) -- 0:00:48 747000 -- (-3134.347) [-3139.948] (-3134.166) (-3136.032) * (-3136.721) [-3130.689] (-3133.029) (-3134.952) -- 0:00:48 747500 -- [-3133.395] (-3136.068) (-3139.158) (-3138.825) * (-3130.392) (-3140.877) [-3134.478] (-3138.224) -- 0:00:47 748000 -- [-3133.323] (-3145.992) (-3136.125) (-3134.952) * [-3134.009] (-3140.572) (-3138.547) (-3138.220) -- 0:00:47 748500 -- (-3140.793) (-3142.316) (-3137.073) [-3131.060] * [-3134.912] (-3140.297) (-3133.733) (-3137.630) -- 0:00:47 749000 -- (-3139.904) [-3134.568] (-3136.062) (-3130.699) * [-3133.739] (-3133.795) (-3139.576) (-3136.266) -- 0:00:47 749500 -- (-3133.789) (-3137.730) [-3135.961] (-3138.620) * (-3138.455) (-3137.693) [-3135.650] (-3131.651) -- 0:00:47 750000 -- (-3136.878) (-3137.116) (-3144.249) [-3136.693] * (-3138.868) (-3138.567) [-3133.286] (-3131.903) -- 0:00:47 Average standard deviation of split frequencies: 0.000000 750500 -- (-3136.561) (-3133.669) (-3141.533) [-3131.981] * [-3133.921] (-3136.327) (-3132.898) (-3138.844) -- 0:00:47 751000 -- (-3131.671) (-3138.462) [-3132.938] (-3134.059) * (-3136.887) [-3134.405] (-3144.895) (-3137.995) -- 0:00:47 751500 -- (-3134.205) [-3133.711] (-3135.239) (-3138.645) * (-3136.678) (-3133.454) [-3134.424] (-3139.989) -- 0:00:47 752000 -- (-3136.698) (-3135.621) (-3131.434) [-3136.371] * [-3136.925] (-3135.018) (-3139.178) (-3131.828) -- 0:00:47 752500 -- (-3144.767) (-3135.486) (-3133.591) [-3132.658] * (-3138.015) (-3135.261) [-3134.364] (-3133.798) -- 0:00:47 753000 -- [-3141.453] (-3133.879) (-3132.667) (-3133.388) * [-3134.094] (-3134.557) (-3143.054) (-3139.269) -- 0:00:46 753500 -- (-3148.043) (-3134.440) (-3137.767) [-3133.616] * [-3136.383] (-3135.634) (-3132.293) (-3137.443) -- 0:00:46 754000 -- (-3141.009) [-3137.500] (-3134.192) (-3139.160) * (-3138.905) (-3140.648) (-3138.125) [-3132.934] -- 0:00:46 754500 -- (-3137.699) (-3140.890) [-3133.311] (-3139.606) * (-3134.533) (-3139.598) (-3134.322) [-3133.312] -- 0:00:46 755000 -- (-3143.179) (-3136.448) [-3130.366] (-3138.676) * (-3137.026) (-3137.459) (-3133.711) [-3138.339] -- 0:00:46 Average standard deviation of split frequencies: 0.000000 755500 -- (-3139.054) (-3137.380) (-3136.174) [-3132.629] * (-3136.137) (-3132.369) (-3140.685) [-3135.349] -- 0:00:46 756000 -- (-3129.247) [-3135.085] (-3135.076) (-3133.713) * [-3130.033] (-3131.347) (-3138.282) (-3135.160) -- 0:00:46 756500 -- (-3130.877) (-3134.944) (-3134.743) [-3131.369] * [-3133.148] (-3135.064) (-3138.447) (-3137.745) -- 0:00:46 757000 -- (-3136.029) [-3139.790] (-3138.743) (-3133.242) * (-3135.523) (-3134.617) (-3138.235) [-3135.207] -- 0:00:46 757500 -- (-3139.810) [-3137.419] (-3142.662) (-3129.902) * [-3137.388] (-3134.455) (-3136.273) (-3137.383) -- 0:00:46 758000 -- (-3131.691) [-3143.477] (-3147.677) (-3133.525) * [-3134.134] (-3136.053) (-3134.304) (-3134.772) -- 0:00:45 758500 -- (-3134.058) [-3136.631] (-3146.669) (-3146.112) * (-3136.076) (-3141.329) (-3131.937) [-3137.098] -- 0:00:45 759000 -- (-3136.064) [-3132.479] (-3131.599) (-3137.872) * (-3134.760) (-3136.036) [-3131.928] (-3142.770) -- 0:00:45 759500 -- [-3133.222] (-3138.518) (-3133.106) (-3134.025) * (-3137.265) (-3138.286) [-3136.931] (-3139.262) -- 0:00:45 760000 -- (-3137.775) (-3134.068) (-3134.088) [-3136.275] * (-3143.352) (-3131.544) (-3138.228) [-3133.995] -- 0:00:45 Average standard deviation of split frequencies: 0.000000 760500 -- (-3140.656) (-3139.425) [-3134.132] (-3136.795) * (-3136.409) (-3135.656) [-3144.476] (-3139.956) -- 0:00:45 761000 -- [-3132.828] (-3133.605) (-3132.195) (-3133.735) * [-3133.870] (-3134.777) (-3136.574) (-3138.826) -- 0:00:45 761500 -- (-3135.986) (-3139.467) [-3134.558] (-3133.643) * (-3135.866) (-3134.628) [-3134.986] (-3134.801) -- 0:00:45 762000 -- (-3140.389) (-3136.507) [-3129.462] (-3131.281) * (-3137.865) [-3132.605] (-3135.549) (-3135.624) -- 0:00:45 762500 -- (-3132.604) (-3132.813) (-3134.428) [-3133.114] * (-3136.791) (-3136.009) (-3133.263) [-3135.860] -- 0:00:45 763000 -- (-3135.900) [-3133.984] (-3136.537) (-3135.245) * (-3136.942) [-3132.343] (-3134.844) (-3133.542) -- 0:00:45 763500 -- [-3132.003] (-3133.626) (-3140.819) (-3142.864) * (-3138.949) (-3134.441) [-3133.315] (-3138.131) -- 0:00:44 764000 -- (-3135.549) [-3133.080] (-3131.628) (-3135.146) * [-3135.666] (-3135.316) (-3135.091) (-3134.279) -- 0:00:44 764500 -- [-3134.562] (-3136.036) (-3136.359) (-3132.952) * (-3143.423) (-3139.195) (-3134.505) [-3133.470] -- 0:00:44 765000 -- (-3132.769) (-3132.613) (-3132.913) [-3133.971] * [-3134.792] (-3135.680) (-3138.586) (-3146.959) -- 0:00:44 Average standard deviation of split frequencies: 0.000000 765500 -- (-3133.803) (-3139.775) (-3132.838) [-3133.775] * (-3138.632) [-3133.921] (-3134.296) (-3139.267) -- 0:00:44 766000 -- [-3135.249] (-3133.988) (-3136.236) (-3132.853) * [-3131.497] (-3135.403) (-3135.776) (-3140.219) -- 0:00:44 766500 -- [-3133.926] (-3133.034) (-3137.593) (-3136.839) * (-3140.337) (-3140.061) (-3137.841) [-3135.376] -- 0:00:44 767000 -- (-3136.167) [-3133.724] (-3138.445) (-3136.810) * [-3135.194] (-3144.379) (-3140.514) (-3134.934) -- 0:00:44 767500 -- (-3132.982) [-3132.138] (-3135.328) (-3142.552) * (-3133.305) (-3136.004) (-3135.361) [-3134.038] -- 0:00:44 768000 -- (-3137.960) (-3140.231) [-3134.685] (-3140.299) * [-3136.177] (-3135.562) (-3136.849) (-3137.711) -- 0:00:44 768500 -- (-3139.601) [-3134.284] (-3132.792) (-3139.585) * (-3138.016) [-3132.672] (-3136.570) (-3138.447) -- 0:00:43 769000 -- (-3133.156) (-3133.926) (-3137.778) [-3136.187] * (-3132.834) [-3133.203] (-3140.802) (-3132.489) -- 0:00:43 769500 -- (-3145.379) (-3135.667) [-3135.099] (-3130.446) * [-3134.499] (-3137.795) (-3133.194) (-3136.409) -- 0:00:43 770000 -- [-3133.953] (-3137.717) (-3136.737) (-3131.786) * (-3132.087) [-3130.964] (-3135.224) (-3130.415) -- 0:00:43 Average standard deviation of split frequencies: 0.000000 770500 -- (-3133.709) (-3135.586) (-3137.957) [-3132.375] * (-3133.547) (-3133.593) [-3133.503] (-3130.941) -- 0:00:43 771000 -- (-3130.084) (-3135.578) (-3131.049) [-3135.206] * (-3134.529) (-3139.496) (-3132.749) [-3136.148] -- 0:00:43 771500 -- (-3135.848) [-3135.764] (-3131.508) (-3135.551) * (-3139.550) (-3133.399) [-3135.698] (-3133.125) -- 0:00:43 772000 -- (-3133.114) [-3137.719] (-3133.179) (-3136.897) * (-3130.962) [-3132.007] (-3138.145) (-3133.513) -- 0:00:43 772500 -- (-3136.826) (-3139.225) [-3131.822] (-3135.140) * (-3136.360) (-3138.032) (-3151.200) [-3132.372] -- 0:00:43 773000 -- (-3135.848) (-3139.091) (-3137.200) [-3133.469] * [-3132.532] (-3134.386) (-3136.901) (-3136.842) -- 0:00:43 773500 -- [-3134.917] (-3141.385) (-3135.650) (-3134.677) * (-3137.660) (-3135.412) [-3130.909] (-3137.357) -- 0:00:43 774000 -- (-3136.580) (-3140.707) (-3135.647) [-3134.520] * (-3143.400) (-3134.854) (-3132.122) [-3135.333] -- 0:00:42 774500 -- (-3146.028) (-3139.060) (-3135.961) [-3134.561] * (-3134.798) (-3134.742) (-3137.973) [-3134.153] -- 0:00:42 775000 -- [-3135.516] (-3142.101) (-3133.128) (-3134.723) * [-3134.718] (-3137.338) (-3139.239) (-3133.485) -- 0:00:42 Average standard deviation of split frequencies: 0.000000 775500 -- [-3134.805] (-3136.337) (-3131.804) (-3134.703) * [-3131.040] (-3138.267) (-3134.669) (-3133.743) -- 0:00:42 776000 -- (-3137.470) [-3135.613] (-3133.182) (-3140.255) * (-3136.515) (-3135.720) (-3138.472) [-3138.422] -- 0:00:42 776500 -- [-3131.951] (-3134.240) (-3138.472) (-3134.924) * [-3134.854] (-3139.359) (-3138.802) (-3137.199) -- 0:00:42 777000 -- (-3133.451) (-3136.675) [-3131.626] (-3135.217) * (-3130.826) (-3133.893) (-3136.195) [-3136.750] -- 0:00:42 777500 -- (-3130.704) [-3132.521] (-3143.776) (-3145.351) * (-3135.138) [-3134.061] (-3136.243) (-3133.501) -- 0:00:42 778000 -- [-3134.710] (-3135.789) (-3139.495) (-3132.133) * (-3131.472) (-3139.292) (-3134.427) [-3133.952] -- 0:00:42 778500 -- (-3134.440) [-3134.781] (-3136.635) (-3136.170) * [-3134.801] (-3140.622) (-3133.022) (-3144.193) -- 0:00:42 779000 -- (-3134.963) (-3137.633) (-3130.100) [-3130.791] * (-3133.106) [-3138.359] (-3132.581) (-3140.407) -- 0:00:41 779500 -- (-3136.054) (-3133.686) [-3138.470] (-3131.751) * (-3131.585) (-3133.668) (-3134.046) [-3133.390] -- 0:00:41 780000 -- (-3136.279) [-3132.403] (-3134.783) (-3133.125) * [-3132.307] (-3136.901) (-3130.529) (-3134.479) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 780500 -- (-3137.424) [-3132.300] (-3137.446) (-3137.492) * [-3134.988] (-3142.443) (-3134.650) (-3134.810) -- 0:00:41 781000 -- (-3134.582) (-3141.950) (-3136.762) [-3130.941] * (-3134.412) [-3134.564] (-3132.581) (-3136.570) -- 0:00:41 781500 -- [-3138.056] (-3139.073) (-3139.527) (-3143.040) * [-3134.634] (-3133.668) (-3133.161) (-3134.061) -- 0:00:41 782000 -- (-3142.094) [-3136.457] (-3136.399) (-3134.231) * (-3132.187) (-3130.680) (-3133.635) [-3140.152] -- 0:00:41 782500 -- (-3137.777) (-3133.908) (-3136.555) [-3135.795] * (-3138.226) (-3135.332) (-3134.133) [-3132.568] -- 0:00:41 783000 -- (-3137.462) [-3137.175] (-3138.684) (-3134.656) * (-3146.337) (-3131.988) [-3137.090] (-3135.119) -- 0:00:41 783500 -- (-3135.802) (-3143.849) [-3134.579] (-3132.968) * [-3142.662] (-3138.642) (-3136.981) (-3131.630) -- 0:00:41 784000 -- [-3133.867] (-3132.979) (-3148.802) (-3136.365) * [-3137.386] (-3143.633) (-3131.089) (-3134.685) -- 0:00:41 784500 -- (-3135.734) [-3136.663] (-3140.341) (-3137.036) * (-3135.966) [-3130.298] (-3132.113) (-3137.815) -- 0:00:40 785000 -- [-3134.742] (-3133.359) (-3132.886) (-3133.644) * (-3142.055) [-3131.714] (-3138.265) (-3139.295) -- 0:00:40 Average standard deviation of split frequencies: 0.000000 785500 -- [-3130.896] (-3141.401) (-3138.763) (-3145.338) * (-3133.142) [-3134.846] (-3132.460) (-3131.389) -- 0:00:40 786000 -- [-3133.953] (-3131.506) (-3136.391) (-3138.337) * (-3130.573) [-3133.714] (-3139.451) (-3133.925) -- 0:00:40 786500 -- (-3134.318) (-3133.470) [-3132.998] (-3134.932) * (-3133.983) (-3137.527) (-3132.997) [-3137.001] -- 0:00:40 787000 -- (-3132.997) (-3136.145) [-3132.958] (-3138.373) * [-3135.370] (-3137.606) (-3139.470) (-3133.301) -- 0:00:40 787500 -- (-3138.068) (-3137.061) (-3132.050) [-3134.160] * (-3141.077) [-3134.084] (-3135.514) (-3135.007) -- 0:00:40 788000 -- (-3135.815) [-3138.486] (-3137.174) (-3137.282) * [-3139.525] (-3135.349) (-3134.456) (-3133.544) -- 0:00:40 788500 -- (-3133.283) [-3135.643] (-3142.566) (-3134.063) * (-3140.038) (-3135.667) (-3142.240) [-3137.837] -- 0:00:40 789000 -- (-3137.099) (-3134.179) (-3146.339) [-3135.036] * (-3133.094) (-3138.318) (-3140.807) [-3143.498] -- 0:00:40 789500 -- (-3140.578) (-3138.127) [-3136.521] (-3134.071) * (-3141.232) (-3141.574) [-3138.673] (-3132.183) -- 0:00:39 790000 -- (-3135.785) (-3139.513) [-3139.412] (-3133.424) * [-3137.985] (-3137.980) (-3135.154) (-3134.121) -- 0:00:39 Average standard deviation of split frequencies: 0.000000 790500 -- (-3133.544) (-3134.823) (-3136.856) [-3136.024] * (-3138.892) (-3142.852) [-3138.389] (-3134.856) -- 0:00:39 791000 -- [-3134.179] (-3138.318) (-3135.423) (-3130.392) * (-3136.912) (-3137.084) (-3134.651) [-3134.197] -- 0:00:39 791500 -- (-3135.529) (-3137.352) [-3136.163] (-3133.899) * (-3137.310) (-3131.840) [-3136.010] (-3138.330) -- 0:00:39 792000 -- (-3137.930) (-3136.892) [-3140.167] (-3135.791) * (-3135.406) [-3133.095] (-3132.500) (-3136.390) -- 0:00:39 792500 -- [-3133.187] (-3136.096) (-3136.012) (-3138.822) * (-3137.193) (-3139.341) [-3135.916] (-3135.854) -- 0:00:39 793000 -- (-3134.040) (-3136.606) [-3141.547] (-3143.260) * (-3140.435) (-3136.291) (-3134.245) [-3134.315] -- 0:00:39 793500 -- [-3133.589] (-3138.286) (-3135.195) (-3136.262) * [-3135.998] (-3132.964) (-3136.398) (-3134.150) -- 0:00:39 794000 -- [-3134.329] (-3134.412) (-3140.816) (-3138.181) * (-3133.868) (-3135.674) (-3139.565) [-3134.459] -- 0:00:39 794500 -- (-3141.093) (-3131.217) (-3142.680) [-3137.984] * (-3135.411) (-3134.964) [-3135.422] (-3136.601) -- 0:00:39 795000 -- (-3134.762) (-3134.223) [-3135.770] (-3136.685) * [-3135.069] (-3140.482) (-3139.261) (-3144.022) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 795500 -- (-3138.941) (-3139.245) (-3136.104) [-3132.262] * (-3131.734) (-3135.170) (-3135.622) [-3129.995] -- 0:00:38 796000 -- [-3138.773] (-3133.659) (-3137.526) (-3137.777) * (-3139.926) (-3135.650) (-3136.459) [-3135.298] -- 0:00:38 796500 -- (-3137.910) (-3141.570) (-3132.654) [-3131.226] * (-3131.646) (-3140.231) [-3137.887] (-3138.644) -- 0:00:38 797000 -- [-3136.891] (-3135.743) (-3135.526) (-3134.963) * [-3134.104] (-3142.502) (-3134.649) (-3136.362) -- 0:00:38 797500 -- (-3136.383) (-3134.155) [-3138.857] (-3135.728) * [-3137.654] (-3138.056) (-3131.823) (-3133.048) -- 0:00:38 798000 -- (-3137.181) [-3137.161] (-3136.287) (-3134.825) * (-3143.103) (-3139.451) [-3134.066] (-3136.451) -- 0:00:38 798500 -- (-3134.597) [-3137.040] (-3137.430) (-3136.236) * (-3142.094) [-3134.158] (-3132.329) (-3138.124) -- 0:00:38 799000 -- (-3139.098) (-3138.158) [-3132.756] (-3139.452) * [-3134.011] (-3132.928) (-3134.574) (-3143.407) -- 0:00:38 799500 -- (-3133.530) [-3135.377] (-3134.900) (-3137.147) * [-3135.403] (-3135.588) (-3135.805) (-3137.469) -- 0:00:38 800000 -- (-3137.070) (-3133.441) (-3134.914) [-3133.999] * (-3133.841) (-3137.624) (-3131.342) [-3131.856] -- 0:00:38 Average standard deviation of split frequencies: 0.000000 800500 -- (-3138.351) (-3139.910) [-3136.282] (-3138.363) * (-3133.966) (-3139.061) [-3134.585] (-3132.575) -- 0:00:37 801000 -- (-3135.343) [-3137.165] (-3131.250) (-3138.469) * (-3137.421) (-3134.590) (-3134.436) [-3136.005] -- 0:00:37 801500 -- (-3139.758) [-3131.700] (-3139.744) (-3136.776) * (-3134.856) [-3136.139] (-3132.978) (-3141.404) -- 0:00:37 802000 -- (-3139.890) (-3134.210) (-3134.306) [-3134.450] * (-3133.176) (-3133.561) (-3136.722) [-3138.060] -- 0:00:37 802500 -- (-3138.058) [-3138.276] (-3134.776) (-3132.338) * [-3134.306] (-3133.757) (-3133.905) (-3136.836) -- 0:00:37 803000 -- [-3135.032] (-3138.171) (-3141.045) (-3134.499) * (-3137.870) (-3132.243) (-3130.243) [-3139.765] -- 0:00:37 803500 -- (-3134.388) (-3137.470) [-3136.121] (-3135.114) * [-3134.037] (-3131.939) (-3135.789) (-3138.522) -- 0:00:37 804000 -- [-3138.751] (-3139.786) (-3130.090) (-3135.545) * (-3134.842) (-3133.191) [-3134.872] (-3136.510) -- 0:00:37 804500 -- (-3143.127) (-3130.320) [-3133.909] (-3135.900) * [-3133.034] (-3134.012) (-3134.870) (-3131.171) -- 0:00:37 805000 -- (-3144.571) (-3132.189) [-3130.968] (-3131.029) * (-3135.668) (-3132.457) (-3137.134) [-3139.643] -- 0:00:37 Average standard deviation of split frequencies: 0.000000 805500 -- (-3138.486) (-3136.028) (-3137.332) [-3135.538] * (-3139.108) (-3139.796) [-3135.269] (-3134.126) -- 0:00:36 806000 -- [-3133.902] (-3133.177) (-3135.025) (-3142.817) * (-3133.986) (-3145.582) [-3134.433] (-3137.261) -- 0:00:36 806500 -- (-3133.352) [-3133.593] (-3143.292) (-3143.471) * (-3134.752) (-3141.811) (-3134.787) [-3143.289] -- 0:00:36 807000 -- (-3140.267) (-3133.285) [-3140.423] (-3137.804) * (-3139.653) (-3134.716) [-3131.984] (-3143.685) -- 0:00:36 807500 -- (-3140.612) [-3135.894] (-3138.812) (-3135.995) * [-3132.605] (-3139.519) (-3133.909) (-3139.889) -- 0:00:36 808000 -- (-3136.126) (-3138.891) (-3136.092) [-3132.841] * (-3142.876) (-3134.494) (-3137.893) [-3133.609] -- 0:00:36 808500 -- (-3143.789) (-3135.939) [-3132.599] (-3132.676) * (-3133.678) (-3131.214) [-3135.645] (-3137.119) -- 0:00:36 809000 -- (-3137.961) (-3135.578) [-3135.239] (-3130.752) * (-3134.340) [-3134.960] (-3135.233) (-3138.346) -- 0:00:36 809500 -- (-3132.282) [-3131.765] (-3138.057) (-3133.430) * [-3135.802] (-3133.509) (-3135.496) (-3134.175) -- 0:00:36 810000 -- [-3138.080] (-3133.479) (-3145.443) (-3135.575) * (-3137.504) [-3137.180] (-3136.747) (-3135.901) -- 0:00:36 Average standard deviation of split frequencies: 0.000000 810500 -- (-3133.457) [-3134.596] (-3142.810) (-3143.783) * (-3133.953) [-3143.964] (-3133.348) (-3136.027) -- 0:00:36 811000 -- [-3135.867] (-3131.690) (-3138.625) (-3136.963) * (-3138.590) (-3137.513) (-3137.798) [-3130.958] -- 0:00:35 811500 -- (-3135.683) (-3134.193) (-3130.884) [-3137.449] * [-3137.532] (-3137.662) (-3134.349) (-3141.876) -- 0:00:35 812000 -- (-3136.899) (-3133.379) (-3135.618) [-3137.476] * (-3140.653) (-3139.112) [-3135.284] (-3135.741) -- 0:00:35 812500 -- (-3135.932) (-3141.713) (-3133.594) [-3141.243] * (-3132.926) (-3147.928) (-3133.452) [-3137.838] -- 0:00:35 813000 -- (-3133.864) [-3134.228] (-3134.202) (-3134.305) * (-3136.898) (-3142.024) [-3131.029] (-3132.569) -- 0:00:35 813500 -- (-3133.373) (-3136.064) (-3136.559) [-3134.019] * [-3133.411] (-3136.767) (-3132.008) (-3134.935) -- 0:00:35 814000 -- (-3135.397) [-3144.754] (-3139.591) (-3140.884) * (-3133.933) (-3135.185) (-3132.707) [-3132.772] -- 0:00:35 814500 -- (-3135.465) (-3142.056) (-3133.847) [-3136.045] * (-3137.557) (-3138.522) [-3130.276] (-3135.328) -- 0:00:35 815000 -- (-3136.482) [-3135.280] (-3135.181) (-3136.495) * (-3139.086) [-3132.947] (-3139.224) (-3134.422) -- 0:00:35 Average standard deviation of split frequencies: 0.000000 815500 -- (-3137.487) (-3137.714) (-3130.298) [-3133.012] * (-3140.715) (-3133.246) (-3134.955) [-3137.482] -- 0:00:35 816000 -- [-3133.623] (-3133.691) (-3134.886) (-3134.512) * (-3133.523) [-3136.914] (-3137.342) (-3137.203) -- 0:00:34 816500 -- (-3136.503) (-3136.517) (-3134.500) [-3137.490] * [-3132.391] (-3134.965) (-3130.792) (-3141.512) -- 0:00:34 817000 -- (-3144.830) [-3133.718] (-3136.026) (-3133.288) * (-3132.523) (-3133.025) [-3136.503] (-3139.751) -- 0:00:34 817500 -- (-3141.205) [-3133.569] (-3138.188) (-3138.558) * (-3135.323) [-3131.922] (-3140.433) (-3137.664) -- 0:00:34 818000 -- (-3142.465) [-3143.641] (-3138.510) (-3136.712) * [-3137.393] (-3137.651) (-3136.082) (-3139.394) -- 0:00:34 818500 -- [-3136.357] (-3140.066) (-3138.732) (-3136.961) * (-3141.732) (-3137.389) [-3133.663] (-3138.549) -- 0:00:34 819000 -- (-3136.558) (-3143.875) (-3135.978) [-3138.640] * (-3139.745) [-3138.873] (-3138.601) (-3135.834) -- 0:00:34 819500 -- (-3140.660) [-3137.271] (-3138.884) (-3137.837) * (-3138.240) (-3137.029) [-3132.240] (-3134.703) -- 0:00:34 820000 -- (-3141.222) [-3142.419] (-3135.663) (-3137.447) * (-3131.597) [-3133.577] (-3133.095) (-3140.407) -- 0:00:34 Average standard deviation of split frequencies: 0.000000 820500 -- (-3136.738) (-3138.549) [-3133.540] (-3141.787) * (-3134.654) (-3135.363) (-3135.500) [-3133.871] -- 0:00:34 821000 -- (-3137.992) (-3140.968) (-3132.378) [-3134.891] * (-3134.441) (-3138.866) [-3131.808] (-3134.603) -- 0:00:34 821500 -- [-3134.164] (-3133.975) (-3135.039) (-3135.750) * (-3132.360) (-3134.593) [-3141.725] (-3139.422) -- 0:00:33 822000 -- (-3140.170) (-3137.586) [-3137.169] (-3132.251) * (-3133.322) (-3138.951) (-3140.026) [-3135.507] -- 0:00:33 822500 -- (-3132.772) (-3133.920) [-3135.435] (-3131.947) * (-3133.236) [-3133.638] (-3139.526) (-3139.726) -- 0:00:33 823000 -- [-3133.493] (-3140.608) (-3133.147) (-3132.322) * [-3133.726] (-3136.155) (-3134.820) (-3144.710) -- 0:00:33 823500 -- (-3134.746) (-3140.368) [-3135.109] (-3143.627) * (-3135.883) (-3133.798) [-3134.133] (-3139.327) -- 0:00:33 824000 -- [-3135.764] (-3135.807) (-3144.003) (-3135.177) * (-3141.638) (-3133.878) [-3133.865] (-3139.272) -- 0:00:33 824500 -- (-3136.773) (-3132.637) [-3135.956] (-3142.728) * (-3137.136) [-3134.388] (-3138.341) (-3139.357) -- 0:00:33 825000 -- (-3136.004) (-3134.718) [-3135.674] (-3142.379) * (-3140.089) [-3136.612] (-3137.301) (-3136.496) -- 0:00:33 Average standard deviation of split frequencies: 0.000000 825500 -- (-3135.722) [-3139.885] (-3142.286) (-3135.108) * (-3147.289) [-3134.303] (-3134.075) (-3137.586) -- 0:00:33 826000 -- (-3135.344) (-3136.465) [-3135.334] (-3137.794) * (-3138.825) (-3135.353) (-3137.331) [-3137.365] -- 0:00:33 826500 -- (-3134.861) (-3132.217) (-3141.784) [-3133.252] * [-3134.912] (-3135.772) (-3135.338) (-3136.800) -- 0:00:32 827000 -- [-3136.539] (-3137.478) (-3135.077) (-3136.237) * (-3133.561) [-3131.555] (-3143.365) (-3134.731) -- 0:00:32 827500 -- (-3139.979) [-3139.236] (-3141.564) (-3138.973) * (-3137.929) [-3137.329] (-3134.010) (-3136.086) -- 0:00:32 828000 -- (-3137.704) (-3131.286) (-3134.839) [-3138.328] * (-3137.236) [-3131.940] (-3133.248) (-3133.252) -- 0:00:32 828500 -- (-3129.933) (-3138.705) [-3133.313] (-3141.486) * (-3134.656) [-3131.467] (-3134.292) (-3136.297) -- 0:00:32 829000 -- (-3146.559) (-3134.273) (-3139.701) [-3136.438] * (-3137.719) [-3134.010] (-3139.669) (-3142.136) -- 0:00:32 829500 -- (-3142.634) (-3142.942) (-3139.256) [-3131.871] * (-3135.091) [-3136.320] (-3145.560) (-3138.404) -- 0:00:32 830000 -- [-3138.644] (-3137.357) (-3132.921) (-3132.612) * (-3133.979) (-3135.978) (-3138.713) [-3134.250] -- 0:00:32 Average standard deviation of split frequencies: 0.000000 830500 -- (-3138.285) (-3137.004) [-3131.548] (-3132.758) * [-3135.129] (-3136.808) (-3137.150) (-3140.792) -- 0:00:32 831000 -- (-3137.093) (-3136.173) [-3133.814] (-3138.718) * (-3138.717) [-3134.062] (-3138.190) (-3136.482) -- 0:00:32 831500 -- (-3133.750) [-3133.870] (-3132.140) (-3132.831) * (-3135.136) (-3137.616) (-3136.436) [-3132.170] -- 0:00:32 832000 -- (-3131.105) (-3137.034) (-3131.239) [-3139.173] * [-3132.449] (-3134.298) (-3131.996) (-3137.514) -- 0:00:31 832500 -- (-3136.060) (-3137.051) (-3135.895) [-3130.708] * (-3134.946) (-3134.857) [-3137.069] (-3139.866) -- 0:00:31 833000 -- (-3140.030) (-3142.087) [-3140.019] (-3129.680) * (-3136.645) (-3134.094) (-3134.119) [-3136.495] -- 0:00:31 833500 -- (-3134.515) [-3137.685] (-3138.314) (-3136.412) * (-3139.080) [-3133.933] (-3143.291) (-3134.933) -- 0:00:31 834000 -- (-3136.246) (-3137.014) [-3135.568] (-3138.114) * (-3137.192) (-3139.359) [-3135.953] (-3137.626) -- 0:00:31 834500 -- (-3137.777) (-3135.090) (-3138.591) [-3133.737] * (-3140.016) [-3135.338] (-3144.255) (-3138.751) -- 0:00:31 835000 -- (-3133.795) (-3132.488) (-3132.816) [-3141.719] * (-3135.893) (-3138.191) (-3137.283) [-3132.598] -- 0:00:31 Average standard deviation of split frequencies: 0.000000 835500 -- [-3131.515] (-3131.294) (-3133.706) (-3138.319) * (-3139.339) (-3138.448) (-3130.997) [-3137.336] -- 0:00:31 836000 -- (-3137.231) [-3135.605] (-3138.138) (-3137.301) * (-3135.245) (-3139.326) [-3133.449] (-3136.700) -- 0:00:31 836500 -- (-3133.545) [-3137.017] (-3137.228) (-3135.263) * (-3134.742) (-3136.723) [-3135.097] (-3136.614) -- 0:00:31 837000 -- (-3131.942) (-3145.571) (-3136.010) [-3130.854] * (-3135.316) (-3131.952) [-3131.413] (-3138.039) -- 0:00:30 837500 -- (-3139.589) (-3132.557) [-3138.753] (-3141.311) * (-3131.130) (-3134.358) [-3133.043] (-3139.914) -- 0:00:30 838000 -- [-3134.350] (-3134.135) (-3133.987) (-3139.258) * [-3133.315] (-3132.994) (-3133.732) (-3133.660) -- 0:00:30 838500 -- (-3137.116) [-3131.582] (-3135.069) (-3134.074) * (-3133.645) (-3138.475) (-3132.459) [-3134.463] -- 0:00:30 839000 -- (-3144.236) [-3129.642] (-3133.190) (-3133.811) * (-3138.972) (-3141.959) [-3136.181] (-3140.516) -- 0:00:30 839500 -- (-3135.491) (-3132.217) [-3136.077] (-3137.919) * (-3140.478) [-3130.776] (-3132.269) (-3136.339) -- 0:00:30 840000 -- [-3140.430] (-3134.717) (-3132.593) (-3138.887) * [-3140.332] (-3133.258) (-3135.767) (-3142.065) -- 0:00:30 Average standard deviation of split frequencies: 0.000000 840500 -- (-3139.623) (-3137.396) (-3131.786) [-3136.273] * (-3136.539) [-3133.309] (-3135.039) (-3139.414) -- 0:00:30 841000 -- (-3141.253) (-3133.923) (-3135.160) [-3134.675] * (-3137.430) (-3139.362) [-3134.381] (-3140.352) -- 0:00:30 841500 -- (-3136.121) (-3138.474) (-3144.901) [-3137.871] * [-3134.322] (-3132.596) (-3135.802) (-3130.957) -- 0:00:30 842000 -- (-3134.081) (-3133.989) (-3146.228) [-3134.559] * [-3131.911] (-3129.943) (-3134.515) (-3133.534) -- 0:00:30 842500 -- [-3137.639] (-3130.560) (-3133.066) (-3137.753) * [-3132.097] (-3140.652) (-3133.099) (-3135.055) -- 0:00:29 843000 -- (-3137.688) (-3134.480) (-3133.433) [-3129.765] * (-3136.752) (-3142.915) (-3137.479) [-3130.958] -- 0:00:29 843500 -- [-3131.061] (-3128.837) (-3134.442) (-3131.054) * [-3135.699] (-3138.350) (-3141.691) (-3130.484) -- 0:00:29 844000 -- (-3136.763) (-3130.161) [-3135.899] (-3134.178) * (-3137.556) (-3133.541) (-3133.061) [-3134.044] -- 0:00:29 844500 -- (-3132.786) [-3131.742] (-3138.288) (-3135.649) * (-3147.289) (-3130.806) [-3134.584] (-3133.286) -- 0:00:29 845000 -- (-3134.161) (-3142.581) (-3141.985) [-3133.932] * [-3132.533] (-3136.900) (-3148.403) (-3133.615) -- 0:00:29 Average standard deviation of split frequencies: 0.000000 845500 -- (-3132.457) (-3131.229) (-3139.395) [-3132.231] * (-3136.588) (-3138.672) [-3132.350] (-3135.773) -- 0:00:29 846000 -- [-3134.560] (-3131.763) (-3136.081) (-3132.308) * (-3137.760) [-3138.511] (-3132.297) (-3134.535) -- 0:00:29 846500 -- (-3135.980) (-3132.861) [-3136.349] (-3140.318) * (-3145.012) [-3133.984] (-3136.996) (-3137.239) -- 0:00:29 847000 -- (-3139.240) (-3136.568) [-3134.385] (-3140.150) * (-3141.640) (-3133.442) (-3129.719) [-3139.823] -- 0:00:29 847500 -- (-3140.125) [-3135.322] (-3135.855) (-3134.605) * (-3133.108) (-3140.651) (-3133.219) [-3134.647] -- 0:00:28 848000 -- [-3133.812] (-3134.951) (-3134.929) (-3134.497) * [-3132.268] (-3137.587) (-3136.057) (-3140.822) -- 0:00:28 848500 -- [-3132.059] (-3133.042) (-3132.798) (-3140.700) * [-3131.350] (-3136.471) (-3139.619) (-3136.566) -- 0:00:28 849000 -- (-3135.252) (-3136.521) [-3135.748] (-3136.041) * (-3137.294) (-3135.967) [-3133.135] (-3136.241) -- 0:00:28 849500 -- (-3136.306) [-3134.663] (-3133.437) (-3141.299) * (-3139.703) [-3137.373] (-3135.607) (-3135.503) -- 0:00:28 850000 -- (-3142.996) (-3135.055) [-3136.739] (-3136.741) * (-3136.271) (-3142.410) (-3134.683) [-3135.985] -- 0:00:28 Average standard deviation of split frequencies: 0.000000 850500 -- (-3132.613) [-3133.564] (-3133.482) (-3137.794) * (-3132.710) (-3137.291) (-3137.343) [-3132.691] -- 0:00:28 851000 -- [-3132.192] (-3129.072) (-3135.521) (-3134.653) * (-3130.905) (-3131.953) (-3131.304) [-3135.157] -- 0:00:28 851500 -- [-3133.932] (-3132.987) (-3132.593) (-3139.857) * [-3131.897] (-3132.898) (-3135.588) (-3137.556) -- 0:00:28 852000 -- (-3135.609) (-3135.521) [-3130.444] (-3137.267) * (-3133.633) (-3136.153) [-3134.709] (-3140.841) -- 0:00:28 852500 -- (-3135.067) (-3135.218) (-3133.218) [-3136.632] * (-3137.469) (-3142.471) (-3134.332) [-3133.984] -- 0:00:28 853000 -- (-3133.935) (-3138.279) [-3134.771] (-3144.116) * [-3134.482] (-3140.910) (-3131.184) (-3139.261) -- 0:00:27 853500 -- (-3132.706) [-3137.815] (-3136.398) (-3147.007) * (-3138.317) (-3136.987) (-3135.021) [-3134.742] -- 0:00:27 854000 -- (-3136.963) (-3133.034) (-3137.576) [-3146.343] * (-3137.734) [-3131.902] (-3138.507) (-3133.323) -- 0:00:27 854500 -- (-3132.237) (-3139.314) [-3134.853] (-3134.994) * [-3133.713] (-3133.712) (-3139.370) (-3139.897) -- 0:00:27 855000 -- (-3137.738) [-3137.574] (-3134.793) (-3138.753) * (-3136.960) [-3133.793] (-3133.828) (-3143.211) -- 0:00:27 Average standard deviation of split frequencies: 0.000000 855500 -- [-3135.125] (-3135.697) (-3134.402) (-3141.516) * (-3136.964) [-3135.656] (-3136.284) (-3136.216) -- 0:00:27 856000 -- (-3136.286) (-3137.455) (-3139.062) [-3135.038] * (-3136.757) (-3136.027) (-3130.548) [-3136.823] -- 0:00:27 856500 -- (-3131.301) (-3136.552) [-3134.073] (-3135.235) * (-3134.733) (-3143.074) [-3133.881] (-3137.418) -- 0:00:27 857000 -- (-3133.898) (-3137.099) [-3132.939] (-3139.876) * (-3142.025) (-3142.876) [-3136.507] (-3135.690) -- 0:00:27 857500 -- [-3134.703] (-3137.630) (-3137.570) (-3141.307) * (-3130.760) [-3135.431] (-3136.107) (-3136.143) -- 0:00:27 858000 -- (-3138.665) (-3134.149) (-3134.852) [-3131.715] * (-3136.002) (-3136.309) [-3140.136] (-3139.837) -- 0:00:26 858500 -- [-3133.555] (-3146.883) (-3133.506) (-3137.669) * (-3131.718) [-3133.551] (-3134.964) (-3131.154) -- 0:00:26 859000 -- (-3137.236) [-3137.905] (-3140.213) (-3138.193) * (-3137.729) [-3135.206] (-3134.860) (-3130.117) -- 0:00:26 859500 -- [-3137.833] (-3131.465) (-3136.498) (-3138.778) * (-3136.446) [-3145.409] (-3129.935) (-3135.278) -- 0:00:26 860000 -- (-3129.978) [-3137.706] (-3134.818) (-3135.477) * (-3137.098) [-3135.834] (-3140.197) (-3134.003) -- 0:00:26 Average standard deviation of split frequencies: 0.000000 860500 -- (-3139.709) [-3132.590] (-3131.641) (-3143.481) * (-3136.641) (-3141.365) [-3137.396] (-3132.889) -- 0:00:26 861000 -- (-3143.331) (-3137.686) [-3134.568] (-3133.622) * (-3133.331) (-3136.259) (-3135.394) [-3136.501] -- 0:00:26 861500 -- (-3135.062) (-3134.864) [-3135.347] (-3134.697) * (-3135.957) (-3132.180) (-3135.646) [-3139.532] -- 0:00:26 862000 -- [-3133.174] (-3137.784) (-3139.539) (-3133.101) * (-3137.357) [-3131.214] (-3133.436) (-3133.135) -- 0:00:26 862500 -- (-3137.912) [-3135.029] (-3137.519) (-3141.865) * (-3133.602) [-3132.700] (-3142.584) (-3138.284) -- 0:00:26 863000 -- (-3137.479) [-3133.636] (-3142.034) (-3133.703) * [-3130.574] (-3137.890) (-3137.854) (-3135.341) -- 0:00:26 863500 -- (-3131.353) (-3137.103) [-3133.919] (-3132.472) * (-3134.876) (-3139.081) (-3133.535) [-3137.051] -- 0:00:25 864000 -- [-3134.741] (-3137.112) (-3138.925) (-3136.682) * (-3132.754) (-3138.042) (-3139.951) [-3135.829] -- 0:00:25 864500 -- (-3131.305) (-3145.283) (-3136.251) [-3133.260] * (-3138.017) (-3140.153) [-3135.012] (-3136.917) -- 0:00:25 865000 -- (-3131.456) (-3132.019) (-3143.448) [-3135.928] * (-3144.712) [-3141.793] (-3136.549) (-3146.441) -- 0:00:25 Average standard deviation of split frequencies: 0.000000 865500 -- [-3137.902] (-3134.210) (-3143.946) (-3135.264) * [-3139.563] (-3133.758) (-3137.255) (-3133.432) -- 0:00:25 866000 -- [-3134.416] (-3132.413) (-3134.274) (-3138.961) * (-3134.990) (-3136.760) [-3132.924] (-3133.203) -- 0:00:25 866500 -- [-3134.566] (-3131.045) (-3131.062) (-3133.213) * (-3137.442) [-3129.874] (-3139.082) (-3136.315) -- 0:00:25 867000 -- (-3131.283) (-3143.318) (-3136.001) [-3133.713] * (-3144.935) (-3131.974) (-3135.124) [-3130.014] -- 0:00:25 867500 -- (-3134.092) (-3130.369) (-3139.623) [-3132.636] * (-3149.148) (-3131.937) [-3131.181] (-3134.300) -- 0:00:25 868000 -- (-3134.527) (-3134.469) [-3132.571] (-3135.586) * (-3135.995) (-3137.790) [-3132.289] (-3136.798) -- 0:00:25 868500 -- (-3135.816) (-3130.205) [-3136.626] (-3135.630) * (-3139.114) (-3136.839) [-3138.632] (-3134.191) -- 0:00:24 869000 -- [-3136.056] (-3142.527) (-3131.983) (-3136.966) * (-3140.403) (-3137.422) (-3138.736) [-3136.977] -- 0:00:24 869500 -- (-3135.913) [-3139.112] (-3137.005) (-3137.795) * (-3134.623) (-3134.653) (-3132.569) [-3132.233] -- 0:00:24 870000 -- [-3133.373] (-3145.888) (-3141.317) (-3136.158) * (-3136.475) [-3135.888] (-3139.644) (-3135.913) -- 0:00:24 Average standard deviation of split frequencies: 0.000000 870500 -- (-3135.380) (-3134.100) [-3135.115] (-3143.178) * [-3133.387] (-3135.394) (-3141.229) (-3135.392) -- 0:00:24 871000 -- [-3135.621] (-3131.696) (-3137.562) (-3132.466) * (-3138.108) [-3135.825] (-3143.216) (-3135.732) -- 0:00:24 871500 -- (-3138.256) (-3135.450) [-3132.919] (-3142.647) * (-3133.694) (-3134.023) (-3133.842) [-3132.749] -- 0:00:24 872000 -- (-3135.489) [-3133.369] (-3141.799) (-3137.604) * (-3132.756) (-3141.083) (-3138.349) [-3132.857] -- 0:00:24 872500 -- (-3135.155) (-3140.437) [-3134.473] (-3135.156) * [-3131.822] (-3130.894) (-3133.341) (-3129.923) -- 0:00:24 873000 -- (-3133.987) [-3130.815] (-3134.058) (-3136.005) * [-3132.352] (-3132.695) (-3135.650) (-3132.774) -- 0:00:24 873500 -- [-3134.782] (-3132.103) (-3132.680) (-3131.942) * (-3137.327) [-3137.454] (-3138.430) (-3140.121) -- 0:00:24 874000 -- (-3133.813) (-3134.454) (-3131.122) [-3132.222] * [-3141.880] (-3136.808) (-3143.274) (-3140.258) -- 0:00:23 874500 -- (-3135.942) [-3134.058] (-3135.200) (-3136.031) * (-3134.139) (-3132.415) (-3142.679) [-3134.935] -- 0:00:23 875000 -- (-3136.335) (-3133.089) [-3136.837] (-3132.022) * [-3133.610] (-3134.549) (-3140.204) (-3135.624) -- 0:00:23 Average standard deviation of split frequencies: 0.000000 875500 -- (-3136.042) (-3133.977) [-3134.572] (-3133.448) * (-3132.987) (-3137.688) (-3139.705) [-3134.062] -- 0:00:23 876000 -- (-3134.038) (-3141.137) (-3134.461) [-3134.650] * (-3133.022) (-3136.472) (-3140.420) [-3132.843] -- 0:00:23 876500 -- [-3135.224] (-3135.397) (-3139.101) (-3138.326) * (-3139.663) (-3134.613) [-3139.620] (-3140.428) -- 0:00:23 877000 -- (-3135.256) (-3133.595) [-3137.555] (-3137.346) * [-3137.727] (-3134.094) (-3135.708) (-3134.736) -- 0:00:23 877500 -- [-3133.345] (-3137.732) (-3136.556) (-3138.159) * (-3139.191) (-3131.022) [-3132.205] (-3133.440) -- 0:00:23 878000 -- (-3138.909) [-3131.612] (-3135.637) (-3134.547) * (-3133.489) [-3131.762] (-3136.902) (-3132.649) -- 0:00:23 878500 -- (-3137.349) (-3137.231) (-3138.628) [-3132.567] * (-3134.205) (-3137.067) (-3135.571) [-3137.964] -- 0:00:23 879000 -- (-3131.828) [-3132.701] (-3134.378) (-3132.764) * (-3134.636) [-3136.426] (-3134.100) (-3138.534) -- 0:00:22 879500 -- (-3135.266) (-3133.485) [-3132.268] (-3136.222) * (-3135.631) (-3134.327) (-3135.436) [-3135.199] -- 0:00:22 880000 -- (-3138.744) (-3131.242) [-3137.823] (-3139.386) * [-3135.248] (-3135.442) (-3132.667) (-3139.291) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 880500 -- [-3141.829] (-3136.468) (-3137.741) (-3133.929) * (-3133.174) (-3135.206) [-3134.195] (-3135.411) -- 0:00:22 881000 -- (-3136.817) [-3135.156] (-3145.150) (-3131.714) * (-3139.719) [-3133.316] (-3132.788) (-3134.769) -- 0:00:22 881500 -- (-3138.094) [-3131.381] (-3140.233) (-3133.162) * (-3132.967) [-3134.070] (-3133.546) (-3140.319) -- 0:00:22 882000 -- (-3139.383) [-3136.603] (-3137.454) (-3137.244) * (-3135.842) (-3136.126) (-3137.638) [-3134.565] -- 0:00:22 882500 -- (-3131.422) (-3134.453) (-3139.616) [-3132.760] * (-3133.564) (-3135.490) (-3133.849) [-3136.037] -- 0:00:22 883000 -- [-3133.342] (-3135.054) (-3136.626) (-3131.031) * (-3137.319) (-3134.488) (-3134.662) [-3136.580] -- 0:00:22 883500 -- (-3134.142) (-3133.064) (-3131.567) [-3137.241] * (-3136.198) (-3132.582) [-3133.831] (-3136.645) -- 0:00:22 884000 -- (-3137.153) (-3133.404) (-3131.989) [-3134.597] * (-3132.810) (-3134.703) (-3136.170) [-3131.527] -- 0:00:22 884500 -- (-3133.094) (-3136.831) [-3139.413] (-3134.161) * [-3137.030] (-3136.122) (-3132.390) (-3135.794) -- 0:00:21 885000 -- (-3136.872) [-3132.323] (-3132.207) (-3144.262) * [-3134.479] (-3134.012) (-3138.752) (-3141.238) -- 0:00:21 Average standard deviation of split frequencies: 0.000000 885500 -- (-3132.108) [-3131.449] (-3133.593) (-3135.871) * (-3136.908) (-3139.262) [-3131.842] (-3136.983) -- 0:00:21 886000 -- (-3132.377) (-3139.251) (-3137.349) [-3137.697] * (-3134.084) (-3137.353) (-3134.695) [-3136.305] -- 0:00:21 886500 -- (-3133.773) (-3135.181) [-3137.244] (-3135.569) * (-3140.296) (-3132.537) [-3137.226] (-3138.251) -- 0:00:21 887000 -- (-3134.579) (-3140.873) [-3132.335] (-3136.474) * (-3138.751) (-3139.479) [-3136.185] (-3136.883) -- 0:00:21 887500 -- (-3131.943) (-3130.182) (-3131.990) [-3140.657] * (-3135.331) [-3133.513] (-3136.351) (-3146.071) -- 0:00:21 888000 -- (-3132.636) (-3138.201) (-3136.494) [-3133.088] * (-3132.977) [-3132.576] (-3139.540) (-3141.544) -- 0:00:21 888500 -- (-3136.476) (-3134.457) (-3138.013) [-3129.828] * (-3131.165) [-3132.097] (-3133.546) (-3137.571) -- 0:00:21 889000 -- (-3136.207) (-3134.525) [-3134.044] (-3134.275) * (-3132.282) (-3134.833) (-3137.737) [-3134.042] -- 0:00:21 889500 -- (-3135.893) (-3133.238) [-3133.363] (-3134.307) * [-3134.302] (-3131.676) (-3139.996) (-3143.385) -- 0:00:20 890000 -- (-3134.207) (-3138.302) [-3136.761] (-3134.397) * (-3135.663) (-3138.270) [-3145.179] (-3136.326) -- 0:00:20 Average standard deviation of split frequencies: 0.000000 890500 -- [-3135.886] (-3143.104) (-3136.403) (-3134.719) * (-3143.738) (-3133.948) (-3135.928) [-3134.532] -- 0:00:20 891000 -- (-3135.038) [-3134.323] (-3134.212) (-3140.143) * (-3137.617) (-3134.932) [-3139.310] (-3132.027) -- 0:00:20 891500 -- (-3133.117) (-3141.488) [-3132.119] (-3135.380) * (-3139.045) (-3134.527) [-3137.381] (-3132.520) -- 0:00:20 892000 -- (-3135.987) [-3134.757] (-3133.403) (-3137.915) * (-3143.026) [-3135.362] (-3136.068) (-3135.388) -- 0:00:20 892500 -- (-3132.659) [-3134.242] (-3138.147) (-3131.875) * (-3141.786) (-3135.728) (-3132.110) [-3134.826] -- 0:00:20 893000 -- (-3137.375) [-3131.872] (-3136.565) (-3130.418) * (-3136.059) (-3131.857) [-3134.334] (-3137.293) -- 0:00:20 893500 -- (-3136.358) (-3139.624) [-3138.844] (-3139.086) * (-3139.100) (-3135.852) [-3135.798] (-3134.026) -- 0:00:20 894000 -- [-3130.375] (-3139.200) (-3137.294) (-3133.441) * (-3138.513) (-3138.481) (-3134.828) [-3132.812] -- 0:00:20 894500 -- (-3140.337) (-3137.291) [-3136.039] (-3137.999) * (-3133.321) (-3137.849) (-3140.043) [-3142.516] -- 0:00:20 895000 -- (-3134.455) (-3132.732) [-3130.122] (-3132.868) * (-3135.484) (-3139.951) [-3134.550] (-3137.690) -- 0:00:19 Average standard deviation of split frequencies: 0.000000 895500 -- (-3142.092) [-3130.230] (-3134.160) (-3132.669) * (-3137.821) [-3132.089] (-3137.623) (-3140.521) -- 0:00:19 896000 -- (-3135.594) (-3136.849) [-3129.514] (-3135.347) * [-3135.205] (-3132.383) (-3135.470) (-3137.428) -- 0:00:19 896500 -- (-3143.619) [-3135.182] (-3136.610) (-3132.349) * (-3134.401) (-3137.093) [-3135.850] (-3140.962) -- 0:00:19 897000 -- (-3134.288) [-3131.671] (-3136.325) (-3140.123) * [-3134.764] (-3131.835) (-3136.295) (-3140.717) -- 0:00:19 897500 -- (-3132.756) (-3137.807) [-3137.927] (-3135.379) * (-3135.132) [-3133.747] (-3132.555) (-3138.532) -- 0:00:19 898000 -- (-3136.278) [-3133.640] (-3137.620) (-3132.395) * [-3138.412] (-3142.583) (-3140.018) (-3146.623) -- 0:00:19 898500 -- [-3137.283] (-3139.738) (-3135.851) (-3133.065) * (-3139.579) [-3138.869] (-3139.241) (-3140.482) -- 0:00:19 899000 -- (-3136.378) (-3134.388) [-3136.909] (-3136.961) * (-3134.315) (-3136.591) (-3133.196) [-3136.640] -- 0:00:19 899500 -- (-3142.277) [-3137.353] (-3140.421) (-3139.032) * (-3135.241) (-3138.531) [-3131.554] (-3140.495) -- 0:00:19 900000 -- [-3135.489] (-3133.805) (-3140.538) (-3135.755) * (-3137.963) [-3141.305] (-3134.241) (-3135.103) -- 0:00:19 Average standard deviation of split frequencies: 0.000000 900500 -- [-3135.360] (-3135.784) (-3144.236) (-3133.650) * (-3135.753) (-3136.929) (-3135.333) [-3132.806] -- 0:00:18 901000 -- [-3134.410] (-3134.277) (-3135.368) (-3136.365) * (-3140.699) [-3133.722] (-3138.637) (-3137.987) -- 0:00:18 901500 -- (-3137.324) [-3136.789] (-3137.598) (-3136.055) * (-3138.014) (-3138.711) (-3142.968) [-3136.311] -- 0:00:18 902000 -- (-3144.066) [-3141.933] (-3129.774) (-3136.469) * (-3135.389) (-3138.090) (-3137.228) [-3132.417] -- 0:00:18 902500 -- (-3140.127) (-3135.693) [-3130.783] (-3134.835) * (-3133.423) (-3138.377) [-3134.645] (-3139.514) -- 0:00:18 903000 -- [-3137.815] (-3134.588) (-3145.010) (-3132.591) * (-3132.932) (-3139.846) (-3137.120) [-3132.078] -- 0:00:18 903500 -- [-3133.688] (-3131.733) (-3140.622) (-3137.969) * (-3134.405) [-3133.990] (-3134.925) (-3138.019) -- 0:00:18 904000 -- (-3130.894) (-3135.066) (-3136.496) [-3134.494] * (-3135.899) [-3130.837] (-3132.812) (-3136.562) -- 0:00:18 904500 -- (-3138.177) (-3133.569) [-3138.242] (-3134.961) * (-3139.757) (-3133.111) (-3141.522) [-3133.740] -- 0:00:18 905000 -- (-3136.835) (-3139.102) (-3141.947) [-3134.644] * [-3133.733] (-3130.855) (-3138.403) (-3132.246) -- 0:00:18 Average standard deviation of split frequencies: 0.000000 905500 -- (-3142.395) [-3134.809] (-3142.364) (-3134.963) * (-3135.142) (-3137.444) [-3139.112] (-3135.514) -- 0:00:17 906000 -- (-3139.051) (-3136.028) (-3138.236) [-3133.279] * (-3137.359) (-3138.877) (-3137.912) [-3132.428] -- 0:00:17 906500 -- (-3136.720) [-3132.989] (-3139.003) (-3133.038) * (-3133.875) [-3134.326] (-3141.223) (-3140.503) -- 0:00:17 907000 -- (-3135.806) (-3131.911) (-3135.022) [-3133.571] * [-3132.935] (-3134.920) (-3138.003) (-3140.136) -- 0:00:17 907500 -- (-3138.351) (-3136.266) [-3140.910] (-3133.623) * (-3137.528) [-3132.015] (-3135.974) (-3134.213) -- 0:00:17 908000 -- (-3132.744) (-3129.260) [-3134.320] (-3137.417) * [-3130.299] (-3131.691) (-3136.567) (-3138.888) -- 0:00:17 908500 -- [-3130.701] (-3131.389) (-3137.572) (-3131.284) * [-3132.488] (-3136.834) (-3133.524) (-3138.447) -- 0:00:17 909000 -- [-3131.729] (-3136.420) (-3133.022) (-3137.863) * (-3134.624) [-3135.970] (-3140.032) (-3137.528) -- 0:00:17 909500 -- [-3136.925] (-3136.326) (-3131.800) (-3134.077) * (-3136.719) (-3136.963) (-3137.888) [-3132.485] -- 0:00:17 910000 -- (-3137.998) (-3132.773) (-3137.487) [-3136.204] * [-3133.098] (-3134.698) (-3138.165) (-3134.829) -- 0:00:17 Average standard deviation of split frequencies: 0.000000 910500 -- (-3143.940) (-3135.146) (-3134.352) [-3134.688] * (-3140.915) (-3141.980) (-3136.160) [-3132.487] -- 0:00:17 911000 -- (-3138.749) (-3131.768) [-3132.679] (-3135.595) * (-3138.438) [-3138.394] (-3133.319) (-3139.104) -- 0:00:16 911500 -- (-3132.746) (-3141.506) [-3135.649] (-3133.893) * [-3136.803] (-3134.648) (-3138.883) (-3139.849) -- 0:00:16 912000 -- (-3132.719) (-3140.477) [-3134.128] (-3135.701) * (-3138.023) [-3135.161] (-3134.974) (-3137.729) -- 0:00:16 912500 -- (-3131.236) (-3136.072) [-3135.401] (-3142.510) * [-3137.328] (-3136.585) (-3137.463) (-3130.709) -- 0:00:16 913000 -- (-3148.834) (-3135.180) (-3135.317) [-3136.728] * (-3137.936) (-3136.902) (-3136.596) [-3137.583] -- 0:00:16 913500 -- (-3130.447) (-3135.035) [-3136.480] (-3136.028) * [-3129.634] (-3137.109) (-3137.905) (-3138.242) -- 0:00:16 914000 -- (-3133.531) (-3137.746) [-3135.055] (-3136.430) * [-3134.963] (-3135.532) (-3139.517) (-3134.339) -- 0:00:16 914500 -- (-3134.046) (-3135.587) (-3131.322) [-3132.944] * (-3145.553) (-3137.892) [-3135.534] (-3136.663) -- 0:00:16 915000 -- [-3132.630] (-3144.464) (-3136.424) (-3133.626) * (-3131.689) (-3136.529) [-3137.129] (-3141.548) -- 0:00:16 Average standard deviation of split frequencies: 0.000000 915500 -- [-3134.009] (-3134.901) (-3130.821) (-3138.867) * (-3133.557) (-3131.839) [-3131.219] (-3136.631) -- 0:00:16 916000 -- (-3139.515) (-3140.271) (-3136.457) [-3133.834] * (-3135.022) (-3133.902) (-3134.096) [-3135.492] -- 0:00:15 916500 -- [-3134.732] (-3134.523) (-3139.951) (-3137.830) * (-3134.237) [-3132.256] (-3137.894) (-3134.494) -- 0:00:15 917000 -- (-3136.810) (-3134.283) (-3139.695) [-3130.184] * (-3136.001) [-3136.047] (-3130.541) (-3136.723) -- 0:00:15 917500 -- (-3155.301) (-3132.205) (-3137.975) [-3135.614] * (-3136.259) (-3136.308) [-3133.070] (-3136.451) -- 0:00:15 918000 -- (-3133.716) (-3135.462) [-3140.497] (-3141.219) * (-3140.148) (-3137.784) (-3134.357) [-3133.810] -- 0:00:15 918500 -- (-3137.778) (-3134.024) (-3131.182) [-3131.862] * [-3132.440] (-3134.893) (-3137.901) (-3131.586) -- 0:00:15 919000 -- (-3139.017) (-3134.209) (-3134.439) [-3136.603] * (-3136.987) (-3142.295) [-3134.117] (-3138.226) -- 0:00:15 919500 -- (-3135.977) [-3137.330] (-3136.427) (-3137.130) * (-3142.187) (-3133.464) (-3133.039) [-3134.245] -- 0:00:15 920000 -- (-3130.385) (-3135.157) (-3133.869) [-3135.377] * (-3131.535) (-3135.627) (-3133.825) [-3137.232] -- 0:00:15 Average standard deviation of split frequencies: 0.000000 920500 -- (-3138.958) [-3138.455] (-3136.194) (-3138.622) * [-3134.059] (-3138.407) (-3136.275) (-3138.499) -- 0:00:15 921000 -- (-3133.160) (-3132.861) (-3136.440) [-3136.852] * (-3132.164) [-3134.317] (-3142.514) (-3134.466) -- 0:00:15 921500 -- [-3135.085] (-3133.774) (-3131.290) (-3143.277) * (-3135.705) (-3135.795) [-3136.426] (-3146.638) -- 0:00:14 922000 -- [-3139.115] (-3131.413) (-3138.116) (-3134.233) * (-3135.275) (-3130.716) [-3140.272] (-3147.889) -- 0:00:14 922500 -- [-3133.487] (-3138.571) (-3136.395) (-3135.655) * (-3141.769) (-3140.721) [-3138.094] (-3139.833) -- 0:00:14 923000 -- (-3136.994) (-3134.899) (-3133.601) [-3133.500] * [-3140.570] (-3138.043) (-3136.596) (-3137.354) -- 0:00:14 923500 -- [-3134.208] (-3136.798) (-3138.259) (-3136.936) * (-3136.894) (-3138.026) (-3136.732) [-3131.417] -- 0:00:14 924000 -- (-3138.369) (-3138.081) [-3136.871] (-3136.743) * [-3141.033] (-3131.938) (-3135.548) (-3131.038) -- 0:00:14 924500 -- (-3134.646) [-3137.596] (-3137.035) (-3137.391) * (-3139.178) [-3134.979] (-3135.174) (-3138.846) -- 0:00:14 925000 -- (-3135.760) (-3131.458) [-3132.313] (-3132.334) * (-3135.237) [-3134.324] (-3130.196) (-3136.019) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 925500 -- (-3142.816) [-3133.268] (-3134.356) (-3134.297) * [-3134.489] (-3137.394) (-3132.847) (-3141.517) -- 0:00:14 926000 -- [-3133.326] (-3132.840) (-3140.589) (-3131.929) * (-3132.191) (-3138.210) [-3140.200] (-3135.217) -- 0:00:14 926500 -- (-3137.310) (-3137.678) (-3133.072) [-3139.298] * (-3140.059) [-3136.810] (-3136.401) (-3135.658) -- 0:00:13 927000 -- (-3136.584) (-3138.561) [-3130.565] (-3140.943) * (-3135.079) (-3132.901) [-3138.845] (-3131.519) -- 0:00:13 927500 -- (-3133.185) (-3132.673) (-3132.864) [-3139.201] * (-3139.232) [-3132.976] (-3137.140) (-3141.830) -- 0:00:13 928000 -- (-3137.670) (-3143.945) (-3134.900) [-3133.521] * [-3139.252] (-3137.570) (-3143.984) (-3135.250) -- 0:00:13 928500 -- [-3130.542] (-3130.832) (-3135.002) (-3135.687) * (-3134.054) (-3137.926) (-3138.630) [-3134.468] -- 0:00:13 929000 -- (-3134.660) (-3135.877) [-3133.175] (-3148.622) * (-3141.079) (-3130.462) [-3131.793] (-3137.407) -- 0:00:13 929500 -- (-3137.057) (-3131.914) (-3135.957) [-3133.225] * (-3134.348) [-3133.112] (-3130.659) (-3136.300) -- 0:00:13 930000 -- (-3142.654) (-3136.736) [-3132.635] (-3131.035) * (-3135.553) (-3133.463) (-3131.950) [-3134.694] -- 0:00:13 Average standard deviation of split frequencies: 0.000000 930500 -- (-3132.311) (-3133.560) (-3132.567) [-3134.614] * (-3134.709) [-3134.333] (-3133.470) (-3133.962) -- 0:00:13 931000 -- (-3133.493) (-3140.227) (-3141.046) [-3133.242] * (-3133.465) (-3139.431) [-3136.106] (-3143.785) -- 0:00:13 931500 -- (-3137.912) (-3141.286) [-3134.787] (-3137.012) * (-3132.758) (-3130.787) (-3139.640) [-3135.512] -- 0:00:13 932000 -- (-3134.277) [-3140.401] (-3139.922) (-3131.587) * [-3132.434] (-3135.940) (-3138.166) (-3135.449) -- 0:00:12 932500 -- [-3131.494] (-3135.365) (-3137.042) (-3135.472) * (-3134.277) [-3134.333] (-3137.434) (-3138.312) -- 0:00:12 933000 -- (-3137.766) [-3132.252] (-3129.889) (-3139.874) * (-3138.057) (-3133.991) [-3135.753] (-3135.656) -- 0:00:12 933500 -- (-3139.203) [-3133.285] (-3134.383) (-3134.887) * (-3143.109) (-3138.473) (-3138.544) [-3137.887] -- 0:00:12 934000 -- [-3131.414] (-3142.020) (-3136.578) (-3135.915) * (-3134.519) (-3137.632) [-3132.858] (-3136.127) -- 0:00:12 934500 -- (-3140.701) (-3131.302) [-3136.428] (-3133.879) * (-3143.402) (-3138.194) [-3132.036] (-3130.403) -- 0:00:12 935000 -- (-3130.761) (-3135.321) [-3135.194] (-3142.577) * (-3141.689) [-3135.693] (-3134.293) (-3136.422) -- 0:00:12 Average standard deviation of split frequencies: 0.000000 935500 -- (-3133.609) (-3132.209) [-3138.750] (-3133.306) * (-3139.967) (-3137.838) [-3136.735] (-3136.591) -- 0:00:12 936000 -- (-3137.673) (-3132.057) [-3135.563] (-3134.567) * [-3146.851] (-3133.475) (-3142.017) (-3139.534) -- 0:00:12 936500 -- (-3130.998) [-3135.796] (-3138.812) (-3139.429) * (-3138.352) (-3138.050) [-3133.395] (-3132.713) -- 0:00:12 937000 -- (-3136.058) [-3136.958] (-3134.083) (-3134.619) * (-3135.746) [-3133.466] (-3131.521) (-3133.963) -- 0:00:11 937500 -- [-3141.858] (-3133.449) (-3136.761) (-3135.351) * [-3133.598] (-3131.078) (-3138.465) (-3132.659) -- 0:00:11 938000 -- [-3133.060] (-3142.806) (-3131.745) (-3135.198) * (-3130.548) [-3131.401] (-3136.491) (-3137.677) -- 0:00:11 938500 -- (-3137.545) (-3141.510) (-3143.577) [-3132.148] * (-3130.656) (-3135.221) [-3133.656] (-3135.612) -- 0:00:11 939000 -- (-3135.598) [-3137.212] (-3135.462) (-3138.722) * [-3130.298] (-3131.270) (-3137.133) (-3132.968) -- 0:00:11 939500 -- [-3135.971] (-3143.305) (-3133.203) (-3136.661) * (-3139.094) (-3135.502) (-3135.190) [-3137.221] -- 0:00:11 940000 -- [-3138.684] (-3136.202) (-3137.417) (-3134.630) * (-3141.178) [-3138.447] (-3132.875) (-3139.175) -- 0:00:11 Average standard deviation of split frequencies: 0.000000 940500 -- (-3134.163) [-3134.702] (-3133.916) (-3139.828) * (-3138.490) [-3131.404] (-3129.500) (-3135.942) -- 0:00:11 941000 -- (-3134.699) (-3134.953) [-3129.795] (-3133.422) * (-3137.568) (-3141.387) [-3131.745] (-3132.454) -- 0:00:11 941500 -- (-3139.290) (-3132.127) (-3132.879) [-3131.089] * [-3134.821] (-3139.773) (-3136.095) (-3136.089) -- 0:00:11 942000 -- (-3134.012) [-3135.056] (-3141.832) (-3133.578) * [-3136.271] (-3144.558) (-3132.275) (-3131.606) -- 0:00:11 942500 -- (-3131.822) [-3133.765] (-3134.888) (-3141.719) * (-3138.455) (-3144.955) (-3137.902) [-3134.978] -- 0:00:10 943000 -- [-3132.982] (-3133.368) (-3141.716) (-3134.641) * (-3134.646) (-3138.419) (-3138.923) [-3136.207] -- 0:00:10 943500 -- [-3132.943] (-3138.466) (-3143.047) (-3133.658) * [-3132.158] (-3137.882) (-3139.593) (-3137.897) -- 0:00:10 944000 -- (-3132.605) (-3137.249) [-3135.053] (-3136.904) * [-3134.020] (-3137.042) (-3138.956) (-3136.906) -- 0:00:10 944500 -- (-3136.310) [-3131.686] (-3130.327) (-3131.926) * (-3139.467) (-3135.885) [-3133.574] (-3132.895) -- 0:00:10 945000 -- [-3138.500] (-3134.636) (-3132.113) (-3132.670) * (-3135.246) (-3140.341) [-3135.028] (-3140.305) -- 0:00:10 Average standard deviation of split frequencies: 0.000000 945500 -- (-3134.818) [-3133.587] (-3130.733) (-3138.638) * (-3136.561) [-3139.152] (-3137.730) (-3139.259) -- 0:00:10 946000 -- (-3135.495) (-3132.474) (-3135.796) [-3137.615] * (-3135.149) (-3134.886) [-3130.830] (-3147.812) -- 0:00:10 946500 -- (-3141.768) (-3132.754) (-3136.428) [-3134.892] * [-3136.580] (-3134.977) (-3133.471) (-3140.289) -- 0:00:10 947000 -- (-3137.169) [-3136.567] (-3132.645) (-3133.696) * (-3135.952) [-3134.613] (-3142.082) (-3131.790) -- 0:00:10 947500 -- (-3137.195) (-3140.876) (-3136.005) [-3131.442] * (-3133.983) (-3136.946) (-3132.872) [-3134.015] -- 0:00:09 948000 -- [-3136.025] (-3137.559) (-3134.530) (-3139.276) * (-3138.912) (-3136.159) (-3137.484) [-3135.352] -- 0:00:09 948500 -- (-3138.835) (-3134.618) (-3141.486) [-3139.218] * (-3135.412) (-3137.087) (-3138.623) [-3136.482] -- 0:00:09 949000 -- (-3135.695) (-3140.451) [-3136.883] (-3132.587) * [-3136.522] (-3135.139) (-3138.225) (-3132.390) -- 0:00:09 949500 -- (-3135.322) (-3131.952) (-3136.396) [-3136.706] * [-3135.210] (-3135.305) (-3138.457) (-3139.696) -- 0:00:09 950000 -- (-3128.949) (-3143.402) (-3142.349) [-3133.084] * (-3133.967) (-3134.032) [-3137.050] (-3130.423) -- 0:00:09 Average standard deviation of split frequencies: 0.000000 950500 -- [-3132.667] (-3134.638) (-3135.389) (-3139.028) * (-3142.618) (-3134.112) (-3135.841) [-3133.270] -- 0:00:09 951000 -- [-3130.793] (-3141.292) (-3133.320) (-3133.663) * (-3136.168) [-3134.834] (-3137.594) (-3133.192) -- 0:00:09 951500 -- (-3140.966) [-3136.726] (-3134.929) (-3139.719) * [-3136.280] (-3132.770) (-3140.745) (-3140.485) -- 0:00:09 952000 -- (-3138.167) [-3140.980] (-3135.033) (-3136.529) * [-3136.970] (-3131.501) (-3139.945) (-3135.916) -- 0:00:09 952500 -- (-3133.798) (-3133.008) [-3132.677] (-3134.731) * (-3142.603) [-3131.334] (-3134.438) (-3140.224) -- 0:00:09 953000 -- (-3142.795) (-3135.408) (-3140.167) [-3131.889] * (-3131.479) (-3137.076) [-3134.348] (-3139.062) -- 0:00:08 953500 -- (-3133.333) (-3132.020) [-3135.566] (-3134.688) * [-3131.906] (-3139.481) (-3141.621) (-3140.748) -- 0:00:08 954000 -- (-3133.780) (-3136.953) (-3137.018) [-3132.699] * (-3130.472) [-3139.941] (-3141.881) (-3133.362) -- 0:00:08 954500 -- (-3137.162) [-3139.808] (-3134.793) (-3137.864) * (-3134.012) (-3147.573) (-3150.944) [-3134.950] -- 0:00:08 955000 -- (-3134.591) (-3133.042) (-3137.187) [-3132.211] * [-3130.131] (-3132.916) (-3139.512) (-3131.158) -- 0:00:08 Average standard deviation of split frequencies: 0.000000 955500 -- [-3137.231] (-3140.443) (-3141.659) (-3138.747) * (-3138.553) [-3137.783] (-3140.138) (-3133.179) -- 0:00:08 956000 -- (-3136.432) [-3136.030] (-3140.042) (-3143.813) * (-3134.856) [-3134.659] (-3139.985) (-3135.836) -- 0:00:08 956500 -- (-3134.332) (-3137.247) [-3137.260] (-3140.403) * (-3133.295) [-3135.508] (-3134.693) (-3136.834) -- 0:00:08 957000 -- (-3133.404) (-3137.945) (-3138.222) [-3135.175] * (-3133.845) (-3138.732) (-3136.760) [-3133.352] -- 0:00:08 957500 -- [-3132.813] (-3132.309) (-3132.943) (-3135.748) * (-3137.277) (-3133.825) [-3139.870] (-3133.707) -- 0:00:08 958000 -- (-3136.781) (-3137.411) [-3136.661] (-3133.137) * [-3136.710] (-3141.294) (-3144.068) (-3137.535) -- 0:00:07 958500 -- (-3133.783) (-3140.135) (-3139.249) [-3134.887] * (-3140.135) (-3130.873) [-3144.367] (-3135.880) -- 0:00:07 959000 -- (-3135.748) [-3134.491] (-3133.003) (-3138.923) * (-3140.034) (-3130.536) (-3134.453) [-3133.204] -- 0:00:07 959500 -- (-3130.212) (-3135.809) [-3131.273] (-3136.546) * (-3132.007) (-3137.286) [-3136.073] (-3136.427) -- 0:00:07 960000 -- (-3140.398) [-3134.858] (-3134.821) (-3142.982) * [-3134.865] (-3137.754) (-3141.613) (-3143.076) -- 0:00:07 Average standard deviation of split frequencies: 0.000000 960500 -- (-3136.063) (-3134.835) (-3134.134) [-3133.605] * (-3135.626) (-3136.862) [-3137.286] (-3133.313) -- 0:00:07 961000 -- (-3133.041) (-3136.632) [-3132.010] (-3133.080) * (-3140.677) (-3136.353) [-3135.389] (-3135.551) -- 0:00:07 961500 -- (-3134.395) (-3138.506) (-3139.759) [-3133.345] * (-3140.450) [-3135.805] (-3135.516) (-3142.254) -- 0:00:07 962000 -- (-3139.904) (-3136.135) (-3138.129) [-3131.742] * [-3137.692] (-3135.869) (-3136.952) (-3135.528) -- 0:00:07 962500 -- (-3142.657) (-3138.601) (-3137.698) [-3136.216] * [-3137.428] (-3135.576) (-3134.436) (-3138.721) -- 0:00:07 963000 -- (-3131.123) (-3138.232) (-3135.883) [-3131.742] * [-3135.086] (-3133.808) (-3138.029) (-3134.978) -- 0:00:07 963500 -- (-3131.510) (-3138.766) (-3131.718) [-3136.410] * (-3132.858) (-3134.945) (-3134.512) [-3131.519] -- 0:00:06 964000 -- (-3135.698) (-3143.742) (-3143.293) [-3137.420] * (-3133.134) (-3135.583) (-3143.879) [-3135.799] -- 0:00:06 964500 -- (-3138.931) [-3131.051] (-3134.315) (-3139.335) * (-3136.314) [-3131.649] (-3142.070) (-3135.405) -- 0:00:06 965000 -- (-3136.003) [-3132.543] (-3135.917) (-3139.430) * [-3137.474] (-3133.669) (-3135.417) (-3134.124) -- 0:00:06 Average standard deviation of split frequencies: 0.000000 965500 -- (-3133.403) (-3133.148) (-3133.887) [-3137.123] * (-3132.480) (-3135.423) (-3146.085) [-3131.795] -- 0:00:06 966000 -- (-3137.772) (-3131.372) (-3137.356) [-3136.038] * (-3141.136) (-3140.514) (-3134.709) [-3132.376] -- 0:00:06 966500 -- (-3132.738) [-3132.649] (-3136.832) (-3140.204) * [-3135.891] (-3134.139) (-3139.042) (-3132.099) -- 0:00:06 967000 -- (-3131.049) [-3134.972] (-3140.297) (-3141.335) * [-3135.840] (-3138.598) (-3136.871) (-3136.523) -- 0:00:06 967500 -- (-3136.218) (-3138.847) [-3133.162] (-3133.194) * (-3136.647) [-3132.113] (-3132.630) (-3137.208) -- 0:00:06 968000 -- (-3135.476) (-3134.013) [-3131.052] (-3137.571) * (-3138.557) (-3135.944) (-3133.237) [-3137.862] -- 0:00:06 968500 -- (-3135.685) (-3140.885) [-3130.746] (-3140.057) * (-3138.692) [-3132.158] (-3135.909) (-3136.308) -- 0:00:05 969000 -- (-3134.677) [-3133.804] (-3134.432) (-3135.424) * (-3135.181) [-3135.221] (-3139.193) (-3133.438) -- 0:00:05 969500 -- [-3138.110] (-3132.551) (-3130.649) (-3142.698) * [-3136.598] (-3143.192) (-3137.240) (-3133.414) -- 0:00:05 970000 -- (-3137.114) (-3131.542) [-3133.605] (-3142.304) * (-3138.667) [-3140.500] (-3138.917) (-3132.441) -- 0:00:05 Average standard deviation of split frequencies: 0.000000 970500 -- (-3136.521) [-3132.818] (-3135.279) (-3139.719) * (-3138.312) (-3137.259) (-3133.338) [-3134.425] -- 0:00:05 971000 -- (-3136.726) [-3136.324] (-3135.461) (-3131.866) * [-3135.760] (-3134.384) (-3136.283) (-3139.046) -- 0:00:05 971500 -- (-3139.288) (-3134.061) (-3131.490) [-3131.162] * (-3142.826) (-3134.102) (-3135.258) [-3138.371] -- 0:00:05 972000 -- (-3139.032) [-3132.061] (-3136.127) (-3134.130) * [-3130.660] (-3133.967) (-3134.351) (-3134.162) -- 0:00:05 972500 -- (-3133.884) [-3137.928] (-3138.838) (-3133.628) * [-3132.501] (-3136.874) (-3134.682) (-3133.540) -- 0:00:05 973000 -- (-3133.664) [-3133.312] (-3133.387) (-3142.613) * (-3133.335) [-3138.844] (-3137.020) (-3134.538) -- 0:00:05 973500 -- (-3131.377) (-3129.484) (-3143.506) [-3135.078] * (-3133.796) (-3135.939) [-3135.571] (-3131.841) -- 0:00:05 974000 -- (-3131.711) (-3132.431) [-3133.302] (-3137.071) * (-3133.640) (-3144.507) (-3136.609) [-3140.175] -- 0:00:04 974500 -- [-3132.338] (-3136.506) (-3137.687) (-3134.297) * (-3134.736) [-3139.200] (-3135.781) (-3139.651) -- 0:00:04 975000 -- (-3137.157) (-3134.940) (-3132.703) [-3133.710] * [-3134.705] (-3139.734) (-3135.996) (-3143.652) -- 0:00:04 Average standard deviation of split frequencies: 0.000000 975500 -- (-3133.755) (-3131.689) (-3137.574) [-3133.957] * (-3138.687) [-3131.705] (-3142.163) (-3139.086) -- 0:00:04 976000 -- (-3139.705) (-3133.332) [-3137.046] (-3134.598) * (-3135.697) (-3134.312) (-3143.456) [-3139.451] -- 0:00:04 976500 -- (-3137.205) (-3140.063) [-3136.643] (-3137.417) * (-3138.492) (-3136.517) [-3134.240] (-3141.981) -- 0:00:04 977000 -- (-3138.526) (-3141.372) (-3144.020) [-3139.617] * (-3137.845) [-3135.794] (-3135.456) (-3137.525) -- 0:00:04 977500 -- (-3141.604) (-3137.982) [-3134.951] (-3139.503) * (-3139.906) [-3135.672] (-3134.569) (-3136.564) -- 0:00:04 978000 -- (-3134.009) (-3134.734) (-3137.213) [-3134.659] * (-3132.092) (-3144.475) (-3136.191) [-3137.312] -- 0:00:04 978500 -- (-3131.804) (-3134.232) (-3139.914) [-3131.198] * (-3132.466) [-3135.562] (-3135.124) (-3132.776) -- 0:00:04 979000 -- [-3134.745] (-3137.045) (-3140.168) (-3136.952) * [-3132.967] (-3135.042) (-3132.742) (-3132.368) -- 0:00:03 979500 -- (-3134.842) (-3133.873) (-3136.179) [-3132.156] * (-3136.527) [-3139.012] (-3134.688) (-3144.032) -- 0:00:03 980000 -- (-3136.855) (-3136.485) (-3136.586) [-3134.221] * (-3144.224) [-3133.862] (-3130.470) (-3137.784) -- 0:00:03 Average standard deviation of split frequencies: 0.000000 980500 -- [-3133.098] (-3135.977) (-3139.303) (-3140.142) * (-3141.577) (-3136.662) (-3133.936) [-3133.802] -- 0:00:03 981000 -- (-3133.427) (-3130.046) [-3136.183] (-3131.354) * (-3134.399) (-3135.289) [-3135.088] (-3134.860) -- 0:00:03 981500 -- (-3133.697) (-3135.915) [-3135.400] (-3135.180) * (-3136.263) (-3137.340) (-3142.515) [-3132.831] -- 0:00:03 982000 -- [-3133.260] (-3132.522) (-3135.034) (-3136.626) * (-3135.401) (-3136.907) (-3147.034) [-3137.328] -- 0:00:03 982500 -- (-3134.033) (-3140.739) (-3133.993) [-3140.148] * (-3134.754) (-3138.475) [-3138.566] (-3142.736) -- 0:00:03 983000 -- (-3141.979) (-3135.220) (-3131.392) [-3139.199] * (-3130.250) (-3146.756) (-3135.307) [-3131.722] -- 0:00:03 983500 -- (-3144.737) (-3138.184) (-3129.634) [-3132.090] * (-3134.456) [-3133.937] (-3134.976) (-3134.426) -- 0:00:03 984000 -- (-3135.241) [-3136.329] (-3135.864) (-3136.767) * [-3136.408] (-3137.697) (-3138.605) (-3131.997) -- 0:00:03 984500 -- (-3133.547) (-3138.157) [-3133.625] (-3137.079) * (-3137.120) [-3136.820] (-3139.134) (-3133.862) -- 0:00:02 985000 -- (-3130.964) [-3142.110] (-3131.721) (-3135.800) * (-3143.933) (-3142.327) (-3139.313) [-3137.971] -- 0:00:02 Average standard deviation of split frequencies: 0.000000 985500 -- (-3140.305) [-3136.536] (-3143.673) (-3136.310) * (-3134.511) (-3138.222) (-3137.751) [-3135.377] -- 0:00:02 986000 -- [-3134.269] (-3137.933) (-3136.014) (-3140.680) * [-3138.147] (-3137.753) (-3142.672) (-3135.814) -- 0:00:02 986500 -- (-3133.880) [-3135.882] (-3142.282) (-3139.632) * (-3135.313) [-3135.322] (-3132.934) (-3135.693) -- 0:00:02 987000 -- (-3137.049) (-3134.176) (-3136.973) [-3135.727] * (-3143.031) (-3131.120) [-3137.253] (-3137.714) -- 0:00:02 987500 -- (-3142.096) [-3132.380] (-3140.759) (-3137.576) * (-3141.531) (-3134.652) [-3134.359] (-3133.938) -- 0:00:02 988000 -- (-3139.941) (-3136.674) [-3133.669] (-3143.292) * (-3137.061) (-3131.251) [-3136.210] (-3133.590) -- 0:00:02 988500 -- (-3143.257) [-3136.744] (-3140.158) (-3131.457) * (-3134.184) (-3137.218) [-3133.671] (-3132.685) -- 0:00:02 989000 -- [-3140.820] (-3135.723) (-3134.147) (-3136.211) * (-3137.933) (-3134.603) [-3137.141] (-3135.428) -- 0:00:02 989500 -- [-3134.558] (-3137.642) (-3139.540) (-3138.694) * (-3133.324) [-3133.072] (-3133.176) (-3133.837) -- 0:00:01 990000 -- [-3133.032] (-3135.440) (-3133.754) (-3134.195) * (-3130.688) (-3135.306) [-3134.343] (-3139.372) -- 0:00:01 Average standard deviation of split frequencies: 0.000000 990500 -- [-3135.053] (-3133.127) (-3135.829) (-3134.239) * [-3135.363] (-3137.975) (-3135.180) (-3139.040) -- 0:00:01 991000 -- (-3136.696) (-3136.032) [-3133.541] (-3131.066) * (-3131.909) [-3134.593] (-3141.337) (-3139.520) -- 0:00:01 991500 -- (-3135.343) (-3139.004) [-3134.985] (-3139.176) * (-3143.558) (-3141.032) (-3134.808) [-3133.266] -- 0:00:01 992000 -- (-3137.619) (-3140.723) [-3142.767] (-3136.567) * (-3137.250) (-3142.387) [-3134.457] (-3140.788) -- 0:00:01 992500 -- [-3134.848] (-3131.260) (-3135.151) (-3133.938) * (-3138.032) (-3134.122) [-3134.587] (-3134.178) -- 0:00:01 993000 -- (-3134.466) [-3132.771] (-3129.684) (-3136.710) * (-3135.715) (-3135.434) [-3132.183] (-3133.772) -- 0:00:01 993500 -- (-3135.695) (-3132.559) [-3133.744] (-3138.119) * (-3132.960) [-3136.459] (-3134.284) (-3137.323) -- 0:00:01 994000 -- [-3131.068] (-3131.258) (-3138.150) (-3130.682) * (-3131.288) [-3136.199] (-3136.573) (-3136.126) -- 0:00:01 994500 -- [-3135.472] (-3133.843) (-3130.677) (-3135.179) * (-3139.623) (-3136.554) [-3134.843] (-3141.960) -- 0:00:01 995000 -- [-3134.339] (-3132.974) (-3135.040) (-3138.680) * (-3134.790) (-3143.961) (-3134.797) [-3137.928] -- 0:00:00 Average standard deviation of split frequencies: 0.000000 995500 -- (-3135.908) (-3131.055) (-3135.319) [-3132.942] * (-3133.524) [-3138.968] (-3139.151) (-3138.637) -- 0:00:00 996000 -- (-3137.439) (-3133.075) (-3134.737) [-3130.317] * (-3136.013) (-3132.190) [-3136.826] (-3140.670) -- 0:00:00 996500 -- (-3139.866) [-3140.613] (-3133.853) (-3133.719) * (-3135.610) (-3138.061) [-3135.029] (-3136.123) -- 0:00:00 997000 -- (-3145.564) (-3134.776) (-3135.858) [-3134.091] * [-3132.989] (-3136.788) (-3141.202) (-3135.910) -- 0:00:00 997500 -- (-3130.374) (-3135.135) (-3132.112) [-3131.614] * (-3131.629) (-3129.397) (-3134.682) [-3131.611] -- 0:00:00 998000 -- (-3134.412) (-3144.618) [-3141.917] (-3134.196) * (-3138.468) (-3132.295) (-3133.167) [-3132.012] -- 0:00:00 998500 -- (-3136.029) (-3139.360) (-3136.128) [-3133.969] * (-3132.252) [-3134.677] (-3132.352) (-3132.716) -- 0:00:00 999000 -- (-3133.731) (-3139.063) (-3138.920) [-3136.359] * [-3132.687] (-3137.189) (-3133.077) (-3133.081) -- 0:00:00 999500 -- (-3131.812) (-3134.123) (-3137.747) [-3135.857] * (-3140.343) (-3135.332) [-3135.377] (-3135.695) -- 0:00:00 1000000 -- (-3140.242) (-3134.852) [-3134.017] (-3146.142) * (-3142.184) [-3133.705] (-3144.639) (-3133.906) -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3140.242275 -- 13.855162 Chain 1 -- -3140.242275 -- 13.855162 Chain 2 -- -3134.852126 -- 9.626171 Chain 2 -- -3134.852126 -- 9.626171 Chain 3 -- -3134.016854 -- 14.182656 Chain 3 -- -3134.016854 -- 14.182656 Chain 4 -- -3146.141599 -- 13.400681 Chain 4 -- -3146.141599 -- 13.400681 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3142.183654 -- 13.638004 Chain 1 -- -3142.183654 -- 13.638004 Chain 2 -- -3133.704929 -- 13.452464 Chain 2 -- -3133.704929 -- 13.452464 Chain 3 -- -3144.639473 -- 10.765934 Chain 3 -- -3144.639473 -- 10.765934 Chain 4 -- -3133.905773 -- 14.560474 Chain 4 -- -3133.905773 -- 14.560474 Analysis completed in 3 mins 10 seconds Analysis used 189.49 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3127.45 Likelihood of best state for "cold" chain of run 2 was -3127.45 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 45.7 % ( 25 %) Dirichlet(Revmat{all}) 58.9 % ( 33 %) Slider(Revmat{all}) 23.0 % ( 18 %) Dirichlet(Pi{all}) 25.4 % ( 26 %) Slider(Pi{all}) 59.3 % ( 32 %) Multiplier(Alpha{1,2}) 46.0 % ( 21 %) Multiplier(Alpha{3}) 66.0 % ( 40 %) Slider(Pinvar{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.7 % ( 23 %) Multiplier(V{all}) 20.5 % ( 18 %) Nodeslider(V{all}) 25.3 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 46.0 % ( 33 %) Dirichlet(Revmat{all}) 58.5 % ( 35 %) Slider(Revmat{all}) 23.2 % ( 29 %) Dirichlet(Pi{all}) 25.4 % ( 25 %) Slider(Pi{all}) 58.9 % ( 19 %) Multiplier(Alpha{1,2}) 46.0 % ( 22 %) Multiplier(Alpha{3}) 65.9 % ( 46 %) Slider(Pinvar{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 25.9 % ( 34 %) Multiplier(V{all}) 20.6 % ( 17 %) Nodeslider(V{all}) 25.2 % ( 21 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.85 0.71 0.60 2 | 166515 0.86 0.74 3 | 167134 166196 0.87 4 | 166163 166799 167193 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.85 0.71 0.60 2 | 166859 0.86 0.74 3 | 166151 166962 0.87 4 | 166412 166729 166887 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3133.83 | 1 2 2 | | 2 2 21 22 11 2 1 | | 1 2 1 11 2 2 1 | | 2 1 2 1 1 221 1 121 | |1 2 2 22 2 2 2| | 1 1 1 2 221 11 1 | | 2 * 1 1* 22 2 2 1 1 1| | 1 1 2 2 2 21 11 2 1 1 | |2 1 1 1 21 1 2 11 2 2 * 2 | | 11 2 1 1 21 2 * 2 2 * | | 2 1 2 1 2 | | 2 2 2 2 | | 1 1 | | 1 | | 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3136.56 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3132.56 -3140.32 2 -3132.61 -3140.99 -------------------------------------- TOTAL -3132.59 -3140.71 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.226993 0.000760 0.174485 0.279613 0.224553 1335.43 1379.02 1.000 r(A<->C){all} 0.102828 0.000674 0.052481 0.153821 0.101216 614.36 936.38 1.000 r(A<->G){all} 0.273240 0.001522 0.198514 0.349207 0.271394 855.50 919.68 1.000 r(A<->T){all} 0.082734 0.000522 0.038931 0.127129 0.081285 981.23 1122.39 1.000 r(C<->G){all} 0.093085 0.000591 0.047879 0.139639 0.091713 1098.29 1132.18 1.000 r(C<->T){all} 0.399734 0.002109 0.309832 0.485405 0.398638 952.07 1004.63 1.000 r(G<->T){all} 0.048378 0.000349 0.010706 0.082731 0.046395 925.22 1112.13 1.000 pi(A){all} 0.277884 0.000124 0.255425 0.298482 0.277774 1337.03 1340.76 1.000 pi(C){all} 0.217673 0.000101 0.199538 0.238744 0.217172 1297.30 1391.11 1.001 pi(G){all} 0.245223 0.000112 0.223751 0.264964 0.245344 1321.15 1380.15 1.000 pi(T){all} 0.259220 0.000115 0.239311 0.281544 0.259150 1299.39 1323.36 1.000 alpha{1,2} 0.075513 0.003643 0.000132 0.187478 0.062933 1298.44 1302.01 1.000 alpha{3} 1.657819 0.509513 0.511637 3.057750 1.520630 1313.43 1407.21 1.000 pinvar{all} 0.231934 0.012513 0.006409 0.420747 0.234877 1349.61 1425.30 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 Key to taxon bipartitions (saved to file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------- 1 -- .*** 2 -- .*.. 3 -- ..*. 4 -- ...* 5 -- .**. ---------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 5 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.029866 0.000049 0.016855 0.043558 0.029456 1.000 2 length{all}[2] 0.011587 0.000010 0.006069 0.018127 0.011257 1.000 2 length{all}[3] 0.006294 0.000006 0.002008 0.010836 0.006073 1.000 2 length{all}[4] 0.153391 0.000571 0.109589 0.200037 0.150927 1.000 2 length{all}[5] 0.025854 0.000043 0.012877 0.038439 0.025438 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.000 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C4 (4) + | /------------------------------------ C2 (2) \----------------100----------------+ \------------------------------------ C3 (3) Phylogram (based on average branch lengths): /-------------- C1 (1) | |------------------------------------------------------------------------ C4 (4) + | /------ C2 (2) \-----------+ \--- C3 (3) |--------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 4 ls = 1524 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Sites with gaps or missing data are removed. 30 ambiguity characters in seq. 1 33 ambiguity characters in seq. 2 24 ambiguity characters in seq. 3 48 ambiguity characters in seq. 4 19 sites are removed. 268 269 270 271 272 273 274 275 309 310 311 501 502 503 504 505 506 507 508 Sequences read.. Counting site patterns.. 0:00 209 patterns at 489 / 489 sites (100.0%), 0:00 Counting codons.. 48 bytes for distance 203984 bytes for conP 28424 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 4, (2, 3)); MP score: 199 0.072198 0.291852 0.067385 0.028597 0.017079 0.300000 1.300000 ntime & nrate & np: 5 2 7 Bounds (np=7): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 7 lnL0 = -3186.654329 Iterating by ming2 Initial: fx= 3186.654329 x= 0.07220 0.29185 0.06739 0.02860 0.01708 0.30000 1.30000 1 h-m-p 0.0000 0.0003 300.9646 ++CCCCC 3170.712714 4 0.0003 23 | 0/7 2 h-m-p 0.0000 0.0009 5956.3721 ++YYCCCCC 3108.517306 6 0.0001 45 | 0/7 3 h-m-p 0.0001 0.0004 674.5780 +YYYYYC 3076.996779 5 0.0003 61 | 0/7 4 h-m-p 0.0004 0.0018 114.5218 CCCCC 3074.332275 4 0.0005 79 | 0/7 5 h-m-p 0.0002 0.0026 227.4136 YCCC 3068.852026 3 0.0006 94 | 0/7 6 h-m-p 0.0003 0.0015 313.7167 YCYCCC 3058.153802 5 0.0008 112 | 0/7 7 h-m-p 0.0001 0.0004 1918.9646 +YCYCCC 3035.361575 5 0.0002 132 | 0/7 8 h-m-p 0.3812 1.9058 0.1778 CYCCC 3021.314301 4 0.6676 149 | 0/7 9 h-m-p 0.2276 4.3228 0.5216 CYCCC 3015.185183 4 0.1936 173 | 0/7 10 h-m-p 0.5530 2.7652 0.0704 CYCCC 3013.725490 4 0.9160 197 | 0/7 11 h-m-p 0.6040 8.0000 0.1068 +YYYC 3009.025275 3 2.3202 218 | 0/7 12 h-m-p 1.2800 6.4000 0.0802 +YCYCCC 3003.933009 5 3.6671 244 | 0/7 13 h-m-p 1.6000 8.0000 0.0341 YYC 3002.907241 2 1.2351 263 | 0/7 14 h-m-p 0.4865 8.0000 0.0866 +YYC 3002.530694 2 1.6121 283 | 0/7 15 h-m-p 1.6000 8.0000 0.0745 CCCC 3002.039306 3 2.3416 306 | 0/7 16 h-m-p 1.6000 8.0000 0.0779 CC 3001.832938 1 1.8788 325 | 0/7 17 h-m-p 1.6000 8.0000 0.0173 YC 3001.824923 1 1.2633 343 | 0/7 18 h-m-p 1.6000 8.0000 0.0017 Y 3001.824693 0 1.1803 360 | 0/7 19 h-m-p 1.6000 8.0000 0.0004 C 3001.824688 0 1.3467 377 | 0/7 20 h-m-p 1.6000 8.0000 0.0000 Y 3001.824688 0 1.0925 394 | 0/7 21 h-m-p 1.6000 8.0000 0.0000 Y 3001.824688 0 1.6000 411 | 0/7 22 h-m-p 1.6000 8.0000 0.0000 ---C 3001.824688 0 0.0063 431 Out.. lnL = -3001.824688 432 lfun, 432 eigenQcodon, 2160 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 4, (2, 3)); MP score: 199 0.072198 0.291852 0.067385 0.028597 0.017079 2.487384 0.755520 0.234606 ntime & nrate & np: 5 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.322907 np = 8 lnL0 = -3001.591214 Iterating by ming2 Initial: fx= 3001.591214 x= 0.07220 0.29185 0.06739 0.02860 0.01708 2.48738 0.75552 0.23461 1 h-m-p 0.0000 0.0036 91.9990 +++YCCC 2999.708888 3 0.0005 21 | 0/8 2 h-m-p 0.0001 0.0005 316.7123 YCCCCC 2996.619068 5 0.0002 41 | 0/8 3 h-m-p 0.0000 0.0002 806.6353 CCYC 2995.302456 3 0.0000 57 | 0/8 4 h-m-p 0.0002 0.0010 141.9961 CC 2994.425716 1 0.0002 70 | 0/8 5 h-m-p 0.0022 0.0126 13.1853 YCCC 2994.072288 3 0.0043 86 | 0/8 6 h-m-p 0.0005 0.0025 46.2622 CCC 2994.023787 2 0.0002 101 | 0/8 7 h-m-p 0.0028 0.0500 3.1103 YC 2994.014244 1 0.0016 113 | 0/8 8 h-m-p 0.0046 2.3174 1.2598 +++CC 2993.172820 1 0.2907 129 | 0/8 9 h-m-p 0.4060 3.0486 0.9019 YYC 2992.645896 2 0.3407 142 | 0/8 10 h-m-p 1.5207 7.6037 0.0103 YCC 2992.590158 2 0.9432 164 | 0/8 11 h-m-p 1.6000 8.0000 0.0047 YC 2992.587334 1 1.2418 184 | 0/8 12 h-m-p 1.2099 8.0000 0.0048 YC 2992.587123 1 0.8225 204 | 0/8 13 h-m-p 1.6000 8.0000 0.0005 Y 2992.587114 0 1.2007 223 | 0/8 14 h-m-p 1.6000 8.0000 0.0001 Y 2992.587114 0 0.9583 242 | 0/8 15 h-m-p 1.6000 8.0000 0.0000 Y 2992.587114 0 1.0240 261 | 0/8 16 h-m-p 1.6000 8.0000 0.0000 C 2992.587114 0 1.6000 280 | 0/8 17 h-m-p 1.6000 8.0000 0.0000 -------------C 2992.587114 0 0.0000 312 Out.. lnL = -2992.587114 313 lfun, 939 eigenQcodon, 3130 P(t) Time used: 0:03 Model 2: PositiveSelection TREE # 1 (1, 4, (2, 3)); MP score: 199 initial w for M2:NSpselection reset. 0.072198 0.291852 0.067385 0.028597 0.017079 2.547662 1.079469 0.409056 0.257593 2.430889 ntime & nrate & np: 5 3 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.648536 np = 10 lnL0 = -3023.998225 Iterating by ming2 Initial: fx= 3023.998225 x= 0.07220 0.29185 0.06739 0.02860 0.01708 2.54766 1.07947 0.40906 0.25759 2.43089 1 h-m-p 0.0000 0.0050 104.3585 ++CYCC 3022.972934 3 0.0002 22 | 0/10 2 h-m-p 0.0001 0.0006 166.5591 YCCCC 3021.369625 4 0.0002 42 | 0/10 3 h-m-p 0.0001 0.0004 551.1345 YCCCC 3018.830806 4 0.0001 62 | 0/10 4 h-m-p 0.0001 0.0004 446.1283 ++ 3008.304767 m 0.0004 75 | 1/10 5 h-m-p 0.0014 0.0072 82.2437 YCCC 3007.767386 3 0.0006 93 | 1/10 6 h-m-p 0.0009 0.0650 53.9401 +YCCC 3003.393878 3 0.0073 112 | 1/10 7 h-m-p 0.0196 0.0978 7.5306 YCYCCC 2996.336122 5 0.0410 133 | 0/10 8 h-m-p 0.0063 0.0317 35.0552 YCCC 2995.958097 3 0.0008 151 | 0/10 9 h-m-p 0.0065 0.2863 4.2930 +++ 2993.466832 m 0.2863 165 | 1/10 10 h-m-p 1.1416 7.4322 0.4771 CCC 2992.707913 2 0.4048 182 | 1/10 11 h-m-p 0.3458 4.8177 0.5585 YCC 2992.655231 2 0.2237 207 | 1/10 12 h-m-p 0.4627 8.0000 0.2700 CYC 2992.603858 2 0.6497 232 | 1/10 13 h-m-p 1.6000 8.0000 0.0759 YC 2992.588689 1 1.2610 255 | 1/10 14 h-m-p 1.6000 8.0000 0.0191 YC 2992.587163 1 1.1284 278 | 1/10 15 h-m-p 1.6000 8.0000 0.0020 Y 2992.587116 0 1.0857 300 | 1/10 16 h-m-p 1.6000 8.0000 0.0010 Y 2992.587114 0 1.0849 322 | 1/10 17 h-m-p 1.6000 8.0000 0.0002 Y 2992.587114 0 0.7801 344 | 1/10 18 h-m-p 1.6000 8.0000 0.0000 Y 2992.587114 0 1.1407 366 | 1/10 19 h-m-p 1.6000 8.0000 0.0000 Y 2992.587114 0 0.2563 388 | 1/10 20 h-m-p 0.3525 8.0000 0.0000 Y 2992.587114 0 0.3525 410 | 1/10 21 h-m-p 0.4730 8.0000 0.0000 ---C 2992.587114 0 0.0018 435 Out.. lnL = -2992.587114 436 lfun, 1744 eigenQcodon, 6540 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3000.272538 S = -2814.475448 -178.288643 Calculating f(w|X), posterior probabilities of site classes. did 10 / 209 patterns 0:06 did 20 / 209 patterns 0:06 did 30 / 209 patterns 0:06 did 40 / 209 patterns 0:06 did 50 / 209 patterns 0:06 did 60 / 209 patterns 0:06 did 70 / 209 patterns 0:06 did 80 / 209 patterns 0:06 did 90 / 209 patterns 0:06 did 100 / 209 patterns 0:06 did 110 / 209 patterns 0:06 did 120 / 209 patterns 0:07 did 130 / 209 patterns 0:07 did 140 / 209 patterns 0:07 did 150 / 209 patterns 0:07 did 160 / 209 patterns 0:07 did 170 / 209 patterns 0:07 did 180 / 209 patterns 0:07 did 190 / 209 patterns 0:07 did 200 / 209 patterns 0:07 did 209 / 209 patterns 0:07 Time used: 0:07 Model 3: discrete TREE # 1 (1, 4, (2, 3)); MP score: 199 0.072198 0.291852 0.067385 0.028597 0.017079 2.547663 0.408838 0.998206 0.130259 0.283081 0.428262 ntime & nrate & np: 5 4 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 8.960489 np = 11 lnL0 = -3000.613240 Iterating by ming2 Initial: fx= 3000.613240 x= 0.07220 0.29185 0.06739 0.02860 0.01708 2.54766 0.40884 0.99821 0.13026 0.28308 0.42826 1 h-m-p 0.0000 0.0033 56.4233 ++CYC 3000.322681 2 0.0002 21 | 0/11 2 h-m-p 0.0002 0.0010 67.1143 YCC 3000.181595 2 0.0001 38 | 0/11 3 h-m-p 0.0001 0.0016 56.2308 YC 3000.111366 1 0.0001 53 | 0/11 4 h-m-p 0.0001 0.0030 54.9031 +YC 2999.577979 1 0.0010 69 | 0/11 5 h-m-p 0.0002 0.0012 79.3125 ++ 2998.773422 m 0.0012 83 | 1/11 6 h-m-p 0.0032 0.1202 13.9795 ++YCCC 2997.214636 3 0.0331 104 | 1/11 7 h-m-p 0.0010 0.0050 107.9602 CCCCC 2996.698544 4 0.0014 126 | 1/11 8 h-m-p 0.0218 0.3045 6.9343 CCC 2994.974366 2 0.0342 144 | 1/11 9 h-m-p 0.2049 4.1504 1.1582 YC 2993.816657 1 0.4686 159 | 1/11 10 h-m-p 0.2948 1.4738 0.9109 CCCCC 2992.844612 4 0.3951 181 | 0/11 11 h-m-p 0.0682 0.3408 4.1567 YCCC 2992.804511 3 0.0091 210 | 0/11 12 h-m-p 0.0580 0.8838 0.6509 +CCC 2992.754279 2 0.2168 229 | 0/11 13 h-m-p 0.0703 0.3516 0.3603 ++ 2992.712925 m 0.3516 254 | 1/11 14 h-m-p 0.1163 3.5986 1.0756 CYC 2992.701066 2 0.0995 282 | 1/11 15 h-m-p 0.9990 8.0000 0.1071 YCC 2992.676095 2 1.7563 299 | 1/11 16 h-m-p 0.9353 8.0000 0.2012 CCCC 2992.649424 3 1.2495 329 | 1/11 17 h-m-p 1.4712 8.0000 0.1709 CYC 2992.615231 2 1.7865 356 | 0/11 18 h-m-p 0.1026 1.8063 2.9741 --CC 2992.614325 1 0.0023 384 | 0/11 19 h-m-p 0.0347 8.0000 0.1992 +++YYC 2992.592284 2 1.8577 403 | 0/11 20 h-m-p 0.0548 0.2739 0.3059 ++ 2992.580274 m 0.2739 428 | 1/11 21 h-m-p 0.2852 8.0000 0.2937 +YC 2992.572942 1 0.7661 455 | 1/11 22 h-m-p 1.6000 8.0000 0.1033 YYC 2992.567356 2 1.2666 481 | 1/11 23 h-m-p 1.6000 8.0000 0.0478 CC 2992.563119 1 1.9351 507 | 1/11 24 h-m-p 0.3411 7.1582 0.2710 +YY 2992.556823 1 1.3644 533 | 1/11 25 h-m-p 1.6000 8.0000 0.1270 CYC 2992.552164 2 1.8589 560 | 1/11 26 h-m-p 1.0833 5.4165 0.2011 CCC 2992.549851 2 1.6130 588 | 1/11 27 h-m-p 0.9349 4.6743 0.1272 C 2992.548523 0 0.9000 612 | 1/11 28 h-m-p 0.4936 2.5054 0.2319 +YC 2992.547225 1 1.4190 638 | 1/11 29 h-m-p 0.2831 1.4156 0.1568 ++ 2992.546546 m 1.4156 662 | 2/11 30 h-m-p 1.6000 8.0000 0.1226 C 2992.546419 0 0.4466 686 | 2/11 31 h-m-p 1.6000 8.0000 0.0139 Y 2992.546373 0 0.7835 709 | 2/11 32 h-m-p 1.6000 8.0000 0.0035 Y 2992.546371 0 0.6420 732 | 2/11 33 h-m-p 1.6000 8.0000 0.0003 Y 2992.546371 0 0.9806 755 | 2/11 34 h-m-p 1.6000 8.0000 0.0000 Y 2992.546371 0 0.8758 778 | 2/11 35 h-m-p 1.6000 8.0000 0.0000 Y 2992.546371 0 1.6000 801 | 2/11 36 h-m-p 1.6000 8.0000 0.0000 Y 2992.546371 0 1.6000 824 | 2/11 37 h-m-p 1.6000 8.0000 0.0000 ---------Y 2992.546371 0 0.0000 856 Out.. lnL = -2992.546371 857 lfun, 3428 eigenQcodon, 12855 P(t) Time used: 0:12 Model 7: beta TREE # 1 (1, 4, (2, 3)); MP score: 199 0.072198 0.291852 0.067385 0.028597 0.017079 2.539852 0.996708 1.805788 ntime & nrate & np: 5 1 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 7.901061 np = 8 lnL0 = -2999.484087 Iterating by ming2 Initial: fx= 2999.484087 x= 0.07220 0.29185 0.06739 0.02860 0.01708 2.53985 0.99671 1.80579 1 h-m-p 0.0000 0.0048 54.9888 ++CYC 2999.245955 2 0.0002 18 | 0/8 2 h-m-p 0.0002 0.0015 58.5767 CYC 2999.108415 2 0.0001 32 | 0/8 3 h-m-p 0.0001 0.0019 53.7596 YCC 2999.054156 2 0.0001 46 | 0/8 4 h-m-p 0.0001 0.0114 42.4242 +CCC 2998.798511 2 0.0006 62 | 0/8 5 h-m-p 0.0007 0.0275 41.5025 CCC 2998.633523 2 0.0005 77 | 0/8 6 h-m-p 0.0003 0.0125 82.1617 ++ QuantileBeta(0.15, 0.00500, 2.20798) = 1.188686e-160 2000 rounds YYYCC 2995.863307 4 0.0040 95 | 0/8 7 h-m-p 0.2011 1.0054 1.4518 YYYYYC 2995.600843 5 0.2012 111 | 0/8 8 h-m-p 0.2678 1.5204 1.0907 YCYCCC 2994.768680 5 0.7303 131 | 0/8 9 h-m-p 0.0305 0.1524 6.6131 +YYYYYYCCCC 2992.825648 9 0.1414 157 | 0/8 10 h-m-p 0.0248 0.1239 0.7549 YCCC 2992.817171 3 0.0066 173 | 0/8 11 h-m-p 0.0160 8.0000 0.8068 ++YCCC 2992.705005 3 0.1555 199 | 0/8 12 h-m-p 0.9855 4.9275 0.0971 YYCCC 2992.585204 4 1.0455 224 | 0/8 13 h-m-p 1.6000 8.0000 0.0222 YYC 2992.574112 2 1.2089 245 | 0/8 14 h-m-p 1.5551 8.0000 0.0173 C 2992.569822 0 1.5297 264 | 0/8 15 h-m-p 1.6000 8.0000 0.0136 YC 2992.568308 1 1.0908 284 | 0/8 16 h-m-p 1.6000 8.0000 0.0030 YC 2992.568083 1 1.1066 304 | 0/8 17 h-m-p 1.6000 8.0000 0.0004 Y 2992.568081 0 1.0673 323 | 0/8 18 h-m-p 1.6000 8.0000 0.0000 Y 2992.568081 0 1.0407 342 | 0/8 19 h-m-p 1.6000 8.0000 0.0000 Y 2992.568081 0 1.1529 361 | 0/8 20 h-m-p 1.6000 8.0000 0.0000 --------------Y 2992.568081 0 0.0000 394 Out.. lnL = -2992.568081 395 lfun, 4345 eigenQcodon, 19750 P(t) Time used: 0:21 Model 8: beta&w>1 TREE # 1 (1, 4, (2, 3)); MP score: 199 initial w for M8:NSbetaw>1 reset. 0.072198 0.291852 0.067385 0.028597 0.017079 2.543435 0.900000 0.709770 1.329016 2.821721 ntime & nrate & np: 5 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 5.936559 np = 10 lnL0 = -3005.298728 Iterating by ming2 Initial: fx= 3005.298728 x= 0.07220 0.29185 0.06739 0.02860 0.01708 2.54344 0.90000 0.70977 1.32902 2.82172 1 h-m-p 0.0000 0.0008 151.6158 ++YCC 3001.496095 2 0.0003 20 | 0/10 2 h-m-p 0.0000 0.0002 296.2820 +YCCC 2998.908991 3 0.0001 39 | 0/10 3 h-m-p 0.0000 0.0001 287.8727 +YCC 2997.980265 2 0.0001 56 | 0/10 4 h-m-p 0.0001 0.0003 68.8778 +CC 2997.628054 1 0.0002 72 | 0/10 5 h-m-p 0.0006 0.0044 23.6688 +YC 2996.928126 1 0.0030 87 | 0/10 6 h-m-p 0.0003 0.0033 203.6378 +YCCCC 2994.694020 4 0.0010 108 | 0/10 7 h-m-p 0.0033 0.0163 37.0538 CYC 2994.434578 2 0.0010 124 | 0/10 8 h-m-p 0.0211 1.4221 1.7147 ++CCC 2993.623475 2 0.3286 143 | 0/10 9 h-m-p 0.4504 2.2522 0.9826 YCCC 2993.385084 3 0.3036 161 | 0/10 10 h-m-p 0.6316 3.1581 0.3970 YYCC 2993.237284 3 0.4656 188 | 0/10 11 h-m-p 1.2777 8.0000 0.1447 YC 2993.127971 1 0.5843 212 | 0/10 12 h-m-p 0.2787 3.8244 0.3033 +CYCCC 2992.929209 4 1.6790 243 | 0/10 13 h-m-p 1.5388 7.6942 0.1126 YC 2992.827208 1 2.7070 267 | 0/10 14 h-m-p 1.5765 7.8824 0.0593 YCC 2992.740171 2 1.1850 293 | 0/10 15 h-m-p 0.1664 1.0668 0.4222 CCCC 2992.707495 3 0.3131 322 | 0/10 16 h-m-p 0.3995 1.9973 0.2239 YCCC 2992.673882 3 0.7914 350 | 0/10 17 h-m-p 1.6000 8.0000 0.0707 CCC 2992.633731 2 2.0560 377 | 0/10 18 h-m-p 0.1499 0.7497 0.2450 +C 2992.610287 0 0.5998 401 | 0/10 19 h-m-p 0.1565 0.7826 0.0688 ++ 2992.591101 m 0.7826 424 | 0/10 20 h-m-p -0.0000 -0.0000 0.1152 h-m-p: -0.00000000e+00 -0.00000000e+00 1.15224365e-01 2992.591101 .. | 0/10 21 h-m-p 0.0000 0.0123 3.4556 +C 2992.590456 0 0.0001 468 | 0/10 22 h-m-p 0.0001 0.0471 3.3411 YC 2992.589811 1 0.0002 482 | 0/10 23 h-m-p 0.0001 0.0159 7.3111 YC 2992.588903 1 0.0001 496 | 0/10 24 h-m-p 0.0005 0.2289 3.6713 YC 2992.587996 1 0.0003 510 | 0/10 25 h-m-p 0.0011 0.1067 1.2074 C 2992.587811 0 0.0004 523 | 0/10 26 h-m-p 0.0006 0.2555 0.8154 ++CC 2992.585696 1 0.0103 540 | 0/10 27 h-m-p 0.0018 0.0412 4.6329 CC 2992.582738 1 0.0027 565 | 0/10 28 h-m-p 0.0080 0.0398 0.2436 ++ 2992.580817 m 0.0398 578 | 1/10 29 h-m-p 0.0714 7.8982 0.0933 ------------Y 2992.580817 0 0.0000 613 | 1/10 30 h-m-p 0.0084 4.1864 0.0514 +Y 2992.580699 0 0.0645 636 | 1/10 31 h-m-p 0.5777 8.0000 0.0057 C 2992.580631 0 0.7983 658 | 1/10 32 h-m-p 1.6000 8.0000 0.0016 +C 2992.580623 0 6.0868 681 | 1/10 33 h-m-p 1.6000 8.0000 0.0025 C 2992.580620 0 1.2910 703 | 1/10 34 h-m-p 1.6000 8.0000 0.0001 --------C 2992.580620 0 0.0000 733 | 1/10 35 h-m-p 0.0160 8.0000 0.0378 ++C 2992.580589 0 0.3678 757 | 1/10 36 h-m-p 1.6000 8.0000 0.0084 Y 2992.580529 0 2.8391 779 | 1/10 37 h-m-p 1.6000 8.0000 0.0005 Y 2992.580528 0 3.0680 801 | 1/10 38 h-m-p 1.6000 8.0000 0.0006 ++ 2992.580517 m 8.0000 823 | 1/10 39 h-m-p 0.0058 2.7614 0.8173 +++CYY 2992.578448 2 0.9252 851 | 1/10 40 h-m-p 1.3564 6.7820 0.2218 YYY 2992.577418 2 1.1326 875 | 1/10 41 h-m-p 0.4585 8.0000 0.5478 -Y 2992.577359 0 0.0552 898 | 1/10 42 h-m-p 1.0425 8.0000 0.0290 YC 2992.576832 1 1.8574 921 | 1/10 43 h-m-p 0.6303 8.0000 0.0854 +Y 2992.576028 0 1.6173 944 | 1/10 44 h-m-p 0.7868 6.2164 0.1756 YYY 2992.574495 2 0.7868 968 | 1/10 45 h-m-p 1.6000 8.0000 0.0575 C 2992.573912 0 0.3495 990 | 1/10 46 h-m-p 0.1576 7.6237 0.1274 +C 2992.573175 0 0.6303 1013 | 1/10 47 h-m-p 0.2851 3.1638 0.2817 YY 2992.572716 1 0.2851 1036 | 1/10 48 h-m-p 1.6000 8.0000 0.0392 C 2992.571906 0 1.7328 1058 | 1/10 49 h-m-p 1.6000 8.0000 0.0287 YY 2992.571529 1 1.6000 1081 | 1/10 50 h-m-p 1.6000 8.0000 0.0154 YC 2992.571404 1 0.2585 1104 | 1/10 51 h-m-p 0.0829 8.0000 0.0479 +YC 2992.571293 1 0.7407 1128 | 1/10 52 h-m-p 1.6000 8.0000 0.0217 Y 2992.571233 0 0.8646 1150 | 1/10 53 h-m-p 1.6000 8.0000 0.0080 Y 2992.571197 0 1.0523 1172 | 1/10 54 h-m-p 0.6774 8.0000 0.0124 C 2992.571188 0 0.8297 1194 | 1/10 55 h-m-p 1.6000 8.0000 0.0037 Y 2992.571185 0 1.2330 1216 | 1/10 56 h-m-p 1.6000 8.0000 0.0009 C 2992.571184 0 1.3346 1238 | 1/10 57 h-m-p 1.6000 8.0000 0.0001 Y 2992.571184 0 0.9417 1260 | 1/10 58 h-m-p 0.8341 8.0000 0.0001 C 2992.571184 0 0.8341 1282 | 1/10 59 h-m-p 1.6000 8.0000 0.0000 ---Y 2992.571184 0 0.0040 1307 Out.. lnL = -2992.571184 1308 lfun, 15696 eigenQcodon, 71940 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2999.367308 S = -2814.566245 -178.444870 Calculating f(w|X), posterior probabilities of site classes. did 10 / 209 patterns 0:52 did 20 / 209 patterns 0:52 did 30 / 209 patterns 0:52 did 40 / 209 patterns 0:52 did 50 / 209 patterns 0:52 did 60 / 209 patterns 0:53 did 70 / 209 patterns 0:53 did 80 / 209 patterns 0:53 did 90 / 209 patterns 0:53 did 100 / 209 patterns 0:53 did 110 / 209 patterns 0:54 did 120 / 209 patterns 0:54 did 130 / 209 patterns 0:54 did 140 / 209 patterns 0:54 did 150 / 209 patterns 0:54 did 160 / 209 patterns 0:55 did 170 / 209 patterns 0:55 did 180 / 209 patterns 0:55 did 190 / 209 patterns 0:55 did 200 / 209 patterns 0:55 did 209 / 209 patterns 0:56 Time used: 0:56 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=508 D_melanogaster_ZnT41F-PB MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD D_sechellia_ZnT41F-PB MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD D_simulans_ZnT41F-PB MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD D_yakuba_ZnT41F-PB MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD *.******* **.************ ******. *:*:*****:*** * D_melanogaster_ZnT41F-PB YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS D_sechellia_ZnT41F-PB YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS D_simulans_ZnT41F-PB YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS D_yakuba_ZnT41F-PB NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS ********** *:**:**************************.****** D_melanogaster_ZnT41F-PB ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG D_sechellia_ZnT41F-PB ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG D_simulans_ZnT41F-PB ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG D_yakuba_ZnT41F-PB EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG *:******:***********. *** *********** ***:******** D_melanogaster_ZnT41F-PB GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV D_sechellia_ZnT41F-PB GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV D_simulans_ZnT41F-PB GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV D_yakuba_ZnT41F-PB GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV *********************************.* ************** D_melanogaster_ZnT41F-PB IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV D_sechellia_ZnT41F-PB IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV D_simulans_ZnT41F-PB IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV D_yakuba_ZnT41F-PB IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV *********************::**:*******************.**** D_melanogaster_ZnT41F-PB MMFVLHGSWFVNGNGHGHSHSH--SHSHSHSHGNGHEPNDSLSQTRSNSN D_sechellia_ZnT41F-PB MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN D_simulans_ZnT41F-PB MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN D_yakuba_ZnT41F-PB MMFVLHGSWFVSRNGHG--------HSHSHNHENEHEPNNSPSQTRSNSY ***********. **** ****:.* * ****:* ******* D_melanogaster_ZnT41F-PB FLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAH D_sechellia_ZnT41F-PB FLTAIGSQ---SADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAH D_simulans_ZnT41F-PB FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH D_yakuba_ZnT41F-PB IYTASGGQNPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAH : *: *.* ..**..*:*** * .****:****** :*:*.::*** D_melanogaster_ZnT41F-PB EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSI D_sechellia_ZnT41F-PB EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI D_simulans_ZnT41F-PB EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI D_yakuba_ZnT41F-PB EEKNLNLRAAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSI *:*************************:***** **************** D_melanogaster_ZnT41F-PB IVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQ D_sechellia_ZnT41F-PB IVIMTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ D_simulans_ZnT41F-PB IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ D_yakuba_ZnT41F-PB IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQ *************:***:******************::****:******* D_melanogaster_ZnT41F-PB QTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE D_sechellia_ZnT41F-PB QTSQQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTE D_simulans_ZnT41F-PB QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE D_yakuba_ZnT41F-PB QTSQQRVLMVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTE ************* ***** :****:** **:.*:**:**:***:***** D_melanogaster_ZnT41F-PB oo------ D_sechellia_ZnT41F-PB ooo----- D_simulans_ZnT41F-PB -------- D_yakuba_ZnT41F-PB oooooooo
>D_melanogaster_ZnT41F-PB ATGCCAAAATATCAGAAGCTTGACAACACACTGTTGCCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGGTTACTTTGATGATAATCATCAAA GTTTGGGAATCCAACAGGATCCAGATACTAGAGATGATCGACTGTCAGAT TACCAAGATAGGTATTACAGCGTTAACAACAATAGTGTTAATAGGGAGGT GGTGACAATTGGGTCAAATGTCGTCCGGGTTCCAGAGGAGCAAACCTGGG AAGTGCCACTGTTGGGCGATTGTGGTGACAGTGCGAGAAACCAGAGCTCG GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT CAGAGCCAACTCGAAGAGCAAATCTGCACAGGAGGCCAAGTATAAAATTA TGCTCGCAGTTGCTCTGTGTTGCGTATTTATGATCATTGAATTTCTTGGC GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTCGTCATCGGTCTAGTCGCCATATGGATAGGGG GTCGCCCGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCTTCTATTTTGGGAATCTGGTTCGTAACTACCCTGCT CGTGGTTGTGGCTATTGAGAGGATCTTCTCCCAAGACTTTGAATTAAACG CCGATATGATGATGCTGATTTCAGGCATTGGCATAGTCATAAATATCGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG CCACAGTCACAGCCAT------AGTCATAGTCACAGCCACAGTCACGGAA ACGGACATGAGCCAAACGATAGTCTTTCACAAACACGTTCCAATTCGAAC TTTCTTACGACCATTGGAAGTCAAAGCGCTTCAACGGCAGATGAGGAGGA TTCAATAAGGAAAGAAATTAATTCAAACGAGCATAAGATTGTTATTACAA ATGGGAAAAAACCAACTCTGACTGGGACTTCAAACATGGAGCTGGCACAC GAGGATAAAAACCTGAACCTGCGTGCTGCTATGATTCATGTGATTGGAGA CCTAGTGCAGAGCATTGGCGTTTTTTTGGCCGCCGTCCTAATTAAAGTTT GTCCAGGTGCCAAGTATGCTGATCCCCTGTGTACTCTCATATTCTCAATT ATTGTAATAATGACTACCTTGCGTCTGTTTCGGGAGTCTTTGGGCATCAT CGTGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC TGGGCAGCATCGAAGGTGTCAGATCTTTGCACCACCTAAACGTGTGGCAA CAGACCTCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG AGCGGACGGCAATGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCAGCC CAAGATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACAGAG ------------------------ >D_sechellia_ZnT41F-PB ATGCCAAAATATCAGAAGCTTGACAACACACTGCTGTCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGCTTACTTTGATGATAACCATCAAA ATCTGGGTCTCCAACAGGATCCAGATACTAGAGACGATCGATTACCAGAC TACCAAGATAGGTATTACAGCGTTAACAACAATGGTGTTGATAGGGAAAT GGTGACAATTGGATCAAATGTCGTCCGCGTTCCAGAGGAGCAAACCTGGG AAGTGCCACTGTTGGGCGATTGTGGGGACAGTGCGAGAAACCAGAGCTCG GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT CAGGGCCAACCCGAAGAGCAAATCTGCCCAGGAGGCCAAGTATAAAATTA TGCTCGCAGTTGCCCTGTGTTGCGTTTTTATGATCATCGAATTTCTTGGC GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTTGTCATCGGTCTAGTCGCCATATGGATAGGGG GTCGCCAGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCTTCTATCCTGGGGATCTGGTTCGTAACTACCCTGCT CGTGGTTGTGGCTATTCAGAGGATCTACTCCCAGGACTTTGAACTAAACG CCGATATGATGATGCTCATTTCAGGCATTGGCATAGTCATAAATATAGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG CCACAGTCACAGCCATGGTCATAGTCACAGCCATAGTCATAGTCACGGAA ACGGACATGAGCCAAATAATAGTCCTTCACAAACACGTTCCAATTCCAAC TTTCTTACGGCGATTGGAAGTCAA---------AGCGCAGATGAGGAGGA TTCACTAAGGAAAGAAATTAATTCGAACGAGCATAAGATTGTTATTACAA ATGGGAAAAAACAAATTCTGACTGGGTCTTCAGACATGCAGCTGGCTCAC GAGGAGAAAAACCTCAACCTGCGTGCTGCGATGATTCATGTGATTGGAGA CCTAGTGCAGAGCATTGGCGTTTTCTTGGCTGCCGTCCTAATAAAAGTTT ATCCAGGTGCCAAGTATGCTGATCCGCTGTGTACTCTCATATTCTCAATT ATTGTAATAATGACTACCTTGCGTCTGTTCCGGGAGTCTATGGGCATCAT CATGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC TGGGCAGCATCGAAGGTGTCAGATCTGTGCACCACCTAAACGTGTGGCAG CAAACCTCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG AGCTGACAGCAACGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCGGCC CAAAATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACGGAG ------------------------ >D_simulans_ZnT41F-PB ATGCCAAAATATCAGAAGCTTGACAACATACTGTTGCCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGCTTACTTTGATGATAACCATCAAA ATCTGGGTCTCCAACAGGATCCAGATACTAGAGAAGATCGATTACCAGAT TACCAAGATAGGTATTACAGCGTTAACAACAATGGTGTTGATAGGGAAAT GGTGACAATTGGATCAAATGTCGTCCGCGTTCCAGAGGAGCAAACCTGGG AAGTGCCACTGTTGGGCGATTGTGGGGACAGTGCGAGAAACCAGAGCTCG GAAACGGAATTTGATATGCAGCGTGAGTGCTGCAATCATCAACCAGGGTT CAGGGCCAACCCGAAGAGCAAATCTGACCAGGAGGCCAAGTATAAAATTA TGCTCGCAGTTGCCCTGTGTTGCGTTTTTATGATCATCGAATTTCTTGGC GGCTATGTCGCCGGAAGTCTGGCCATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTCGTCATCGGTCTAGTCGCCATATGGATAGGGG GTCGCCAGCCAGACGAGCGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCTTCTATCCTGGGGATCTGGTTCGTAACTACCCTGCT CGTGGTTGTGGCTATTCAGAGGATCTACTCCCAGGACTTTGAACTAAACG CCGATATGATGATGCTCATTTCAGGCATTGGCATAGTCATAAATATCGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTGAACGGGAATGGTCATGG CCACAGTCACAGCCATGGTCATAGTCACAGCCACAGTTATAGTCACGGAA ACGGACATGAGCCAAATAATAGTCCTTCACAAACACGTTCCAATTCCAAC TTTCTTACGGCGATTGGAAGTCAAAGCGCTTCAACGGCAGATGAGGAGGA TTCACTAAGGAAAGAAATTAATTCAAACGAGCATAAGATTGTTATTACAA ATGGGAAAAAACAAATTCTGACTGGGACTTCAAACATGCAGCTGGCTCAC GAGGAGAAAAACCTCAACCTGCGTGCTGCGATGATTCATGTGATTGGAGA CCTAGTGCAGAGCATTGGCGTTTTCTTGGCTGCCGTCCTAATAAAAGTTT ATCCAGGTGCCAAGTATGCTGACCCCCTGTGTACTCTCATATTCTCAATT ATTGTAATAATGACTACCTTGCGTCTGTTCCGGGAGTCTATGGGCATCAT CGTGAATGCAGTTCCACAAAACCTTAATATGCGCACTCTGCACTTGGAGC TGGGCAGCATCGAAGGTGTCAGATCTGTGCACCACCTAAACGTGTGGCAG CAAACATCTCAGCAAAGGGTGCTGATGGTGCATCTCGTTACAGACTCCCG AGCTGACAGCCATGAGGTACTGCAGGCTGCCACGGCGCTCGTATCCGGTC CAAAATATAACATCAAGCATTCAACCATTCAATTGGAACCTACAACGGAG ------------------------ >D_yakuba_ZnT41F-PB ATGTCAAAATATCAGAAGCTTGACAATGCACTGCTATCCAACGCTCACGA TGACGACTCTGAAGGGGGTTTCCCGGTTTGCTTTGATGATAATCATCAAA ATACGGGCTTCCAACGGGATCCAGATACTAGAGATGATCGACTGCTAGAT AATCAAGACAGGTATTACAGCGTTAACAACAACGAAGTGGATAGGGAGGT GGTGACAATTGGGTCAAATGTCGTCCGAGTTCCAGAGGAGCAAACCTGGG AGGTGCCACTGTTGGGCGACTGTGGTGACAATGCGAGGAATCAGAGTTCG GAAGCGGAATTTGATATGCAGCGTGATTGCTGCAATCATCAACCAGGGTT CAGGGCCAACCCAATGAGCAAATCTGCACAGGAGGCCAAATATAAAATTA TGCTAGCAGTTTTCCTGTGTTGCATATTTATGATCATTGAATTTCTTGGC GGCTATGTGGCCGGAAGTCTAGCTATAATGACGGATGCCGCCCATTTAGC ATCTGATTGCATTAGTTTCGTCATCGGTTTAGTCGCTATATGGATAGGGA GTCGCCCGCCCGACGAACGTATGTCCTTTGGGTACAAACGCTTTGAGGTT ATCGGAGCTCTGGCCTCTATCTTGGGAATTTGGTTTGTAACTACCCTGCT CGTGGTTGTGGCTGTTCAAAGGATCTACTCTCAGGACTTTGAACTAAACG CCGATATGATGATGCTTATTTCAGGCATTGGCATTTTCATAAATATTGTA ATGATGTTTGTTTTGCATGGATCCTGGTTCGTCAGTCGGAATGGACATGG C------------------------CACAGTCACAGCCATAATCACGAAA ACGAACATGAGCCAAATAATAGTCCTTCACAAACGCGTTCCAACTCCTAC ATTTATACGGCGAGTGGTGGTCAAAATCCTTCAAAGGTGGATGAAAGGCA TTCAGTAAGGAAAGAAAGAAATTTAACCGAACATAAGATTCTTATTACAA ATGGAAAAAAAACAAATCAGGCTGGAACTTCAAAAATCCAGTTGGCACAC GAGGAGAAAAACCTGAACTTGCGTGCTGCGATGATTCATGTAATTGGGGA CCTAGTGCAGAGCATTGGCGTTTTTTTGGCCTCCGTCCTAATTAAAGTTT GTCCAGGTGCCAAATATGCTGATCCCCTGTGTACTCTAATATTTTCAATT ATTGTAATTATGACTACTCTGCGTCTGTTTCGGGAGTCTATGGGAATCAT CGTGAATGCAGTTCCACAGAACCTTAATATGCGCACTCTGCATTTGGAGC TGGGCAGCCTCCAAGGTGTCAGATCTGTCCACCACCTAAACGTGTGGCAA CAAACCTCTCAGCAAAGGGTGCTGATGGTACATCTCGTTATAGACTCTCG AGCTGACTGCAATGAGGTACTGCAGACTGCCACGGAGCTAGTCGCTGGCC CAAAATATAACGTAAAGCATGCAACTATTCAAATAGAACCAACAACTGAG ------------------------
>D_melanogaster_ZnT41F-PB MPKYQKLDNTLLPNAHDDDSEGGFPGYFDDNHQSLGIQQDPDTRDDRLSD YQDRYYSVNNNSVNREVVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSH--SHSHSHSHGNGHEPNDSLSQTRSNSN FLTTIGSQSASTADEEDSIRKEINSNEHKIVITNGKKPTLTGTSNMELAH EDKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQ QTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE >D_sechellia_ZnT41F-PB MPKYQKLDNTLLSNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTRDDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSAQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSHSHGNGHEPNNSPSQTRSNSN FLTAIGSQ---SADEEDSLRKEINSNEHKIVITNGKKQILTGSSDMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIMNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSNEVLQAATALVSGPKYNIKHSTIQLEPTTE >D_simulans_ZnT41F-PB MPKYQKLDNILLPNAHDDDSEGGFPAYFDDNHQNLGLQQDPDTREDRLPD YQDRYYSVNNNGVDREMVTIGSNVVRVPEEQTWEVPLLGDCGDSARNQSS ETEFDMQRECCNHQPGFRANPKSKSDQEAKYKIMLAVALCCVFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRQPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAIQRIYSQDFELNADMMMLISGIGIVINIV MMFVLHGSWFVNGNGHGHSHSHGHSHSHSYSHGNGHEPNNSPSQTRSNSN FLTAIGSQSASTADEEDSLRKEINSNEHKIVITNGKKQILTGTSNMQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLAAVLIKVYPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSIEGVRSVHHLNVWQ QTSQQRVLMVHLVTDSRADSHEVLQAATALVSGPKYNIKHSTIQLEPTTE >D_yakuba_ZnT41F-PB MSKYQKLDNALLSNAHDDDSEGGFPVCFDDNHQNTGFQRDPDTRDDRLLD NQDRYYSVNNNEVDREVVTIGSNVVRVPEEQTWEVPLLGDCGDNARNQSS EAEFDMQRDCCNHQPGFRANPMSKSAQEAKYKIMLAVFLCCIFMIIEFLG GYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGSRPPDERMSFGYKRFEV IGALASILGIWFVTTLLVVVAVQRIYSQDFELNADMMMLISGIGIFINIV MMFVLHGSWFVSRNGHG--------HSHSHNHENEHEPNNSPSQTRSNSY IYTASGGQNPSKVDERHSVRKERNLTEHKILITNGKKTNQAGTSKIQLAH EEKNLNLRAAMIHVIGDLVQSIGVFLASVLIKVCPGAKYADPLCTLIFSI IVIMTTLRLFRESMGIIVNAVPQNLNMRTLHLELGSLQGVRSVHHLNVWQ QTSQQRVLMVHLVIDSRADCNEVLQTATELVAGPKYNVKHATIQIEPTTE
#NEXUS [ID: 0391553231] begin taxa; dimensions ntax=4; taxlabels D_melanogaster_ZnT41F-PB D_sechellia_ZnT41F-PB D_simulans_ZnT41F-PB D_yakuba_ZnT41F-PB ; end; begin trees; translate 1 D_melanogaster_ZnT41F-PB, 2 D_sechellia_ZnT41F-PB, 3 D_simulans_ZnT41F-PB, 4 D_yakuba_ZnT41F-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.02945611,4:0.1509269,(2:0.01125743,3:0.00607299)1.000:0.02543826); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.02945611,4:0.1509269,(2:0.01125743,3:0.00607299):0.02543826); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3132.56 -3140.32 2 -3132.61 -3140.99 -------------------------------------- TOTAL -3132.59 -3140.71 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/ZnT41F-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.226993 0.000760 0.174485 0.279613 0.224553 1335.43 1379.02 1.000 r(A<->C){all} 0.102828 0.000674 0.052481 0.153821 0.101216 614.36 936.38 1.000 r(A<->G){all} 0.273240 0.001522 0.198514 0.349207 0.271394 855.50 919.68 1.000 r(A<->T){all} 0.082734 0.000522 0.038931 0.127129 0.081285 981.23 1122.39 1.000 r(C<->G){all} 0.093085 0.000591 0.047879 0.139639 0.091713 1098.29 1132.18 1.000 r(C<->T){all} 0.399734 0.002109 0.309832 0.485405 0.398638 952.07 1004.63 1.000 r(G<->T){all} 0.048378 0.000349 0.010706 0.082731 0.046395 925.22 1112.13 1.000 pi(A){all} 0.277884 0.000124 0.255425 0.298482 0.277774 1337.03 1340.76 1.000 pi(C){all} 0.217673 0.000101 0.199538 0.238744 0.217172 1297.30 1391.11 1.001 pi(G){all} 0.245223 0.000112 0.223751 0.264964 0.245344 1321.15 1380.15 1.000 pi(T){all} 0.259220 0.000115 0.239311 0.281544 0.259150 1299.39 1323.36 1.000 alpha{1,2} 0.075513 0.003643 0.000132 0.187478 0.062933 1298.44 1302.01 1.000 alpha{3} 1.657819 0.509513 0.511637 3.057750 1.520630 1313.43 1407.21 1.000 pinvar{all} 0.231934 0.012513 0.006409 0.420747 0.234877 1349.61 1425.30 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/444/ZnT41F-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 4 ls = 489 Codon usage in sequences ------------------------------------------------------------------------------------------------------ Phe TTT 11 10 9 12 | Ser TCT 7 8 7 9 | Tyr TAT 6 7 8 7 | Cys TGT 4 3 3 4 TTC 7 7 8 7 | TCC 6 8 7 6 | TAC 4 5 5 4 | TGC 4 4 4 6 Leu TTA 2 2 2 3 | TCA 9 7 8 7 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 11 6 7 7 | TCG 3 2 1 1 | TAG 0 0 0 0 | Trp TGG 5 5 5 5 ------------------------------------------------------------------------------------------------------ Leu CTT 5 4 4 5 | Pro CCT 1 2 2 1 | His CAT 11 12 11 13 | Arg CGT 5 5 5 5 CTC 5 8 8 3 | CCC 2 0 2 2 | CAC 8 7 8 7 | CGC 3 4 4 3 CTA 4 6 6 10 | CCA 11 11 11 10 | Gln CAA 12 12 12 13 | CGA 2 2 2 3 CTG 18 18 17 14 | CCG 2 3 2 2 | CAG 9 13 13 11 | CGG 2 1 1 3 ------------------------------------------------------------------------------------------------------ Ile ATT 19 17 17 20 | Thr ACT 8 6 7 10 | Asn AAT 13 13 13 19 | Ser AGT 9 7 7 8 ATC 11 11 12 8 | ACC 6 5 4 4 | AAC 18 18 18 13 | AGC 7 8 7 5 ATA 8 9 9 8 | ACA 7 6 6 4 | Lys AAA 9 10 10 13 | Arg AGA 5 3 3 3 Met ATG 16 19 18 17 | ACG 5 5 6 5 | AAG 6 6 6 4 | AGG 5 6 6 8 ------------------------------------------------------------------------------------------------------ Val GTT 12 13 13 12 | Ala GCT 9 11 11 10 | Asp GAT 19 16 16 16 | Gly GGT 8 8 9 7 GTC 8 8 8 9 | GCC 12 13 12 10 | GAC 9 12 11 11 | GGC 10 10 9 10 GTA 6 5 5 8 | GCA 6 4 4 7 | Glu GAA 9 10 11 13 | GGA 9 8 8 8 GTG 12 11 12 12 | GCG 3 4 4 4 | GAG 18 16 16 14 | GGG 8 9 9 6 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_ZnT41F-PB position 1: T:0.16155 C:0.20450 A:0.31084 G:0.32311 position 2: T:0.31697 C:0.19836 A:0.30879 G:0.17587 position 3: T:0.30061 C:0.24540 A:0.20245 G:0.25153 Average T:0.25971 C:0.21609 A:0.27403 G:0.25017 #2: D_sechellia_ZnT41F-PB position 1: T:0.15133 C:0.22086 A:0.30470 G:0.32311 position 2: T:0.31493 C:0.19427 A:0.32106 G:0.16973 position 3: T:0.29039 C:0.26176 A:0.19427 G:0.25358 Average T:0.25222 C:0.22563 A:0.27335 G:0.24881 #3: D_simulans_ZnT41F-PB position 1: T:0.15133 C:0.22086 A:0.30470 G:0.32311 position 2: T:0.31697 C:0.19223 A:0.32311 G:0.16769 position 3: T:0.29039 C:0.25971 A:0.19836 G:0.25153 Average T:0.25290 C:0.22427 A:0.27539 G:0.24744 #4: D_yakuba_ZnT41F-PB position 1: T:0.15951 C:0.21472 A:0.30470 G:0.32106 position 2: T:0.31697 C:0.18814 A:0.32311 G:0.17178 position 3: T:0.32311 C:0.22086 A:0.22495 G:0.23108 Average T:0.26653 C:0.20791 A:0.28425 G:0.24131 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 42 | Ser S TCT 31 | Tyr Y TAT 28 | Cys C TGT 14 TTC 29 | TCC 27 | TAC 18 | TGC 18 Leu L TTA 9 | TCA 31 | *** * TAA 0 | *** * TGA 0 TTG 31 | TCG 7 | TAG 0 | Trp W TGG 20 ------------------------------------------------------------------------------ Leu L CTT 18 | Pro P CCT 6 | His H CAT 47 | Arg R CGT 20 CTC 24 | CCC 6 | CAC 30 | CGC 14 CTA 26 | CCA 43 | Gln Q CAA 49 | CGA 9 CTG 67 | CCG 9 | CAG 46 | CGG 7 ------------------------------------------------------------------------------ Ile I ATT 73 | Thr T ACT 31 | Asn N AAT 58 | Ser S AGT 31 ATC 42 | ACC 19 | AAC 67 | AGC 27 ATA 34 | ACA 23 | Lys K AAA 42 | Arg R AGA 14 Met M ATG 70 | ACG 21 | AAG 22 | AGG 25 ------------------------------------------------------------------------------ Val V GTT 50 | Ala A GCT 41 | Asp D GAT 67 | Gly G GGT 32 GTC 33 | GCC 47 | GAC 43 | GGC 39 GTA 24 | GCA 21 | Glu E GAA 43 | GGA 33 GTG 47 | GCG 15 | GAG 64 | GGG 32 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.15593 C:0.21524 A:0.30624 G:0.32260 position 2: T:0.31646 C:0.19325 A:0.31902 G:0.17127 position 3: T:0.30112 C:0.24693 A:0.20501 G:0.24693 Average T:0.25784 C:0.21847 A:0.27676 G:0.24693 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_ZnT41F-PB D_sechellia_ZnT41F-PB 0.1768 (0.0275 0.1556) D_simulans_ZnT41F-PB 0.2109 (0.0275 0.1305) 0.2675 (0.0093 0.0349) D_yakuba_ZnT41F-PB 0.2535 (0.0723 0.2852) 0.1820 (0.0632 0.3472) 0.1984 (0.0656 0.3306) Model 0: one-ratio TREE # 1: (1, 4, (2, 3)); MP score: 199 lnL(ntime: 5 np: 7): -3001.824688 +0.000000 5..1 5..4 5..6 6..2 6..3 0.081006 0.307149 0.061483 0.029921 0.017311 2.487384 0.260518 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.49687 (1: 0.081006, 4: 0.307149, (2: 0.029921, 3: 0.017311): 0.061483); (D_melanogaster_ZnT41F-PB: 0.081006, D_yakuba_ZnT41F-PB: 0.307149, (D_sechellia_ZnT41F-PB: 0.029921, D_simulans_ZnT41F-PB: 0.017311): 0.061483); Detailed output identifying parameters kappa (ts/tv) = 2.48738 omega (dN/dS) = 0.26052 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.081 1068.9 398.1 0.2605 0.0153 0.0585 16.3 23.3 5..4 0.307 1068.9 398.1 0.2605 0.0578 0.2220 61.8 88.4 5..6 0.061 1068.9 398.1 0.2605 0.0116 0.0444 12.4 17.7 6..2 0.030 1068.9 398.1 0.2605 0.0056 0.0216 6.0 8.6 6..3 0.017 1068.9 398.1 0.2605 0.0033 0.0125 3.5 5.0 tree length for dN: 0.0936 tree length for dS: 0.3591 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 4, (2, 3)); MP score: 199 lnL(ntime: 5 np: 8): -2992.587114 +0.000000 5..1 5..4 5..6 6..2 6..3 0.081068 0.325185 0.065085 0.030690 0.016942 2.547662 0.729208 0.039827 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.51897 (1: 0.081068, 4: 0.325185, (2: 0.030690, 3: 0.016942): 0.065085); (D_melanogaster_ZnT41F-PB: 0.081068, D_yakuba_ZnT41F-PB: 0.325185, (D_sechellia_ZnT41F-PB: 0.030690, D_simulans_ZnT41F-PB: 0.016942): 0.065085); Detailed output identifying parameters kappa (ts/tv) = 2.54766 dN/dS (w) for site classes (K=2) p: 0.72921 0.27079 w: 0.03983 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.081 1067.4 399.6 0.2998 0.0165 0.0551 17.6 22.0 5..4 0.325 1067.4 399.6 0.2998 0.0663 0.2210 70.7 88.3 5..6 0.065 1067.4 399.6 0.2998 0.0133 0.0442 14.2 17.7 6..2 0.031 1067.4 399.6 0.2998 0.0063 0.0209 6.7 8.3 6..3 0.017 1067.4 399.6 0.2998 0.0035 0.0115 3.7 4.6 Time used: 0:03 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 4, (2, 3)); MP score: 199 lnL(ntime: 5 np: 10): -2992.587114 +0.000000 5..1 5..4 5..6 6..2 6..3 0.081068 0.325185 0.065085 0.030690 0.016942 2.547663 0.729208 0.172155 0.039827 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.51897 (1: 0.081068, 4: 0.325185, (2: 0.030690, 3: 0.016942): 0.065085); (D_melanogaster_ZnT41F-PB: 0.081068, D_yakuba_ZnT41F-PB: 0.325185, (D_sechellia_ZnT41F-PB: 0.030690, D_simulans_ZnT41F-PB: 0.016942): 0.065085); Detailed output identifying parameters kappa (ts/tv) = 2.54766 dN/dS (w) for site classes (K=3) p: 0.72921 0.17216 0.09864 w: 0.03983 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.081 1067.4 399.6 0.2998 0.0165 0.0551 17.6 22.0 5..4 0.325 1067.4 399.6 0.2998 0.0663 0.2210 70.7 88.3 5..6 0.065 1067.4 399.6 0.2998 0.0133 0.0442 14.2 17.7 6..2 0.031 1067.4 399.6 0.2998 0.0063 0.0209 6.7 8.3 6..3 0.017 1067.4 399.6 0.2998 0.0035 0.0115 3.7 4.6 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_ZnT41F-PB) Pr(w>1) post mean +- SE for w 62 S 0.534 1.538 +- 0.833 301 T 0.528 1.534 +- 0.855 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.704 0.293 0.003 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.675 0.223 0.072 0.021 0.006 0.002 0.001 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.305 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.053 0.212 0.125 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.072 0.055 0.112 0.049 sum of density on p0-p1 = 1.000000 Time used: 0:07 Model 3: discrete (3 categories) TREE # 1: (1, 4, (2, 3)); MP score: 199 lnL(ntime: 5 np: 11): -2992.546371 +0.000000 5..1 5..4 5..6 6..2 6..3 0.080822 0.324025 0.064935 0.030661 0.016883 2.539852 0.604880 0.044650 0.000001 0.000001 0.841074 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.51733 (1: 0.080822, 4: 0.324025, (2: 0.030661, 3: 0.016883): 0.064935); (D_melanogaster_ZnT41F-PB: 0.080822, D_yakuba_ZnT41F-PB: 0.324025, (D_sechellia_ZnT41F-PB: 0.030661, D_simulans_ZnT41F-PB: 0.016883): 0.064935); Detailed output identifying parameters kappa (ts/tv) = 2.53985 dN/dS (w) for site classes (K=3) p: 0.60488 0.04465 0.35047 w: 0.00000 0.00000 0.84107 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.081 1067.6 399.4 0.2948 0.0163 0.0553 17.4 22.1 5..4 0.324 1067.6 399.4 0.2948 0.0654 0.2219 69.8 88.6 5..6 0.065 1067.6 399.4 0.2948 0.0131 0.0445 14.0 17.8 6..2 0.031 1067.6 399.4 0.2948 0.0062 0.0210 6.6 8.4 6..3 0.017 1067.6 399.4 0.2948 0.0034 0.0116 3.6 4.6 Naive Empirical Bayes (NEB) analysis Time used: 0:12 Model 7: beta (10 categories) TREE # 1: (1, 4, (2, 3)); MP score: 199 lnL(ntime: 5 np: 8): -2992.568081 +0.000000 5..1 5..4 5..6 6..2 6..3 0.080948 0.324609 0.065012 0.030675 0.016915 2.543435 0.064612 0.152889 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.51816 (1: 0.080948, 4: 0.324609, (2: 0.030675, 3: 0.016915): 0.065012); (D_melanogaster_ZnT41F-PB: 0.080948, D_yakuba_ZnT41F-PB: 0.324609, (D_sechellia_ZnT41F-PB: 0.030675, D_simulans_ZnT41F-PB: 0.016915): 0.065012); Detailed output identifying parameters kappa (ts/tv) = 2.54344 Parameters in M7 (beta): p = 0.06461 q = 0.15289 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00002 0.00081 0.01779 0.20079 0.76248 0.98964 0.99999 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.081 1067.5 399.5 0.2972 0.0164 0.0552 17.5 22.1 5..4 0.325 1067.5 399.5 0.2972 0.0658 0.2215 70.3 88.5 5..6 0.065 1067.5 399.5 0.2972 0.0132 0.0444 14.1 17.7 6..2 0.031 1067.5 399.5 0.2972 0.0062 0.0209 6.6 8.4 6..3 0.017 1067.5 399.5 0.2972 0.0034 0.0115 3.7 4.6 Time used: 0:21 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 4, (2, 3)); MP score: 199 lnL(ntime: 5 np: 10): -2992.571184 +0.000000 5..1 5..4 5..6 6..2 6..3 0.080962 0.324701 0.065029 0.030678 0.016918 2.544289 0.795003 0.083657 0.627370 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.51829 (1: 0.080962, 4: 0.324701, (2: 0.030678, 3: 0.016918): 0.065029); (D_melanogaster_ZnT41F-PB: 0.080962, D_yakuba_ZnT41F-PB: 0.324701, (D_sechellia_ZnT41F-PB: 0.030678, D_simulans_ZnT41F-PB: 0.016918): 0.065029); Detailed output identifying parameters kappa (ts/tv) = 2.54429 Parameters in M8 (beta&w>1): p0 = 0.79500 p = 0.08366 q = 0.62737 (p1 = 0.20500) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.07950 0.07950 0.07950 0.07950 0.07950 0.07950 0.07950 0.07950 0.07950 0.07950 0.20500 w: 0.00000 0.00000 0.00000 0.00001 0.00016 0.00176 0.01288 0.06982 0.28623 0.79475 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 5..1 0.081 1067.5 399.5 0.2977 0.0164 0.0552 17.5 22.1 5..4 0.325 1067.5 399.5 0.2977 0.0659 0.2214 70.3 88.4 5..6 0.065 1067.5 399.5 0.2977 0.0132 0.0443 14.1 17.7 6..2 0.031 1067.5 399.5 0.2977 0.0062 0.0209 6.6 8.4 6..3 0.017 1067.5 399.5 0.2977 0.0034 0.0115 3.7 4.6 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_ZnT41F-PB) Pr(w>1) post mean +- SE for w 10 T 0.642 1.445 +- 0.821 13 P 0.652 1.462 +- 0.823 26 G 0.592 1.355 +- 0.801 35 L 0.664 1.485 +- 0.830 37 I 0.628 1.420 +- 0.815 49 S 0.681 1.515 +- 0.832 62 S 0.751 1.626 +- 0.811 138 A 0.632 1.425 +- 0.815 294 L 0.616 1.397 +- 0.809 301 T 0.734 1.603 +- 0.826 305 E 0.561 1.295 +- 0.775 308 I 0.633 1.429 +- 0.820 327 P 0.686 1.524 +- 0.834 328 T 0.573 1.321 +- 0.791 334 N 0.563 1.302 +- 0.784 459 G 0.630 1.422 +- 0.815 484 L 0.518 1.211 +- 0.828 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.389 0.609 p : 0.486 0.374 0.133 0.007 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.046 0.091 0.047 0.080 0.135 0.153 0.145 0.145 0.158 ws: 0.659 0.265 0.065 0.010 0.001 0.000 0.000 0.000 0.000 0.000 Time used: 0:56
Model 1: NearlyNeutral -2992.587114 Model 2: PositiveSelection -2992.587114 Model 0: one-ratio -3001.824688 Model 3: discrete -2992.546371 Model 7: beta -2992.568081 Model 8: beta&w>1 -2992.571184 Model 0 vs 1 18.475148000000445 Model 2 vs 1 0.0 Model 8 vs 7 0.00620600000002014