--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Dec 09 11:15:08 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/444/ZnT35C-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3382.54 -3395.85 2 -3382.93 -3395.25 -------------------------------------- TOTAL -3382.71 -3395.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.502407 0.002429 0.407551 0.598454 0.499052 1501.00 1501.00 1.000 r(A<->C){all} 0.127469 0.000760 0.076612 0.182377 0.126030 978.65 1063.86 1.000 r(A<->G){all} 0.232638 0.001294 0.159760 0.300486 0.230896 980.78 984.66 1.001 r(A<->T){all} 0.163009 0.001074 0.097689 0.226318 0.161007 955.90 1010.40 1.007 r(C<->G){all} 0.101349 0.000355 0.068577 0.142154 0.100195 1110.41 1151.13 1.001 r(C<->T){all} 0.329771 0.001442 0.258815 0.408474 0.329068 847.96 880.43 1.000 r(G<->T){all} 0.045763 0.000214 0.019913 0.076394 0.044328 892.18 1030.90 1.000 pi(A){all} 0.211250 0.000107 0.190183 0.230587 0.211423 1005.11 1253.05 1.000 pi(C){all} 0.280057 0.000119 0.260100 0.301587 0.280039 1405.84 1453.42 1.000 pi(G){all} 0.279908 0.000131 0.257870 0.302111 0.279932 1234.52 1273.36 1.000 pi(T){all} 0.228785 0.000106 0.209786 0.249707 0.228570 1285.49 1315.87 1.000 alpha{1,2} 0.047627 0.000909 0.000104 0.097161 0.046192 744.06 1122.53 1.000 alpha{3} 3.413284 0.985121 1.762646 5.431063 3.286415 1333.95 1356.01 1.000 pinvar{all} 0.426720 0.002143 0.332089 0.512526 0.428400 1221.63 1259.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3086.055409 Model 2: PositiveSelection -3086.055409 Model 0: one-ratio -3105.434808 Model 3: discrete -3086.016048 Model 7: beta -3086.81449 Model 8: beta&w>1 -3086.019792 Model 0 vs 1 38.75879799999984 Model 2 vs 1 0.0 Model 8 vs 7 1.5893960000003062
>C1 MLANWQTARKSSEMNDARLYRNAATSLDKSRLEMLHEYVRDHCHRARSEG VDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFM ISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGR LISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGHGHSHGGS KNASHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGLPTFSYQNTKLV DPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMNVRAALIHVIGDVIQSV GVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTP NYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKR ILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQCNVPEKoooooooooo o >C2 MLANWQTARKSSEMNDARLYRNAATSLDKSRLEMLHEYVRDHCHRARSEG VDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFM ISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGR LISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGHGHSHGGS KKSKKKNPSHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGLPTFSYQ NTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMNVRAALIHVIGD VIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVL MEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIADN ANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCQQCNVPEKooooo o >C3 MLANWQTARKSSEMNDARLYRNAATSLDKSRLEMLHEYVRDHCHRARSEG VDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFM ISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGR LISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGHGHSHGGS KKSKKKNPSHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGLPTFSYQ NTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMNVRAALIHVIGD VIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVL MEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAEN ANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCQQCNVPEKooooo o >C4 MLANWQTARKSSEMNDARLYGNAATSLDKSRLEMLHEYVRDHCHRARSEG VDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFM ISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGR LISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGHGHSHGGS KKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPEDAELPGGGL PTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREAVNMNVRAAL IHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMK DALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAH LAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQMESCQQCNVPE K >C5 MLANWQTARKSLEMNDARLYRNAATSLDKSRLEMLHEYVRDHCHRARSEG VDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFM ISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGR LISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGHGHSHGGT KNPSHVQATSTPCSDSPSQRIEGGVAFAPEDAELPGGGLPTFSYQNTKLV DPTLDLEIAAVLAETAPGSHHHGGPAGREAVNMNVRAALIHVIGDVIQSV GVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTP NYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKR ILDAATSAVHLRYNFFETTIQIEDYTAQMESCQQCNVPEKoooooooooo o >C6 MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGGAHG HSHGGSKNPSHAHATSTPCSASPNQRIEGGVAFAPEDAELPGGGLPTFSY QNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREAVNMNVRAALIHVIG DVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLV LMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAE NANPKQILDAATSAVHLRYNFFETTIQIEDYTAQMESCQQCNVPEKoooo o >C7 MLANWQTARKSSEMNDARLYRKAATSLDKCRMEMLHEYVRDHCHRARSEG VDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFM ISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGR LISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGGGHGHSH GGNKNPSHAHATSTPCSASPNQRIEGGVAFAPEDAELPGSGLPTYSYQNA KLVDPSLDLEIAAVLAETAPGAHHHGGPVGREAVNMNVRAALIHVIGDVI QSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLME GTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAANAN PKMILDAATSAVHLRYNFFETTIQIEEYTAQMESCLQCNVPEKooooooo o CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=471 C1 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH C2 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH C3 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH C4 MLANWQTARKSSEMNDARLYGNAA------TSLDKSRLEMLHEYVRDHCH C5 MLANWQTARKSLEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH C6 MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH C7 MLANWQTARKSSEMNDARLYRKAA------TSLDKCRMEMLHEYVRDHCH *********** ******** :** *:***.*:************ C1 RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT C2 RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT C3 RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT C4 RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT C5 RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT C6 RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT C7 RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT *******************:****************************** C1 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV C2 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV C3 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV C4 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV C5 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV C6 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV C7 DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV ************************************************** C1 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- C2 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- C3 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- C4 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- C5 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- C6 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGG--- C7 WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGG *******************************************.*** C1 GHGHSHGGSKN-----------ASHVQATSTPCSDSPSQRIEGGVAYAPE C2 GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE C3 GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE C4 GHGHSHGGSKKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPE C5 GHGHSHGGTKN-----------PSHVQATSTPCSDSPSQRIEGGVAFAPE C6 AHGHSHGGSKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE C7 GHGHSHGGNKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE .*******.*: .**.:******* **.********:*** C1 DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA C2 DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA C3 DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA C4 DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREA C5 DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPAGREA C6 DAELPGGGLPTFSYQNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREA C7 DAELPGSGLPTYSYQNAKLVDPSLDLEIAAVLAETAPGAHHHGGPVGREA ******.****:****:*****: **************:******.**** C1 VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV C2 VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV C3 VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV C4 VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV C5 VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV C6 VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV C7 VNMNVRAALIHVIGDVIQSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIV *******************:****************************** C1 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS C2 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS C3 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS C4 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS C5 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS C6 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS C7 LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS ************************************************** C1 INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME C2 INKVALSAHLAIADNANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME C3 INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME C4 INKVALSAHLAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQME C5 INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME C6 INKVALSAHLAIAENANPKQILDAATSAVHLRYNFFETTIQIEDYTAQME C7 INKVALSAHLAIAANANPKMILDAATSAVHLRYNFFETTIQIEEYTAQME ************* ***** ***********************:****** C1 SCLQCNVPEKooooooooooo C2 SCQQCNVPEKoooooo----- C3 SCQQCNVPEKoooooo----- C4 SCQQCNVPEK----------- C5 SCQQCNVPEKooooooooooo C6 SCQQCNVPEKooooo------ C7 SCLQCNVPEKoooooooo--- ** ******* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 451 type PROTEIN Struct Unchecked Input File /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21368] Library Relaxation: Multi_proc [72] Relaxation Summary: [21368]--->[20584] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 31.107 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKN-----------ASHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCLQCNVPEKooooooooooo >C2 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIADNANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKoooooo----- >C3 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKoooooo----- >C4 MLANWQTARKSSEMNDARLYGNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK----------- >C5 MLANWQTARKSLEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGTKN-----------PSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPAGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKooooooooooo >C6 MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGG--- AHGHSHGGSKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGGGLPTFSYQNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKQILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKooooo------ >C7 MLANWQTARKSSEMNDARLYRKAA------TSLDKCRMEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGG GHGHSHGGNKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGSGLPTYSYQNAKLVDPSLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAANANPKMILDAATSAVHLRYNFFETTIQIEEYTAQME SCLQCNVPEKoooooooo--- FORMAT of file /tmp/tmp3316276745591782633aln Not Supported[FATAL:T-COFFEE] >C1 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKN-----------ASHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCLQCNVPEKooooooooooo >C2 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIADNANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKoooooo----- >C3 MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKoooooo----- >C4 MLANWQTARKSSEMNDARLYGNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK----------- >C5 MLANWQTARKSLEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGTKN-----------PSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPAGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKooooooooooo >C6 MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGG--- AHGHSHGGSKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGGGLPTFSYQNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKQILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEKooooo------ >C7 MLANWQTARKSSEMNDARLYRKAA------TSLDKCRMEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGG GHGHSHGGNKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGSGLPTYSYQNAKLVDPSLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAANANPKMILDAATSAVHLRYNFFETTIQIEEYTAQME SCLQCNVPEKoooooooo--- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:471 S:97 BS:471 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # PW_SEQ_DISTANCES BOT 0 1 99.10 C1 C2 99.10 TOP 1 0 99.10 C2 C1 99.10 BOT 0 2 99.33 C1 C3 99.33 TOP 2 0 99.33 C3 C1 99.33 BOT 0 3 98.41 C1 C4 98.41 TOP 3 0 98.41 C4 C1 98.41 BOT 0 4 98.67 C1 C5 98.67 TOP 4 0 98.67 C5 C1 98.67 BOT 0 5 96.18 C1 C6 96.18 TOP 5 0 96.18 C6 C1 96.18 BOT 0 6 95.76 C1 C7 95.76 TOP 6 0 95.76 C7 C1 95.76 BOT 1 2 99.78 C2 C3 99.78 TOP 2 1 99.78 C3 C2 99.78 BOT 1 3 98.65 C2 C4 98.65 TOP 3 1 98.65 C4 C2 98.65 BOT 1 4 98.65 C2 C5 98.65 TOP 4 1 98.65 C5 C2 98.65 BOT 1 5 96.18 C2 C6 96.18 TOP 5 1 96.18 C6 C2 96.18 BOT 1 6 95.52 C2 C7 95.52 TOP 6 1 95.52 C7 C2 95.52 BOT 2 3 98.88 C3 C4 98.88 TOP 3 2 98.88 C4 C3 98.88 BOT 2 4 98.88 C3 C5 98.88 TOP 4 2 98.88 C5 C3 98.88 BOT 2 5 96.40 C3 C6 96.40 TOP 5 2 96.40 C6 C3 96.40 BOT 2 6 95.52 C3 C7 95.52 TOP 6 2 95.52 C7 C3 95.52 BOT 3 4 98.41 C4 C5 98.41 TOP 4 3 98.41 C5 C4 98.41 BOT 3 5 96.14 C4 C6 96.14 TOP 5 3 96.14 C6 C4 96.14 BOT 3 6 95.68 C4 C7 95.68 TOP 6 3 95.68 C7 C4 95.68 BOT 4 5 96.18 C5 C6 96.18 TOP 5 4 96.18 C6 C5 96.18 BOT 4 6 95.54 C5 C7 95.54 TOP 6 4 95.54 C7 C5 95.54 BOT 5 6 96.40 C6 C7 96.40 TOP 6 5 96.40 C7 C6 96.40 AVG 0 C1 * 97.91 AVG 1 C2 * 97.98 AVG 2 C3 * 98.13 AVG 3 C4 * 97.69 AVG 4 C5 * 97.72 AVG 5 C6 * 96.25 AVG 6 C7 * 95.74 TOT TOT * 97.35 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC C2 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC C3 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC C4 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC C5 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGCTGGAAATGAATGATGC C6 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC C7 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC ********************************* *************** C1 CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG C2 CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG C3 CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG C4 CCGGCTATATGGGAATGCGGCA------------------ACTTCGCTGG C5 CCGGCTGTATAGGAATGCGGCA------------------ACATCGCTGG C6 CCGGCTATATAGGAAGGCGGCGTCGGCAGCGGCAGAAACGACTACGCTGG C7 CCGGCTATATCGAAAAGCGGCG------------------ACTTCGCTGG ******.*** *.** *****. **::****** C1 ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGTCAT C2 ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGCCAT C3 ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGCCAT C4 ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTTCGGGATCATTGCCAT C5 ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGTCAT C6 ATAAATGCCGCTTGGAAATGCTGCACGAATATGTACGGGATCATTGTCAT C7 ATAAATGCCGCATGGAAATGCTGCACGAATATGTCCGAGACCATTGCCAT *****:*****:********************** **.** ***** *** C1 CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCTCGCCGAAAACTGATCAT C2 CGTGCCCGCAGCGAGGGTGTGGATGTGAAGGCTCGCCGAAAACTGATCAT C3 CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCTCGCCGAAAACTGATCAT C4 CGAGCCCGCAGCGAGGGCGTCGACGTGAAGGCGCGACGAAAACTGATCAT C5 CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCGCGCCGGAAACTGATCAT C6 CGTGCCCGCAGCGAGGGGGTGGATGTAAAGGCGCGCCGGAAACTGATCAT C7 CGGGCAAGAAGCGAGGGAGTGGACGTGAAAGCCCGCCGAAAACTGATCAT ** **..*.******** ** ** **.**.** **.**.*********** C1 TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGCG C2 TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGTG C3 TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGCG C4 TGCGAGCATTTTGTGTTTGGTTTTCATGATTGCGGAAATCGTGGGTGGCG C5 TGCGAGCATTTTGTGCTTGGTTTTCATGATTGCCGAAATCGTGGGTGGCG C6 AGCCAGCGTTTTGTGTTTGGTCTTTATGATTGCAGAAATCGTGGGTGGCG C7 AGCCAGCATCCTGTGCTTGGTTTTTATGATTGCCGAAATCGTAGGTGGCG :** ***.* **** **** ** ******** ********.***** * C1 TCCTATCGAACAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACG C2 TCCTATCCAATAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC C3 TCCTATCCAACAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC C4 TCTTATCGAACAGTCTAGCCATTGCAACAGACGCCGCTCATTTGCTAACC C5 TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC C6 TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCACATTTGCTCACC C7 TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCACATTTGCTCACC ** **** ** ** **.***** **************:********.** C1 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGGCG C2 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG C3 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG C4 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCTGGACG C5 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG C6 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG C7 GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG ******************************************** **.** C1 ACCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG C2 CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGCGCTGAGGTTATTG C3 CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGCGCTGAGGTTATTG C4 CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCCGAGGTTATTG C5 ACCATCTACGCAGCGCATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG C6 ACCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG C7 CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCCGAGGTTATTG .************** ******************** ** ********** C1 GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTT C2 GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC C3 GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC C4 GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC C5 GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC C6 GCGCCATGGCCTCCGTCTTTATGATCTGGGTCATCACAGGCATACTGGTC C7 GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC ******************* *****************.*****.** ** C1 TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA C2 TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA C3 TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA C4 TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA C5 TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA C6 TGGCTGGCCATTGGACGTCTCATTAGCGGCGACTACGAGGTGAATGCGAA C7 TGGTTGGCCATCGGAAGACTCATCAGCGGCGATTACGAGGTGAATGCGAA *** ******* ***.*:***** ******** ***************** C1 GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG C2 GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG C3 GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG C4 GATCATGCTGATCACCTCCGGGCTGGCCATTTTGGTGAATGTCATCATGG C5 GATCATGCTGATCACCTCGGGCCTGGCCATTTTGGTGAATGTCATCATGG C6 GATCATGCTGATCACCTCGGGCCTGGCCATATTGGTGAATGTCATAATGG C7 GATCATGCTGATCACCTCGGGCCTGGCCATATTGGTTAATGTCATCATGG ***************.** ** ********:***** ********.**** C1 GCGTTCAGCTGCAGCATGGCCATTCGCATGGCCTGGGCGGT--------- C2 GCGTTCAGCTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- C3 GCGTTCAGCTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- C4 GCGTTCAACTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- C5 GCGTGCAACTGCAGCATGGCCATTCGCATGGCCTGGGCGGC--------- C6 GAGTCCAGCTGCAGCATGGCCATTCGCATGCCCTGGGCGGT--------- C7 GCGTTCAGCTGCAGCACGGCCATTCCCATGGACTCGGCGGAGGCGGCGGT *.** **.******** ******** **** .** ***** C1 GGGCATGGTCACAGCCATGGTGGTTCCAAGAAC----------------- C2 GGGCATGGTCACAGCCATGGCGGTTCCAAGAAGTCAAAGAAGAAGAAC-- C3 GGGCATGGTCACAGCCATGGCGGTTCCAAGAAGTCAAAGAAGAAGAAC-- C4 GGGCATGGTCACAGCCATGGCGGCTCCAAGAAACTAAAGAAGAAGAACCC C5 GGGCATGGTCACAGCCATGGTGGCACCAAGAAC----------------- C6 GCGCATGGTCACAGCCACGGTGGCTCCAAGAAC----------------- C7 GGGCATGGTCACAGCCACGGTGGCAACAAGAAC----------------- * *************** ** ** :.****** C1 ----------------GCATCCCATGTGCAGGCCACATCCACACCATGCT C2 ----------------CCATCCCATGTGCAGGCCACATCCACACCATGCT C3 ----------------CCATCCCATGTGCAGGCCACATCCACACCATGCT C4 CGCAGCAACTGCCATACCGTCCCATGTGCAGGCCACATCCACACCCTGTT C5 ----------------CCATCCCATGTGCAGGCCACATCCACGCCCTGCT C6 ----------------CCATCCCATGCCCATGCCACATCCACACCATGTT C7 ----------------CCATCCCATGCCCATGCCACATCCACTCCCTGTT *.******* ** *********** **.** * C1 CCGATTCGCCCAGCCAGCGTATTGAGGGCGGTGTGGCCTACGCGCCCGAG C2 CCGATTCGCCCAGCCAGCGGATTGAGGGCGGTGTGGCCTACGCGCCCGAG C3 CCGATTCGCCCAGCCAGCGGATTGAGGGCGGTGTGGCCTACGCGCCCGAG C4 CCGATTCACCCAGCCAACGCATTGAGGGCGGTGTGGCCTTCGCGCCGGAG C5 CCGATTCACCCAGCCAACGGATTGAGGGCGGCGTGGCCTTCGCGCCGGAG C6 CCGCTTCGCCCAACCAAAGGATTGAGGGCGGTGTGGCCTTTGCGCCCGAG C7 CCGCATCGCCCAATCAACGGATCGAAGGGGGCGTGGCCTTTGCACCCGAG ***.:**.****. **..* ** **.** ** *******: **.** *** C1 GATGCCGAATTGCCTGGCGGCGGGCTGCCAACGTTCTCCTACCAAAATAC C2 GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCGTACCAAAATAC C3 GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCGTACCAAAATAC C4 GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCCTACCAAAACAC C5 GATGCCGAATTGCCTGGCGGCGGGCTGCCAACGTTCTCCTACCAAAATAC C6 GATGCCGAATTGCCTGGCGGCGGATTGCCCACGTTTTCCTACCAAAATGC C7 GATGCGGAGTTGCCTGGCAGCGGACTGCCAACGTACTCATACCAGAACGC ***** **.*********.****. **** ****: ** *****.** .* C1 CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCTGCCGTTCTGGCCG C2 CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG C3 CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG C4 CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG C5 CAAGCTGGTCGATCCCACACTGGACCTGGAAATTGCAGCCGTGCTGGCCG C6 AAAGTTAGTGGATCCCGCAAAGGATTTAGAAATTGCAGCAGTTCTGGCCG C7 CAAGCTGGTGGATCCATCGCTGGACCTCGAAATTGCGGCCGTTTTGGCGG .*** *.** *****. *..:*** * ******** **.** **** * C1 AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC C2 AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC C3 AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC C4 AAACGGCACCCGGAGCACATCACCACGGCGGACCGGTTGGACGCGAGGCC C5 AAACGGCACCCGGCTCACATCACCACGGCGGACCGGCTGGACGCGAGGCC C6 AGACAGCACCAGGATCACATCATCACGGCGGACCAGTTGGACGGGAGGCC C7 AAACCGCTCCCGGTGCTCATCATCACGGCGGACCCGTTGGTCGCGAAGCC *.** **:**.** *:***** *********** * ***:** **.*** C1 GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT C2 GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT C3 GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT C4 GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGACGTCAT C5 GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT C6 GTCAACATGAATGTCCGAGCTGCCCTCATCCATGTGATTGGCGATGTCAT C7 GTAAACATGAATGTCCGGGCAGCTCTTATTCACGTGATTGGCGACGTCAT **.**************.**:** ** ** ** *********** ***** C1 CCAGAGCGTGGGAGTTTTTGTCGCCGCTGGCGTGATTTACTTTTGGCCAG C2 CCAGAGCGTGGGTGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCAG C3 CCAGAGCGTGGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCAG C4 CCAGAGCGTTGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTCTGGCCCG C5 CCAGAGCGTGGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCGG C6 TCAGAGCGTTGGAGTGTTTGTGGCCGCCGGGGTCATCTACTTTTGGCCAG C7 CCAGAGCCTTGGTGTTTTCGTCGCCGCCGGCGTGATCTACTTTTGGCCAG ****** * **:** ** ** ***** ** ** ** ***** ***** * C1 AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG C2 AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG C3 AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG C4 AGTACTCCATCGTTGATCCCATTTGCACTTTTGTGTTCTCCATCATTGTG C5 AGTACTCCATCGTTGATCCCATTTGCACTTTTGTGTTCTCCATCATTGTG C6 AGTATTCCATCGTTGATCCGATTTGCACATTTGTTTTCTCCATTATTGTC C7 AGTACTCCATCGTTGACCCCATTTGCACGTTTGTGTTCTCCATTATTGTC **** *********** ** ******** ***** ******** ***** C1 CTCTTCACCACGTTCACGATCATGAAGGATGCGTTGCTGGTGCTCATGGA C2 CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA C3 CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA C4 CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA C5 CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA C6 CTCTTTACCACGTTCACGATTATGAAGGATGCCCTGCTGGTACTCATGGA C7 CTCTTTACCACGTTTACGATCATGAAGGATGCCCTGCTGGTTCTCATGGA ***** ******** ***** *********** ******* ******** C1 GGGGACTCCCAACTATATGCACTACGCCGAGGTACTGCAGATTTTCCAAG C2 GGGGACTCCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG C3 GGGGACTCCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG C4 GGGGACACCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG C5 GGGGACTCCCAACTACATGCACTACGCCGAGGTGCTGCAGATATTCCAAG C6 GGGGACTCCCAACTACATGCACTACGCCGAGGTGCTGCAGATATTCCAAG C7 GGGGACCCCCAATTACATGCACTACGCGGAGGTGCTGCAGATTTTCCAAG ****** ***** ** ******** ** *****.********:******* C1 GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC C2 GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC C3 GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC C4 GCATCGAGGGAGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC C5 GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC C6 GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC C7 GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC **********.*************************************** C1 ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCGAA C2 ATTAATAAAGTAGCGCTATCTGCACATTTGGCCATTGCTGATAATGCGAA C3 ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCGAA C4 ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCCAA C5 ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAACGCGAA C6 ATTAATAAAGTGGCGCTATCTGCGCATTTGGCCATTGCTGAAAATGCGAA C7 ATTAATAAAGTGGCGCTATCTGCGCATTTGGCCATTGCTGCCAATGCGAA ***********.***********.****************. ** ** ** C1 TCCGAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTATA C2 TCCTAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTACA C3 TCCTAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTACA C4 TCCGAAGAAGATCCTGGACGCTGCTACATCGGCGGTACACTTGCGCTACA C5 TCCGAAGCGGATCCTGGATGCAGCCACATCGGCGGTACACTTGCGATACA C6 TCCCAAGCAAATCTTGGATGCAGCCACATCGGCGGTTCACTTGCGCTACA C7 TCCAAAGATGATCCTGGATGCAGCCACCTCGGCGGTTCATCTGCGCTACA *** ***. .*** **** ** ** **.********:** ****.** * C1 ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG C2 ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG C3 ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG C4 ACTTCTTTGAGACCACCATCCAGATCGAAGACTATACCGCCCAAATGGAG C5 ACTTCTTCGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG C6 ACTTTTTTGAGACCACCATCCAGATCGAGGACTATACGGCCCAGATGGAG C7 ATTTCTTCGAGACGACCATTCAGATCGAGGAGTACACGGCCCAAATGGAG * ** ** ***** ***** ********.** ** ** *****.****** C1 AGCTGCCTGCAGTGCAATGTGCCCGAGAAG-------------------- C2 AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- C3 AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- C4 AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- C5 AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- C6 AGTTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- C7 AGCTGCCTGCAGTGCAATGTGCCCGAAAAG-------------------- ** ****:******************.*** C1 ------------- C2 ------------- C3 ------------- C4 ------------- C5 ------------- C6 ------------- C7 ------------- >C1 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGTCAT CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCTCGCCGAAAACTGATCAT TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGCG TCCTATCGAACAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACG GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGGCG ACCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTT TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG GCGTTCAGCTGCAGCATGGCCATTCGCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGTGGTTCCAAGAAC----------------- ----------------GCATCCCATGTGCAGGCCACATCCACACCATGCT CCGATTCGCCCAGCCAGCGTATTGAGGGCGGTGTGGCCTACGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCAACGTTCTCCTACCAAAATAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCTGCCGTTCTGGCCG AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGAGTTTTTGTCGCCGCTGGCGTGATTTACTTTTGGCCAG AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCGTTGCTGGTGCTCATGGA GGGGACTCCCAACTATATGCACTACGCCGAGGTACTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCGAA TCCGAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTATA ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCTGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >C2 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGCCAT CGTGCCCGCAGCGAGGGTGTGGATGTGAAGGCTCGCCGAAAACTGATCAT TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGTG TCCTATCCAATAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGCGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG GCGTTCAGCTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGCGGTTCCAAGAAGTCAAAGAAGAAGAAC-- ----------------CCATCCCATGTGCAGGCCACATCCACACCATGCT CCGATTCGCCCAGCCAGCGGATTGAGGGCGGTGTGGCCTACGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCGTACCAAAATAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGTGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCAG AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACTCCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTAGCGCTATCTGCACATTTGGCCATTGCTGATAATGCGAA TCCTAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTACA ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >C3 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGCCAT CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCTCGCCGAAAACTGATCAT TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGCG TCCTATCCAACAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGCGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG GCGTTCAGCTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGCGGTTCCAAGAAGTCAAAGAAGAAGAAC-- ----------------CCATCCCATGTGCAGGCCACATCCACACCATGCT CCGATTCGCCCAGCCAGCGGATTGAGGGCGGTGTGGCCTACGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCGTACCAAAATAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCAG AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACTCCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCGAA TCCTAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTACA ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >C4 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATGGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTTCGGGATCATTGCCAT CGAGCCCGCAGCGAGGGCGTCGACGTGAAGGCGCGACGAAAACTGATCAT TGCGAGCATTTTGTGTTTGGTTTTCATGATTGCGGAAATCGTGGGTGGCG TCTTATCGAACAGTCTAGCCATTGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCTGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCCGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACCTCCGGGCTGGCCATTTTGGTGAATGTCATCATGG GCGTTCAACTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGCGGCTCCAAGAAACTAAAGAAGAAGAACCC CGCAGCAACTGCCATACCGTCCCATGTGCAGGCCACATCCACACCCTGTT CCGATTCACCCAGCCAACGCATTGAGGGCGGTGTGGCCTTCGCGCCGGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCCTACCAAAACAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG AAACGGCACCCGGAGCACATCACCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGACGTCAT CCAGAGCGTTGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTCTGGCCCG AGTACTCCATCGTTGATCCCATTTGCACTTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACACCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGAGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCCAA TCCGAAGAAGATCCTGGACGCTGCTACATCGGCGGTACACTTGCGCTACA ACTTCTTTGAGACCACCATCCAGATCGAAGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >C5 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGCTGGAAATGAATGATGC CCGGCTGTATAGGAATGCGGCA------------------ACATCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGTCAT CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCGCGCCGGAAACTGATCAT TGCGAGCATTTTGTGCTTGGTTTTCATGATTGCCGAAATCGTGGGTGGCG TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG ACCATCTACGCAGCGCATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACCTCGGGCCTGGCCATTTTGGTGAATGTCATCATGG GCGTGCAACTGCAGCATGGCCATTCGCATGGCCTGGGCGGC--------- GGGCATGGTCACAGCCATGGTGGCACCAAGAAC----------------- ----------------CCATCCCATGTGCAGGCCACATCCACGCCCTGCT CCGATTCACCCAGCCAACGGATTGAGGGCGGCGTGGCCTTCGCGCCGGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCAACGTTCTCCTACCAAAATAC CAAGCTGGTCGATCCCACACTGGACCTGGAAATTGCAGCCGTGCTGGCCG AAACGGCACCCGGCTCACATCACCACGGCGGACCGGCTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCGG AGTACTCCATCGTTGATCCCATTTGCACTTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACTCCCAACTACATGCACTACGCCGAGGTGCTGCAGATATTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAACGCGAA TCCGAAGCGGATCCTGGATGCAGCCACATCGGCGGTACACTTGCGATACA ACTTCTTCGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >C6 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAAGGCGGCGTCGGCAGCGGCAGAAACGACTACGCTGG ATAAATGCCGCTTGGAAATGCTGCACGAATATGTACGGGATCATTGTCAT CGTGCCCGCAGCGAGGGGGTGGATGTAAAGGCGCGCCGGAAACTGATCAT AGCCAGCGTTTTGTGTTTGGTCTTTATGATTGCAGAAATCGTGGGTGGCG TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCACATTTGCTCACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG ACCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTTATGATCTGGGTCATCACAGGCATACTGGTC TGGCTGGCCATTGGACGTCTCATTAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACCTCGGGCCTGGCCATATTGGTGAATGTCATAATGG GAGTCCAGCTGCAGCATGGCCATTCGCATGCCCTGGGCGGT--------- GCGCATGGTCACAGCCACGGTGGCTCCAAGAAC----------------- ----------------CCATCCCATGCCCATGCCACATCCACACCATGTT CCGCTTCGCCCAACCAAAGGATTGAGGGCGGTGTGGCCTTTGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGATTGCCCACGTTTTCCTACCAAAATGC AAAGTTAGTGGATCCCGCAAAGGATTTAGAAATTGCAGCAGTTCTGGCCG AGACAGCACCAGGATCACATCATCACGGCGGACCAGTTGGACGGGAGGCC GTCAACATGAATGTCCGAGCTGCCCTCATCCATGTGATTGGCGATGTCAT TCAGAGCGTTGGAGTGTTTGTGGCCGCCGGGGTCATCTACTTTTGGCCAG AGTATTCCATCGTTGATCCGATTTGCACATTTGTTTTCTCCATTATTGTC CTCTTTACCACGTTCACGATTATGAAGGATGCCCTGCTGGTACTCATGGA GGGGACTCCCAACTACATGCACTACGCCGAGGTGCTGCAGATATTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCGCATTTGGCCATTGCTGAAAATGCGAA TCCCAAGCAAATCTTGGATGCAGCCACATCGGCGGTTCACTTGCGCTACA ACTTTTTTGAGACCACCATCCAGATCGAGGACTATACGGCCCAGATGGAG AGTTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >C7 ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATCGAAAAGCGGCG------------------ACTTCGCTGG ATAAATGCCGCATGGAAATGCTGCACGAATATGTCCGAGACCATTGCCAT CGGGCAAGAAGCGAGGGAGTGGACGTGAAAGCCCGCCGAAAACTGATCAT AGCCAGCATCCTGTGCTTGGTTTTTATGATTGCCGAAATCGTAGGTGGCG TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCACATTTGCTCACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCCGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGTTGGCCATCGGAAGACTCATCAGCGGCGATTACGAGGTGAATGCGAA GATCATGCTGATCACCTCGGGCCTGGCCATATTGGTTAATGTCATCATGG GCGTTCAGCTGCAGCACGGCCATTCCCATGGACTCGGCGGAGGCGGCGGT GGGCATGGTCACAGCCACGGTGGCAACAAGAAC----------------- ----------------CCATCCCATGCCCATGCCACATCCACTCCCTGTT CCGCATCGCCCAATCAACGGATCGAAGGGGGCGTGGCCTTTGCACCCGAG GATGCGGAGTTGCCTGGCAGCGGACTGCCAACGTACTCATACCAGAACGC CAAGCTGGTGGATCCATCGCTGGACCTCGAAATTGCGGCCGTTTTGGCGG AAACCGCTCCCGGTGCTCATCATCACGGCGGACCCGTTGGTCGCGAAGCC GTAAACATGAATGTCCGGGCAGCTCTTATTCACGTGATTGGCGACGTCAT CCAGAGCCTTGGTGTTTTCGTCGCCGCCGGCGTGATCTACTTTTGGCCAG AGTACTCCATCGTTGACCCCATTTGCACGTTTGTGTTCTCCATTATTGTC CTCTTTACCACGTTTACGATCATGAAGGATGCCCTGCTGGTTCTCATGGA GGGGACCCCCAATTACATGCACTACGCGGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCGCATTTGGCCATTGCTGCCAATGCGAA TCCAAAGATGATCCTGGATGCAGCCACCTCGGCGGTTCATCTGCGCTACA ATTTCTTCGAGACGACCATTCAGATCGAGGAGTACACGGCCCAAATGGAG AGCTGCCTGCAGTGCAATGTGCCCGAAAAG-------------------- ------------- >C1 MLANWQTARKSSEMNDARLYRNAAooooooTSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGooo GHGHSHGGSKNoooooooooooASHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCLQCNVPEK >C2 MLANWQTARKSSEMNDARLYRNAAooooooTSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGooo GHGHSHGGSKKSKKKNooooooPSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIADNANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >C3 MLANWQTARKSSEMNDARLYRNAAooooooTSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGooo GHGHSHGGSKKSKKKNooooooPSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >C4 MLANWQTARKSSEMNDARLYGNAAooooooTSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGooo GHGHSHGGSKKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >C5 MLANWQTARKSLEMNDARLYRNAAooooooTSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGooo GHGHSHGGTKNoooooooooooPSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPAGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >C6 MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGGooo AHGHSHGGSKNoooooooooooPSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGGGLPTFSYQNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKQILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >C7 MLANWQTARKSSEMNDARLYRKAAooooooTSLDKCRMEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGG GHGHSHGGNKNoooooooooooPSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGSGLPTYSYQNAKLVDPSLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAANANPKMILDAATSAVHLRYNFFETTIQIEEYTAQME SCLQCNVPEK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 7 taxa and 1413 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481281514 Setting output file names to "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 414727262 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0968003640 Seed = 272628740 Swapseed = 1481281514 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 37 unique site patterns Division 2 has 25 unique site patterns Division 3 has 113 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4441.474829 -- -24.557203 Chain 2 -- -4380.808593 -- -24.557203 Chain 3 -- -4419.824821 -- -24.557203 Chain 4 -- -4317.870776 -- -24.557203 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4432.660731 -- -24.557203 Chain 2 -- -4431.024538 -- -24.557203 Chain 3 -- -4379.444968 -- -24.557203 Chain 4 -- -4460.184945 -- -24.557203 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4441.475] (-4380.809) (-4419.825) (-4317.871) * [-4432.661] (-4431.025) (-4379.445) (-4460.185) 500 -- (-3511.219) [-3482.954] (-3500.375) (-3514.310) * (-3490.734) [-3485.509] (-3505.453) (-3504.538) -- 0:00:00 1000 -- (-3480.191) [-3467.603] (-3482.188) (-3479.911) * [-3421.128] (-3456.209) (-3488.771) (-3450.867) -- 0:00:00 1500 -- (-3467.892) (-3456.914) [-3440.194] (-3450.768) * [-3397.244] (-3434.919) (-3473.068) (-3400.648) -- 0:11:05 2000 -- (-3428.604) (-3401.941) [-3404.849] (-3426.515) * [-3391.485] (-3401.411) (-3454.421) (-3391.660) -- 0:08:19 2500 -- (-3397.712) (-3398.020) [-3392.400] (-3419.924) * (-3385.494) [-3386.945] (-3451.118) (-3390.992) -- 0:06:39 3000 -- [-3393.384] (-3389.620) (-3389.545) (-3402.069) * (-3389.316) [-3385.461] (-3430.174) (-3387.418) -- 0:05:32 3500 -- (-3395.278) [-3394.520] (-3384.212) (-3386.083) * [-3386.466] (-3392.482) (-3402.775) (-3387.113) -- 0:04:44 4000 -- (-3390.554) (-3405.040) [-3387.487] (-3401.139) * [-3394.015] (-3391.900) (-3397.443) (-3386.469) -- 0:08:18 4500 -- (-3381.642) (-3402.092) [-3388.999] (-3384.684) * (-3385.554) (-3383.314) (-3389.836) [-3388.448] -- 0:07:22 5000 -- [-3391.861] (-3383.318) (-3385.258) (-3390.012) * (-3390.394) (-3399.162) [-3385.999] (-3387.455) -- 0:06:38 Average standard deviation of split frequencies: 0.000000 5500 -- [-3382.803] (-3388.278) (-3394.128) (-3394.782) * (-3384.039) [-3388.449] (-3396.044) (-3384.381) -- 0:06:01 6000 -- [-3389.446] (-3394.858) (-3389.516) (-3384.240) * (-3388.799) (-3385.954) (-3404.882) [-3388.852] -- 0:05:31 6500 -- [-3385.871] (-3387.924) (-3383.293) (-3397.266) * (-3384.793) (-3386.680) (-3402.781) [-3387.504] -- 0:07:38 7000 -- (-3383.920) (-3390.203) [-3391.616] (-3389.100) * (-3389.201) [-3386.310] (-3397.782) (-3387.977) -- 0:07:05 7500 -- (-3383.218) (-3390.000) [-3381.346] (-3393.082) * [-3389.546] (-3397.664) (-3388.948) (-3387.037) -- 0:06:37 8000 -- [-3386.630] (-3383.879) (-3389.346) (-3389.535) * (-3393.080) (-3398.425) [-3389.703] (-3387.937) -- 0:06:12 8500 -- [-3383.047] (-3386.820) (-3388.757) (-3401.106) * (-3384.761) (-3393.856) (-3397.118) [-3394.991] -- 0:05:49 9000 -- [-3382.099] (-3386.630) (-3399.411) (-3401.861) * (-3399.253) (-3390.957) (-3387.424) [-3382.827] -- 0:07:20 9500 -- (-3384.367) (-3388.019) [-3381.762] (-3392.950) * (-3388.427) [-3386.640] (-3388.748) (-3388.170) -- 0:06:57 10000 -- (-3384.260) (-3384.842) [-3385.751] (-3385.626) * (-3390.386) (-3388.019) [-3388.701] (-3384.559) -- 0:06:36 Average standard deviation of split frequencies: 0.000000 10500 -- (-3388.453) [-3390.297] (-3389.022) (-3391.452) * (-3394.791) (-3391.994) [-3388.370] (-3388.175) -- 0:06:16 11000 -- (-3386.329) (-3398.676) [-3389.163] (-3390.125) * [-3382.488] (-3384.847) (-3384.302) (-3389.003) -- 0:05:59 11500 -- (-3386.960) (-3386.512) [-3383.819] (-3393.628) * (-3385.394) (-3396.228) (-3389.498) [-3384.975] -- 0:07:09 12000 -- [-3383.361] (-3386.783) (-3389.960) (-3383.709) * (-3380.882) (-3394.733) (-3384.369) [-3381.482] -- 0:06:51 12500 -- (-3386.048) (-3394.806) (-3385.922) [-3392.230] * (-3386.552) (-3388.084) [-3384.681] (-3385.491) -- 0:06:35 13000 -- (-3389.654) (-3394.396) (-3396.842) [-3390.673] * (-3390.073) [-3383.475] (-3393.968) (-3385.959) -- 0:06:19 13500 -- [-3399.551] (-3385.657) (-3386.699) (-3387.312) * (-3393.805) (-3392.581) (-3393.304) [-3385.166] -- 0:06:05 14000 -- (-3383.447) [-3385.416] (-3390.424) (-3388.092) * (-3386.066) [-3389.018] (-3386.731) (-3386.307) -- 0:07:02 14500 -- (-3393.577) (-3381.263) (-3386.767) [-3381.553] * [-3391.633] (-3388.864) (-3385.630) (-3392.793) -- 0:06:47 15000 -- (-3396.137) (-3383.361) [-3381.757] (-3394.097) * (-3387.481) (-3393.938) (-3386.990) [-3386.092] -- 0:06:34 Average standard deviation of split frequencies: 0.000000 15500 -- (-3384.807) (-3392.046) (-3385.464) [-3388.152] * [-3386.169] (-3390.676) (-3383.256) (-3394.398) -- 0:06:21 16000 -- (-3391.227) (-3380.661) [-3386.729] (-3390.718) * [-3388.484] (-3387.163) (-3386.052) (-3386.537) -- 0:06:09 16500 -- (-3384.515) (-3383.036) (-3382.387) [-3381.402] * (-3385.882) (-3382.874) (-3385.629) [-3383.505] -- 0:05:57 17000 -- [-3382.351] (-3382.508) (-3389.575) (-3396.582) * (-3384.546) (-3390.365) [-3385.532] (-3387.695) -- 0:06:44 17500 -- (-3389.710) (-3386.639) (-3385.458) [-3384.741] * (-3388.097) (-3389.999) (-3390.625) [-3387.701] -- 0:06:33 18000 -- (-3393.226) (-3383.960) [-3385.610] (-3380.881) * [-3381.356] (-3387.654) (-3388.481) (-3387.410) -- 0:06:21 18500 -- (-3380.603) (-3391.955) [-3392.705] (-3388.424) * (-3386.898) (-3387.705) [-3382.920] (-3386.067) -- 0:06:11 19000 -- (-3382.345) (-3382.704) (-3393.121) [-3390.192] * [-3384.731] (-3388.338) (-3386.255) (-3392.706) -- 0:06:01 19500 -- [-3382.069] (-3386.724) (-3386.825) (-3390.224) * (-3389.342) [-3394.014] (-3392.629) (-3387.876) -- 0:06:42 20000 -- [-3384.820] (-3382.408) (-3395.489) (-3389.576) * (-3383.204) [-3380.939] (-3396.638) (-3390.501) -- 0:06:32 Average standard deviation of split frequencies: 0.000000 20500 -- (-3385.650) [-3395.133] (-3404.243) (-3386.346) * (-3384.463) [-3389.814] (-3385.805) (-3393.399) -- 0:06:22 21000 -- (-3389.433) (-3394.675) (-3391.441) [-3390.261] * (-3399.413) (-3389.728) [-3384.994] (-3386.225) -- 0:06:12 21500 -- [-3384.008] (-3387.125) (-3384.594) (-3386.059) * [-3384.850] (-3388.180) (-3389.732) (-3387.016) -- 0:06:04 22000 -- (-3385.487) (-3389.117) [-3385.477] (-3385.132) * (-3396.455) [-3395.081] (-3386.064) (-3384.901) -- 0:06:40 22500 -- (-3390.766) (-3388.315) (-3385.892) [-3382.370] * (-3394.552) (-3387.002) (-3378.390) [-3388.383] -- 0:06:31 23000 -- (-3387.848) [-3380.743] (-3386.969) (-3385.983) * (-3390.110) (-3397.172) [-3385.422] (-3388.545) -- 0:06:22 23500 -- (-3388.813) (-3388.647) [-3384.676] (-3387.011) * (-3393.924) [-3386.159] (-3394.367) (-3391.308) -- 0:06:13 24000 -- [-3390.229] (-3388.162) (-3387.456) (-3390.201) * (-3391.494) (-3386.724) (-3391.566) [-3386.499] -- 0:06:06 24500 -- [-3386.016] (-3392.392) (-3382.193) (-3387.058) * (-3384.862) [-3384.736] (-3396.986) (-3390.877) -- 0:05:58 25000 -- (-3390.244) (-3385.986) [-3385.189] (-3388.111) * (-3383.024) (-3388.170) (-3391.989) [-3385.580] -- 0:06:30 Average standard deviation of split frequencies: 0.000000 25500 -- (-3393.357) (-3381.173) (-3396.640) [-3393.691] * [-3385.333] (-3385.261) (-3394.058) (-3397.681) -- 0:06:22 26000 -- (-3381.943) (-3396.344) [-3386.083] (-3387.432) * [-3387.195] (-3387.064) (-3389.873) (-3401.099) -- 0:06:14 26500 -- (-3388.021) (-3392.603) [-3387.754] (-3393.174) * (-3382.846) (-3388.267) (-3389.263) [-3390.374] -- 0:06:07 27000 -- (-3387.553) (-3388.441) (-3380.621) [-3394.099] * (-3386.025) (-3394.747) [-3389.480] (-3388.571) -- 0:06:00 27500 -- (-3389.623) (-3381.448) [-3385.287] (-3392.053) * [-3382.328] (-3384.291) (-3380.427) (-3387.277) -- 0:06:29 28000 -- (-3386.803) (-3380.573) [-3384.605] (-3389.589) * (-3390.389) (-3389.591) (-3390.116) [-3389.859] -- 0:06:21 28500 -- (-3385.629) [-3385.993] (-3392.845) (-3387.106) * (-3391.724) [-3380.218] (-3388.059) (-3387.860) -- 0:06:14 29000 -- [-3384.430] (-3388.732) (-3389.023) (-3393.460) * (-3391.087) [-3388.617] (-3388.105) (-3389.801) -- 0:06:08 29500 -- (-3385.481) (-3385.569) (-3387.595) [-3383.994] * [-3387.558] (-3387.022) (-3389.290) (-3385.922) -- 0:06:01 30000 -- (-3390.885) [-3379.462] (-3393.273) (-3390.504) * [-3395.020] (-3383.310) (-3388.439) (-3381.570) -- 0:06:28 Average standard deviation of split frequencies: 0.000000 30500 -- [-3387.970] (-3392.687) (-3386.656) (-3393.268) * (-3397.126) (-3389.502) [-3384.885] (-3393.920) -- 0:06:21 31000 -- (-3393.401) [-3387.678] (-3397.426) (-3385.964) * (-3382.133) (-3385.844) (-3395.088) [-3389.735] -- 0:06:15 31500 -- (-3393.428) [-3384.485] (-3386.867) (-3384.728) * (-3400.840) (-3389.335) [-3384.136] (-3396.337) -- 0:06:08 32000 -- (-3387.313) [-3390.531] (-3380.146) (-3383.814) * [-3398.779] (-3384.139) (-3383.891) (-3395.630) -- 0:06:03 32500 -- (-3391.259) (-3392.279) (-3394.396) [-3382.419] * (-3387.627) (-3387.865) (-3389.060) [-3386.373] -- 0:05:57 33000 -- (-3387.523) (-3386.902) [-3389.749] (-3393.464) * (-3403.160) (-3386.923) (-3387.860) [-3386.936] -- 0:06:20 33500 -- (-3398.837) (-3384.851) [-3386.672] (-3388.528) * (-3389.939) (-3391.674) (-3386.762) [-3382.066] -- 0:06:15 34000 -- (-3393.952) (-3385.552) (-3393.981) [-3387.418] * [-3397.516] (-3382.621) (-3390.370) (-3394.566) -- 0:06:09 34500 -- (-3390.707) (-3393.912) (-3394.752) [-3390.308] * (-3398.060) (-3381.430) (-3386.551) [-3384.671] -- 0:06:03 35000 -- [-3387.897] (-3397.479) (-3386.441) (-3392.260) * (-3390.671) (-3390.841) (-3383.968) [-3385.989] -- 0:05:58 Average standard deviation of split frequencies: 0.000000 35500 -- (-3388.847) (-3385.517) (-3390.446) [-3384.291] * (-3386.401) [-3390.581] (-3384.289) (-3395.891) -- 0:06:20 36000 -- (-3390.823) (-3391.712) (-3396.129) [-3387.142] * (-3386.296) (-3384.672) [-3385.482] (-3394.555) -- 0:06:14 36500 -- [-3388.002] (-3394.295) (-3385.098) (-3400.862) * (-3382.667) [-3382.813] (-3391.673) (-3391.285) -- 0:06:09 37000 -- [-3382.380] (-3395.920) (-3391.723) (-3387.810) * (-3384.446) (-3390.294) (-3387.020) [-3389.346] -- 0:06:04 37500 -- (-3387.221) (-3390.831) [-3383.166] (-3392.552) * [-3392.389] (-3398.303) (-3382.406) (-3393.606) -- 0:05:59 38000 -- (-3384.825) (-3385.043) [-3383.801] (-3398.610) * (-3389.557) (-3391.785) (-3391.607) [-3381.246] -- 0:05:54 38500 -- [-3390.682] (-3389.877) (-3386.542) (-3407.115) * (-3392.461) (-3388.979) (-3389.092) [-3386.859] -- 0:06:14 39000 -- (-3387.463) [-3390.007] (-3387.804) (-3395.100) * (-3390.277) [-3383.949] (-3387.077) (-3390.636) -- 0:06:09 39500 -- [-3380.682] (-3392.705) (-3388.049) (-3399.183) * (-3385.778) [-3387.855] (-3390.116) (-3380.031) -- 0:06:04 40000 -- (-3383.819) (-3382.388) [-3384.032] (-3386.048) * (-3392.023) (-3388.037) (-3384.147) [-3390.871] -- 0:06:00 Average standard deviation of split frequencies: 0.000000 40500 -- (-3387.618) [-3385.653] (-3390.130) (-3386.174) * (-3399.278) (-3391.553) (-3388.219) [-3389.155] -- 0:05:55 41000 -- (-3389.895) [-3384.360] (-3384.307) (-3383.552) * [-3384.140] (-3391.257) (-3389.136) (-3393.578) -- 0:06:14 41500 -- (-3393.326) (-3392.466) (-3380.229) [-3390.679] * (-3394.110) (-3395.402) (-3390.802) [-3389.458] -- 0:06:09 42000 -- (-3395.020) (-3393.331) (-3391.742) [-3389.518] * (-3384.844) [-3386.149] (-3384.645) (-3396.205) -- 0:06:04 42500 -- (-3388.450) (-3391.170) [-3393.168] (-3384.980) * (-3387.136) [-3388.488] (-3394.631) (-3394.361) -- 0:06:00 43000 -- [-3393.548] (-3384.640) (-3381.799) (-3387.440) * (-3385.055) (-3384.008) [-3383.183] (-3387.974) -- 0:05:56 43500 -- (-3385.217) (-3388.986) [-3386.075] (-3402.735) * (-3388.973) (-3386.250) [-3388.187] (-3388.437) -- 0:05:51 44000 -- (-3390.236) (-3386.486) (-3388.352) [-3386.904] * (-3386.177) [-3386.662] (-3386.229) (-3391.385) -- 0:06:09 44500 -- (-3393.886) (-3390.801) [-3386.827] (-3391.597) * (-3384.119) [-3380.790] (-3391.836) (-3385.468) -- 0:06:05 45000 -- (-3399.109) (-3382.689) [-3392.831] (-3382.087) * [-3390.551] (-3389.337) (-3385.498) (-3392.632) -- 0:06:00 Average standard deviation of split frequencies: 0.000000 45500 -- [-3383.590] (-3389.078) (-3391.827) (-3382.677) * (-3387.037) (-3397.998) [-3389.780] (-3386.951) -- 0:05:56 46000 -- (-3390.026) (-3392.366) [-3391.238] (-3389.157) * (-3388.538) (-3388.819) [-3387.334] (-3383.099) -- 0:05:52 46500 -- (-3387.099) (-3387.909) [-3390.601] (-3385.237) * (-3389.423) (-3386.818) [-3389.004] (-3396.556) -- 0:06:09 47000 -- (-3386.987) (-3402.170) [-3383.852] (-3380.206) * (-3396.943) (-3395.511) (-3387.650) [-3391.643] -- 0:06:04 47500 -- (-3377.852) (-3386.112) (-3386.217) [-3386.387] * [-3382.629] (-3392.441) (-3385.953) (-3393.478) -- 0:06:00 48000 -- (-3382.011) (-3388.835) [-3386.203] (-3385.767) * (-3389.970) (-3392.266) [-3385.718] (-3389.964) -- 0:05:57 48500 -- (-3384.439) (-3384.197) [-3388.529] (-3387.997) * (-3392.658) (-3392.043) [-3387.960] (-3383.863) -- 0:05:53 49000 -- [-3384.747] (-3390.880) (-3386.125) (-3385.579) * (-3395.200) [-3388.150] (-3396.844) (-3385.250) -- 0:05:49 49500 -- [-3384.409] (-3384.860) (-3383.648) (-3384.651) * (-3397.557) [-3383.353] (-3386.878) (-3387.292) -- 0:06:04 50000 -- [-3383.835] (-3389.742) (-3398.055) (-3387.105) * (-3390.317) (-3386.393) [-3389.314] (-3391.131) -- 0:06:01 Average standard deviation of split frequencies: 0.000000 50500 -- (-3393.593) [-3386.675] (-3396.193) (-3383.970) * (-3391.368) (-3385.791) [-3385.489] (-3391.641) -- 0:05:57 51000 -- (-3390.019) (-3380.021) (-3388.236) [-3383.193] * (-3396.185) [-3394.175] (-3393.456) (-3391.129) -- 0:05:53 51500 -- (-3394.884) (-3383.711) (-3392.414) [-3384.744] * [-3388.632] (-3393.259) (-3391.802) (-3395.234) -- 0:05:49 52000 -- (-3387.670) (-3386.150) (-3384.162) [-3390.763] * (-3383.230) (-3385.111) [-3388.436] (-3391.408) -- 0:06:04 52500 -- (-3395.269) (-3410.448) (-3385.008) [-3384.780] * [-3387.001] (-3381.820) (-3387.533) (-3384.969) -- 0:06:00 53000 -- [-3383.639] (-3393.045) (-3393.701) (-3387.875) * [-3386.421] (-3390.386) (-3392.067) (-3383.329) -- 0:05:57 53500 -- [-3389.174] (-3390.658) (-3386.014) (-3397.073) * (-3389.573) (-3390.412) (-3389.682) [-3388.684] -- 0:05:53 54000 -- [-3382.742] (-3393.404) (-3382.987) (-3387.640) * (-3384.707) (-3391.523) (-3386.465) [-3388.275] -- 0:05:50 54500 -- (-3390.424) (-3388.450) (-3382.452) [-3382.896] * (-3388.807) [-3382.549] (-3386.731) (-3389.430) -- 0:05:46 55000 -- (-3392.780) (-3391.518) [-3384.196] (-3384.475) * (-3383.428) [-3386.532] (-3384.997) (-3392.969) -- 0:06:00 Average standard deviation of split frequencies: 0.000000 55500 -- (-3386.014) [-3390.091] (-3387.353) (-3388.583) * (-3392.071) (-3385.796) [-3387.266] (-3386.601) -- 0:05:57 56000 -- (-3386.518) (-3381.476) [-3380.169] (-3391.333) * (-3392.224) [-3384.973] (-3381.962) (-3384.296) -- 0:05:54 56500 -- (-3387.468) (-3384.139) [-3382.994] (-3390.428) * [-3386.519] (-3388.304) (-3390.281) (-3396.582) -- 0:05:50 57000 -- (-3393.160) (-3384.721) [-3385.382] (-3385.812) * (-3389.016) [-3384.344] (-3392.845) (-3388.118) -- 0:05:47 57500 -- (-3402.860) (-3386.926) [-3386.134] (-3388.346) * (-3387.397) [-3388.208] (-3389.163) (-3386.240) -- 0:06:00 58000 -- [-3385.358] (-3395.353) (-3391.446) (-3391.901) * (-3390.357) (-3389.363) (-3387.838) [-3390.715] -- 0:05:57 58500 -- (-3391.295) [-3386.907] (-3394.024) (-3394.535) * [-3387.075] (-3390.907) (-3388.347) (-3391.126) -- 0:05:54 59000 -- (-3388.256) [-3386.385] (-3396.938) (-3384.328) * (-3394.860) (-3390.436) (-3384.425) [-3388.140] -- 0:05:50 59500 -- (-3388.740) (-3392.495) (-3395.979) [-3388.673] * (-3385.684) [-3382.803] (-3379.741) (-3395.949) -- 0:05:47 60000 -- (-3383.297) (-3391.768) (-3386.098) [-3383.286] * (-3385.416) [-3391.870] (-3388.929) (-3389.704) -- 0:05:44 Average standard deviation of split frequencies: 0.000000 60500 -- [-3384.212] (-3392.486) (-3389.074) (-3383.015) * (-3387.454) (-3385.117) [-3387.073] (-3386.454) -- 0:05:57 61000 -- [-3389.852] (-3385.889) (-3389.977) (-3386.215) * (-3382.090) (-3382.940) [-3387.165] (-3385.665) -- 0:05:54 61500 -- (-3386.443) (-3384.529) (-3386.563) [-3386.977] * (-3383.822) (-3388.871) (-3389.773) [-3385.313] -- 0:05:50 62000 -- (-3380.659) (-3386.593) (-3385.605) [-3384.947] * (-3388.285) (-3387.968) [-3382.130] (-3393.935) -- 0:05:47 62500 -- (-3389.904) (-3384.262) (-3398.540) [-3385.396] * (-3386.677) [-3388.371] (-3387.749) (-3400.372) -- 0:05:45 63000 -- (-3384.001) [-3380.018] (-3389.669) (-3380.942) * (-3384.463) [-3381.236] (-3381.382) (-3393.888) -- 0:05:56 63500 -- (-3385.230) (-3385.030) [-3387.171] (-3387.835) * (-3395.914) (-3390.122) (-3388.694) [-3388.929] -- 0:05:53 64000 -- (-3386.122) (-3390.851) [-3396.570] (-3386.164) * (-3385.026) [-3384.778] (-3395.676) (-3383.006) -- 0:05:51 64500 -- (-3380.877) [-3385.445] (-3387.685) (-3390.587) * (-3390.987) (-3387.102) (-3390.274) [-3384.217] -- 0:05:48 65000 -- (-3384.743) (-3386.237) [-3384.695] (-3395.035) * (-3390.935) [-3391.039] (-3392.152) (-3384.896) -- 0:05:45 Average standard deviation of split frequencies: 0.000000 65500 -- (-3389.801) [-3386.900] (-3382.864) (-3391.073) * [-3386.588] (-3392.677) (-3390.297) (-3387.835) -- 0:05:56 66000 -- (-3393.697) (-3389.812) [-3387.610] (-3398.234) * [-3384.997] (-3385.538) (-3383.844) (-3388.560) -- 0:05:53 66500 -- (-3388.637) [-3386.776] (-3392.062) (-3387.174) * (-3386.314) (-3384.832) [-3387.149] (-3393.546) -- 0:05:50 67000 -- (-3386.878) (-3406.336) [-3387.828] (-3384.749) * (-3394.593) (-3398.004) (-3392.839) [-3385.147] -- 0:05:48 67500 -- (-3390.651) [-3387.723] (-3393.386) (-3381.377) * [-3383.159] (-3383.698) (-3396.617) (-3386.376) -- 0:05:45 68000 -- (-3397.104) (-3386.803) [-3391.756] (-3399.776) * [-3384.213] (-3380.674) (-3399.095) (-3389.114) -- 0:05:42 68500 -- (-3391.374) (-3388.350) (-3388.699) [-3384.939] * (-3392.092) [-3386.078] (-3397.371) (-3386.389) -- 0:05:53 69000 -- (-3386.401) (-3393.695) [-3383.975] (-3390.060) * (-3388.363) (-3387.592) (-3388.829) [-3384.856] -- 0:05:50 69500 -- (-3395.168) (-3391.996) [-3388.758] (-3395.203) * (-3384.536) (-3394.776) (-3396.465) [-3394.126] -- 0:05:48 70000 -- (-3389.617) (-3382.848) (-3383.367) [-3395.213] * (-3384.400) [-3382.910] (-3390.352) (-3395.671) -- 0:05:45 Average standard deviation of split frequencies: 0.000000 70500 -- (-3393.000) (-3383.370) (-3385.453) [-3389.192] * (-3384.077) (-3391.872) [-3390.228] (-3391.763) -- 0:05:42 71000 -- [-3392.025] (-3390.753) (-3395.994) (-3384.156) * (-3388.202) [-3397.901] (-3388.346) (-3386.609) -- 0:05:53 71500 -- [-3391.554] (-3393.027) (-3396.130) (-3395.238) * (-3390.642) (-3397.978) (-3389.333) [-3386.866] -- 0:05:50 72000 -- (-3391.042) [-3391.900] (-3385.401) (-3388.059) * [-3392.184] (-3392.208) (-3386.097) (-3385.544) -- 0:05:48 72500 -- (-3386.453) (-3386.339) (-3389.082) [-3384.962] * (-3383.893) (-3388.539) (-3388.458) [-3386.547] -- 0:05:45 73000 -- (-3389.548) [-3382.849] (-3383.943) (-3391.084) * (-3387.718) (-3392.999) (-3381.979) [-3386.413] -- 0:05:42 73500 -- (-3398.956) [-3390.079] (-3391.962) (-3389.498) * [-3381.943] (-3386.559) (-3387.095) (-3387.795) -- 0:05:52 74000 -- [-3386.597] (-3388.205) (-3387.146) (-3389.299) * [-3387.873] (-3382.909) (-3391.060) (-3387.571) -- 0:05:50 74500 -- (-3384.924) (-3387.968) [-3386.177] (-3383.296) * (-3386.872) (-3392.440) [-3392.479] (-3389.376) -- 0:05:47 75000 -- (-3391.384) (-3385.801) [-3389.743] (-3389.668) * [-3392.654] (-3387.848) (-3390.546) (-3393.785) -- 0:05:45 Average standard deviation of split frequencies: 0.000000 75500 -- (-3384.518) [-3384.830] (-3397.649) (-3390.639) * (-3396.413) (-3391.531) [-3383.639] (-3388.441) -- 0:05:42 76000 -- (-3382.825) (-3384.919) [-3385.008] (-3394.023) * (-3390.989) [-3395.408] (-3392.834) (-3383.036) -- 0:05:40 76500 -- (-3392.350) [-3386.127] (-3383.981) (-3392.370) * (-3389.632) (-3391.090) (-3387.303) [-3387.828] -- 0:05:50 77000 -- (-3392.714) (-3391.996) [-3388.564] (-3379.765) * (-3388.306) (-3381.790) [-3385.132] (-3384.461) -- 0:05:47 77500 -- (-3380.479) (-3393.070) [-3382.793] (-3387.706) * (-3386.078) [-3385.730] (-3389.000) (-3384.385) -- 0:05:45 78000 -- (-3394.466) (-3388.145) [-3381.659] (-3392.225) * [-3386.090] (-3398.123) (-3388.343) (-3383.244) -- 0:05:42 78500 -- (-3390.630) (-3390.523) [-3383.866] (-3386.693) * (-3387.618) (-3387.023) [-3385.203] (-3390.084) -- 0:05:40 79000 -- (-3388.342) (-3389.405) (-3391.992) [-3382.800] * (-3387.688) [-3386.181] (-3389.407) (-3390.191) -- 0:05:49 79500 -- (-3395.524) [-3385.338] (-3387.860) (-3390.868) * [-3384.770] (-3392.267) (-3395.104) (-3389.516) -- 0:05:47 80000 -- (-3401.305) (-3386.363) (-3394.966) [-3395.683] * (-3385.402) (-3387.466) (-3397.923) [-3387.484] -- 0:05:45 Average standard deviation of split frequencies: 0.000000 80500 -- (-3397.807) [-3379.734] (-3388.783) (-3389.685) * (-3390.948) (-3387.842) [-3386.528] (-3389.148) -- 0:05:42 81000 -- (-3395.499) (-3384.540) [-3388.478] (-3388.357) * [-3386.058] (-3394.772) (-3389.371) (-3390.369) -- 0:05:40 81500 -- (-3386.820) (-3393.216) [-3386.487] (-3386.468) * (-3388.292) (-3385.582) (-3396.411) [-3379.318] -- 0:05:38 82000 -- (-3384.898) (-3389.274) [-3384.620] (-3392.535) * (-3384.246) (-3387.135) [-3395.853] (-3384.739) -- 0:05:47 82500 -- (-3388.543) (-3389.241) (-3388.289) [-3388.349] * (-3393.629) (-3385.362) (-3390.898) [-3385.348] -- 0:05:44 83000 -- (-3387.721) [-3389.826] (-3381.743) (-3384.665) * [-3386.515] (-3386.399) (-3387.675) (-3394.533) -- 0:05:42 83500 -- (-3394.870) [-3388.384] (-3385.993) (-3395.064) * (-3395.981) [-3390.223] (-3385.759) (-3388.741) -- 0:05:40 84000 -- (-3391.479) (-3392.794) [-3393.275] (-3394.063) * (-3389.053) (-3386.747) (-3385.837) [-3391.355] -- 0:05:38 84500 -- (-3388.946) (-3385.026) (-3400.124) [-3388.531] * (-3388.783) (-3385.292) (-3386.692) [-3385.600] -- 0:05:46 85000 -- [-3386.775] (-3385.373) (-3393.439) (-3386.686) * (-3386.581) [-3395.598] (-3383.839) (-3387.805) -- 0:05:44 Average standard deviation of split frequencies: 0.000000 85500 -- [-3385.641] (-3383.342) (-3382.066) (-3387.228) * (-3393.276) (-3390.808) (-3381.517) [-3385.723] -- 0:05:42 86000 -- [-3386.136] (-3391.957) (-3390.045) (-3384.180) * (-3390.557) [-3389.941] (-3388.657) (-3392.474) -- 0:05:40 86500 -- (-3390.060) (-3389.063) (-3388.103) [-3385.380] * (-3382.569) (-3393.334) [-3383.077] (-3384.545) -- 0:05:37 87000 -- (-3389.283) [-3389.725] (-3384.292) (-3386.620) * [-3387.718] (-3388.484) (-3390.471) (-3390.579) -- 0:05:46 87500 -- (-3389.390) (-3391.107) [-3389.330] (-3392.955) * (-3381.508) [-3389.151] (-3389.533) (-3388.732) -- 0:05:44 88000 -- (-3389.133) (-3382.788) [-3386.719] (-3393.052) * (-3392.858) (-3386.757) (-3394.836) [-3392.326] -- 0:05:42 88500 -- [-3386.801] (-3391.531) (-3387.382) (-3395.464) * (-3383.704) (-3389.933) [-3388.892] (-3394.664) -- 0:05:39 89000 -- (-3388.892) (-3386.689) (-3393.197) [-3381.430] * (-3389.486) [-3390.717] (-3383.534) (-3387.386) -- 0:05:37 89500 -- [-3387.339] (-3387.968) (-3390.400) (-3390.443) * (-3396.919) (-3387.917) (-3393.310) [-3387.532] -- 0:05:35 90000 -- (-3380.985) (-3385.230) (-3386.434) [-3391.252] * (-3391.856) (-3393.215) (-3391.721) [-3383.775] -- 0:05:43 Average standard deviation of split frequencies: 0.000000 90500 -- (-3389.470) [-3381.006] (-3393.280) (-3388.129) * (-3399.189) (-3385.250) (-3386.073) [-3383.290] -- 0:05:41 91000 -- (-3385.518) [-3383.399] (-3391.487) (-3393.003) * (-3395.053) (-3388.974) [-3383.727] (-3382.871) -- 0:05:39 91500 -- (-3394.916) (-3398.372) (-3396.706) [-3385.542] * [-3385.660] (-3386.945) (-3393.322) (-3398.529) -- 0:05:37 92000 -- (-3383.220) (-3390.585) [-3389.270] (-3392.119) * (-3391.884) (-3390.078) (-3392.267) [-3386.314] -- 0:05:35 92500 -- (-3387.368) (-3385.928) [-3392.539] (-3392.267) * [-3385.146] (-3392.678) (-3391.518) (-3380.164) -- 0:05:43 93000 -- (-3390.214) (-3390.656) (-3393.370) [-3392.210] * [-3390.750] (-3390.526) (-3390.407) (-3382.059) -- 0:05:41 93500 -- (-3384.370) (-3392.353) [-3389.798] (-3387.446) * [-3382.949] (-3400.678) (-3394.606) (-3389.404) -- 0:05:39 94000 -- (-3390.110) (-3384.917) [-3392.160] (-3383.941) * (-3390.942) (-3393.287) (-3388.208) [-3382.230] -- 0:05:37 94500 -- [-3391.922] (-3388.768) (-3389.063) (-3389.428) * (-3390.440) [-3381.309] (-3386.853) (-3392.800) -- 0:05:35 95000 -- (-3386.504) (-3386.629) (-3393.474) [-3384.912] * (-3391.052) (-3389.651) [-3388.351] (-3391.499) -- 0:05:33 Average standard deviation of split frequencies: 0.000000 95500 -- [-3380.044] (-3390.669) (-3390.905) (-3395.269) * (-3394.128) (-3390.705) [-3388.103] (-3389.018) -- 0:05:40 96000 -- (-3388.883) (-3395.996) [-3383.545] (-3392.561) * (-3392.798) (-3390.464) [-3385.729] (-3391.714) -- 0:05:39 96500 -- [-3392.498] (-3392.816) (-3389.736) (-3388.104) * (-3381.801) (-3390.866) (-3390.370) [-3388.465] -- 0:05:37 97000 -- (-3389.266) [-3382.907] (-3398.407) (-3383.808) * [-3386.232] (-3384.296) (-3387.343) (-3389.084) -- 0:05:35 97500 -- (-3390.478) [-3387.297] (-3390.698) (-3397.979) * (-3382.381) (-3389.261) (-3391.460) [-3392.225] -- 0:05:33 98000 -- (-3396.599) (-3391.959) (-3385.175) [-3386.318] * (-3393.481) [-3387.147] (-3396.814) (-3392.019) -- 0:05:31 98500 -- (-3395.063) [-3386.566] (-3382.058) (-3389.385) * (-3383.127) (-3387.768) [-3389.454] (-3397.854) -- 0:05:38 99000 -- (-3390.984) (-3386.825) (-3385.800) [-3385.823] * (-3392.575) [-3388.482] (-3387.466) (-3388.967) -- 0:05:36 99500 -- [-3390.716] (-3392.761) (-3393.229) (-3387.210) * (-3397.104) (-3387.575) [-3390.342] (-3395.868) -- 0:05:34 100000 -- [-3386.274] (-3394.391) (-3389.879) (-3388.560) * (-3392.944) [-3385.436] (-3396.843) (-3390.902) -- 0:05:33 Average standard deviation of split frequencies: 0.000000 100500 -- (-3381.343) (-3388.917) (-3388.794) [-3385.388] * (-3390.519) (-3384.071) (-3396.001) [-3392.183] -- 0:05:31 101000 -- (-3394.727) [-3380.529] (-3391.086) (-3385.260) * (-3387.744) (-3386.659) (-3397.259) [-3392.196] -- 0:05:38 101500 -- (-3390.072) (-3387.349) (-3389.999) [-3389.637] * (-3390.797) (-3397.022) (-3387.359) [-3387.477] -- 0:05:36 102000 -- [-3382.715] (-3392.284) (-3390.025) (-3384.000) * (-3379.390) (-3389.268) (-3386.459) [-3390.608] -- 0:05:34 102500 -- (-3382.579) (-3389.534) (-3385.922) [-3390.448] * (-3392.671) (-3392.520) (-3385.538) [-3390.611] -- 0:05:32 103000 -- (-3383.674) [-3381.309] (-3379.839) (-3387.702) * [-3393.177] (-3399.291) (-3394.359) (-3386.688) -- 0:05:30 103500 -- [-3380.441] (-3386.653) (-3389.250) (-3392.652) * [-3388.961] (-3402.792) (-3385.901) (-3389.515) -- 0:05:29 104000 -- (-3394.374) [-3386.355] (-3393.267) (-3389.898) * (-3386.976) (-3393.381) [-3391.349] (-3382.768) -- 0:05:36 104500 -- (-3385.756) (-3391.237) (-3382.541) [-3390.664] * (-3390.226) (-3390.848) (-3393.740) [-3383.715] -- 0:05:34 105000 -- (-3391.117) (-3390.203) [-3385.810] (-3388.500) * (-3394.557) (-3387.273) (-3392.643) [-3380.636] -- 0:05:32 Average standard deviation of split frequencies: 0.000000 105500 -- (-3391.872) [-3391.354] (-3384.816) (-3391.620) * (-3386.682) (-3384.495) (-3387.853) [-3383.224] -- 0:05:30 106000 -- (-3388.147) (-3392.358) [-3386.938] (-3387.232) * [-3389.351] (-3388.878) (-3393.899) (-3388.414) -- 0:05:28 106500 -- (-3394.259) [-3388.663] (-3387.899) (-3381.685) * [-3385.257] (-3387.591) (-3389.608) (-3384.534) -- 0:05:35 107000 -- (-3397.586) [-3382.680] (-3380.013) (-3384.649) * (-3390.613) (-3398.520) [-3386.320] (-3390.264) -- 0:05:33 107500 -- (-3387.756) [-3381.884] (-3392.545) (-3386.640) * (-3386.755) [-3381.778] (-3383.465) (-3382.869) -- 0:05:32 108000 -- (-3388.377) [-3386.761] (-3388.489) (-3384.036) * [-3388.364] (-3386.792) (-3393.295) (-3387.371) -- 0:05:30 108500 -- (-3405.868) (-3382.859) [-3384.234] (-3389.751) * (-3387.402) (-3387.994) [-3385.310] (-3388.515) -- 0:05:28 109000 -- (-3391.060) [-3387.286] (-3381.907) (-3390.177) * (-3389.183) (-3387.256) [-3391.508] (-3395.428) -- 0:05:26 109500 -- (-3390.519) (-3385.743) [-3386.963] (-3390.061) * (-3392.648) [-3384.019] (-3390.652) (-3399.408) -- 0:05:33 110000 -- (-3390.611) (-3390.554) (-3389.319) [-3388.930] * (-3391.116) (-3384.420) [-3391.478] (-3394.152) -- 0:05:31 Average standard deviation of split frequencies: 0.000000 110500 -- (-3384.756) (-3385.009) (-3397.782) [-3386.506] * [-3394.888] (-3387.699) (-3393.500) (-3400.512) -- 0:05:30 111000 -- (-3386.316) [-3391.169] (-3398.351) (-3392.245) * (-3389.584) [-3384.458] (-3381.966) (-3394.323) -- 0:05:28 111500 -- [-3394.456] (-3386.843) (-3395.573) (-3393.552) * [-3388.450] (-3386.083) (-3383.269) (-3390.819) -- 0:05:26 112000 -- [-3401.650] (-3395.079) (-3385.142) (-3387.939) * (-3388.797) [-3388.892] (-3383.544) (-3392.392) -- 0:05:33 112500 -- (-3400.174) (-3383.631) (-3384.552) [-3392.267] * (-3394.787) [-3382.298] (-3384.726) (-3385.440) -- 0:05:31 113000 -- (-3397.442) (-3391.005) [-3390.011] (-3388.555) * (-3392.864) (-3393.594) [-3383.889] (-3385.593) -- 0:05:29 113500 -- (-3396.336) [-3390.828] (-3385.035) (-3388.704) * (-3391.180) [-3389.805] (-3405.271) (-3384.465) -- 0:05:28 114000 -- (-3384.679) (-3385.498) [-3380.943] (-3387.390) * (-3389.906) (-3385.770) (-3390.650) [-3385.359] -- 0:05:26 114500 -- (-3385.394) (-3385.068) [-3391.165] (-3385.621) * [-3390.627] (-3388.109) (-3388.126) (-3383.877) -- 0:05:32 115000 -- (-3391.714) [-3390.403] (-3390.580) (-3388.313) * (-3400.325) (-3390.064) (-3385.733) [-3390.679] -- 0:05:30 Average standard deviation of split frequencies: 0.000000 115500 -- [-3385.587] (-3390.053) (-3393.776) (-3387.080) * [-3386.430] (-3386.192) (-3391.254) (-3394.445) -- 0:05:29 116000 -- [-3383.616] (-3388.035) (-3388.793) (-3399.101) * (-3388.049) (-3389.403) [-3385.041] (-3388.462) -- 0:05:27 116500 -- (-3388.254) [-3394.592] (-3394.201) (-3388.428) * (-3389.610) [-3382.494] (-3384.854) (-3392.782) -- 0:05:26 117000 -- [-3387.032] (-3389.933) (-3391.115) (-3390.556) * (-3385.371) (-3386.155) [-3386.677] (-3385.402) -- 0:05:24 117500 -- (-3392.342) [-3383.911] (-3385.703) (-3382.438) * (-3387.602) [-3384.115] (-3393.281) (-3385.048) -- 0:05:30 118000 -- (-3386.908) (-3388.125) (-3396.295) [-3384.578] * (-3382.306) (-3401.157) [-3392.684] (-3393.660) -- 0:05:28 118500 -- [-3385.943] (-3389.454) (-3384.765) (-3384.928) * [-3386.462] (-3394.691) (-3393.169) (-3391.583) -- 0:05:27 119000 -- (-3385.758) [-3389.496] (-3384.187) (-3391.158) * (-3386.866) (-3389.946) [-3385.098] (-3393.174) -- 0:05:25 119500 -- [-3387.567] (-3390.320) (-3388.200) (-3386.254) * (-3379.867) (-3396.316) (-3392.562) [-3390.789] -- 0:05:24 120000 -- [-3385.906] (-3381.960) (-3396.710) (-3386.452) * (-3384.737) (-3390.446) [-3385.482] (-3401.962) -- 0:05:30 Average standard deviation of split frequencies: 0.000000 120500 -- (-3385.701) [-3380.464] (-3388.226) (-3383.994) * (-3389.005) [-3385.934] (-3394.110) (-3386.048) -- 0:05:28 121000 -- (-3386.447) (-3392.814) [-3380.977] (-3389.812) * (-3386.183) [-3390.530] (-3388.573) (-3388.774) -- 0:05:26 121500 -- [-3391.559] (-3391.382) (-3383.798) (-3386.070) * (-3390.331) (-3395.713) [-3391.648] (-3394.234) -- 0:05:25 122000 -- (-3385.434) [-3383.344] (-3380.264) (-3382.843) * (-3389.286) (-3395.462) (-3387.925) [-3385.172] -- 0:05:23 122500 -- (-3389.421) (-3401.393) [-3379.709] (-3392.855) * (-3380.441) (-3389.181) [-3396.323] (-3383.259) -- 0:05:22 123000 -- (-3380.743) (-3393.708) [-3382.755] (-3387.221) * (-3390.687) (-3388.478) (-3389.408) [-3393.949] -- 0:05:27 123500 -- (-3384.625) [-3390.650] (-3389.443) (-3391.185) * (-3399.358) [-3376.502] (-3383.649) (-3392.096) -- 0:05:26 124000 -- [-3383.187] (-3387.222) (-3401.385) (-3384.571) * (-3398.659) (-3389.128) (-3389.266) [-3384.523] -- 0:05:24 124500 -- (-3386.436) (-3383.005) (-3388.354) [-3388.924] * (-3398.634) (-3389.154) [-3383.029] (-3386.466) -- 0:05:23 125000 -- (-3390.434) (-3387.930) (-3396.342) [-3386.373] * (-3390.743) (-3395.811) (-3384.778) [-3383.047] -- 0:05:22 Average standard deviation of split frequencies: 0.000000 125500 -- (-3387.669) [-3387.814] (-3391.655) (-3382.764) * (-3390.500) (-3385.532) (-3390.550) [-3387.078] -- 0:05:27 126000 -- [-3385.618] (-3392.746) (-3390.462) (-3385.518) * (-3392.136) [-3386.010] (-3392.185) (-3390.432) -- 0:05:26 126500 -- (-3396.108) [-3385.481] (-3391.349) (-3379.944) * (-3386.443) (-3380.100) (-3396.985) [-3389.259] -- 0:05:24 127000 -- (-3384.726) (-3388.843) (-3382.847) [-3385.881] * (-3386.700) (-3387.076) [-3384.991] (-3380.618) -- 0:05:23 127500 -- (-3383.805) [-3390.439] (-3397.935) (-3389.397) * (-3394.490) [-3387.039] (-3393.729) (-3395.002) -- 0:05:21 128000 -- (-3383.616) (-3391.259) (-3392.653) [-3383.111] * (-3398.286) (-3397.389) [-3394.381] (-3386.195) -- 0:05:20 128500 -- (-3387.800) (-3385.098) [-3385.929] (-3386.602) * (-3391.428) (-3392.449) [-3385.909] (-3385.807) -- 0:05:25 129000 -- (-3386.158) (-3387.189) [-3382.334] (-3386.409) * (-3384.417) [-3384.426] (-3398.970) (-3393.144) -- 0:05:24 129500 -- (-3399.529) [-3386.424] (-3390.802) (-3387.700) * (-3385.733) [-3383.009] (-3394.342) (-3391.253) -- 0:05:22 130000 -- (-3390.280) [-3386.457] (-3386.316) (-3388.786) * (-3381.454) (-3391.995) [-3390.010] (-3391.773) -- 0:05:21 Average standard deviation of split frequencies: 0.000000 130500 -- (-3386.991) (-3389.299) [-3388.357] (-3395.093) * (-3388.663) [-3384.127] (-3391.940) (-3381.821) -- 0:05:19 131000 -- (-3391.955) (-3393.184) [-3391.905] (-3395.419) * (-3381.507) (-3389.904) (-3397.973) [-3384.916] -- 0:05:25 131500 -- (-3392.315) [-3383.583] (-3396.162) (-3391.738) * [-3382.952] (-3391.188) (-3393.104) (-3393.464) -- 0:05:23 132000 -- (-3387.017) (-3388.469) (-3387.588) [-3383.695] * (-3388.066) (-3396.952) (-3387.645) [-3394.791] -- 0:05:22 132500 -- [-3388.048] (-3389.852) (-3386.052) (-3390.120) * [-3385.532] (-3386.109) (-3385.386) (-3393.538) -- 0:05:20 133000 -- (-3382.744) (-3395.785) [-3389.348] (-3393.141) * (-3389.740) [-3384.058] (-3395.065) (-3385.908) -- 0:05:19 133500 -- (-3382.746) (-3392.717) (-3387.110) [-3387.967] * (-3385.965) (-3384.474) [-3389.530] (-3391.013) -- 0:05:18 134000 -- (-3389.993) [-3387.281] (-3389.283) (-3386.613) * [-3380.367] (-3385.459) (-3386.241) (-3391.339) -- 0:05:23 134500 -- [-3394.893] (-3394.061) (-3384.655) (-3388.343) * [-3384.811] (-3385.762) (-3381.344) (-3388.022) -- 0:05:21 135000 -- (-3385.865) (-3392.159) (-3382.840) [-3385.496] * (-3391.155) [-3398.023] (-3381.184) (-3388.928) -- 0:05:20 Average standard deviation of split frequencies: 0.000000 135500 -- [-3391.020] (-3394.222) (-3389.796) (-3383.750) * (-3384.330) [-3394.214] (-3387.130) (-3386.201) -- 0:05:19 136000 -- [-3385.159] (-3386.530) (-3391.828) (-3389.870) * [-3385.704] (-3388.106) (-3389.890) (-3389.310) -- 0:05:17 136500 -- (-3389.081) (-3387.999) [-3386.038] (-3392.906) * [-3390.892] (-3390.451) (-3385.637) (-3394.187) -- 0:05:22 137000 -- (-3391.968) [-3391.102] (-3385.155) (-3389.040) * (-3395.594) (-3387.081) [-3391.484] (-3388.643) -- 0:05:21 137500 -- (-3384.226) (-3397.948) [-3382.300] (-3400.704) * (-3391.933) (-3395.454) [-3389.856] (-3394.395) -- 0:05:19 138000 -- [-3382.856] (-3383.368) (-3388.901) (-3383.430) * (-3389.087) (-3384.453) [-3390.542] (-3393.777) -- 0:05:18 138500 -- (-3390.358) (-3385.096) [-3388.398] (-3383.180) * [-3394.671] (-3389.359) (-3388.334) (-3384.450) -- 0:05:17 139000 -- [-3391.451] (-3383.655) (-3386.497) (-3397.947) * (-3390.402) (-3383.077) (-3383.513) [-3384.675] -- 0:05:22 139500 -- (-3387.790) [-3387.279] (-3387.704) (-3388.437) * (-3387.452) (-3391.180) (-3380.895) [-3386.150] -- 0:05:20 140000 -- (-3383.525) (-3384.480) [-3388.081] (-3385.585) * (-3394.075) (-3387.532) (-3390.229) [-3391.592] -- 0:05:19 Average standard deviation of split frequencies: 0.000000 140500 -- (-3384.977) (-3387.170) (-3386.290) [-3383.004] * (-3390.100) (-3389.408) (-3389.327) [-3393.472] -- 0:05:18 141000 -- (-3397.204) [-3386.150] (-3391.090) (-3388.744) * (-3388.418) (-3381.568) (-3387.331) [-3388.165] -- 0:05:16 141500 -- (-3395.110) (-3385.053) (-3388.046) [-3384.385] * (-3395.905) (-3388.203) (-3389.643) [-3388.300] -- 0:05:15 142000 -- (-3383.553) (-3388.088) [-3385.553] (-3388.949) * (-3384.740) (-3382.852) [-3392.093] (-3391.247) -- 0:05:20 142500 -- (-3387.555) [-3382.584] (-3387.397) (-3388.841) * (-3382.135) [-3385.551] (-3385.026) (-3387.148) -- 0:05:18 143000 -- (-3390.776) (-3380.704) (-3384.665) [-3394.184] * (-3385.322) [-3389.369] (-3386.771) (-3383.174) -- 0:05:17 143500 -- [-3389.085] (-3381.276) (-3385.092) (-3385.781) * (-3393.618) (-3389.684) (-3389.110) [-3383.966] -- 0:05:16 144000 -- (-3389.066) (-3391.108) [-3392.615] (-3395.280) * [-3391.261] (-3387.549) (-3389.616) (-3383.251) -- 0:05:15 144500 -- [-3387.805] (-3392.790) (-3387.136) (-3393.420) * (-3386.183) (-3384.001) (-3395.445) [-3387.038] -- 0:05:19 145000 -- (-3387.960) (-3394.318) (-3397.587) [-3387.967] * (-3388.932) (-3383.079) [-3392.798] (-3388.169) -- 0:05:18 Average standard deviation of split frequencies: 0.000000 145500 -- (-3388.963) (-3392.654) [-3383.786] (-3388.360) * (-3392.250) (-3386.749) (-3388.028) [-3380.422] -- 0:05:17 146000 -- (-3392.362) (-3396.439) (-3383.058) [-3383.097] * (-3384.270) [-3391.741] (-3403.441) (-3385.800) -- 0:05:15 146500 -- (-3400.068) (-3382.467) (-3393.092) [-3389.300] * (-3385.651) [-3390.093] (-3390.204) (-3391.110) -- 0:05:14 147000 -- (-3393.256) (-3389.831) [-3382.919] (-3391.181) * (-3390.836) [-3390.322] (-3391.951) (-3389.054) -- 0:05:13 147500 -- [-3388.504] (-3384.703) (-3392.733) (-3385.381) * (-3387.590) [-3388.018] (-3393.141) (-3386.098) -- 0:05:17 148000 -- (-3386.967) (-3396.618) [-3384.578] (-3384.126) * (-3388.207) [-3385.465] (-3381.995) (-3386.410) -- 0:05:16 148500 -- (-3386.940) (-3392.323) (-3393.020) [-3386.185] * (-3383.378) [-3389.395] (-3390.959) (-3390.606) -- 0:05:15 149000 -- (-3384.449) [-3381.893] (-3393.180) (-3393.550) * [-3385.393] (-3390.701) (-3382.273) (-3389.976) -- 0:05:14 149500 -- [-3383.973] (-3383.442) (-3385.248) (-3397.053) * (-3387.831) (-3390.116) [-3393.260] (-3383.558) -- 0:05:12 150000 -- (-3388.573) (-3389.020) (-3390.192) [-3383.047] * (-3393.558) [-3386.680] (-3395.486) (-3385.271) -- 0:05:17 Average standard deviation of split frequencies: 0.000000 150500 -- (-3383.602) (-3391.767) [-3385.036] (-3397.859) * (-3393.921) [-3384.449] (-3398.023) (-3391.456) -- 0:05:16 151000 -- (-3390.031) (-3396.035) [-3395.038] (-3392.571) * (-3398.104) (-3386.372) [-3383.836] (-3394.130) -- 0:05:14 151500 -- (-3391.337) (-3388.179) [-3385.191] (-3391.895) * (-3389.100) (-3384.961) [-3388.219] (-3393.758) -- 0:05:13 152000 -- (-3389.760) (-3390.069) (-3380.587) [-3384.462] * (-3386.998) [-3386.122] (-3388.497) (-3391.520) -- 0:05:12 152500 -- (-3386.804) (-3384.931) (-3388.181) [-3391.494] * (-3383.812) [-3387.245] (-3386.478) (-3389.393) -- 0:05:11 153000 -- (-3385.823) (-3399.603) [-3386.134] (-3384.164) * (-3384.796) [-3386.707] (-3385.475) (-3385.869) -- 0:05:15 153500 -- [-3386.464] (-3389.862) (-3391.004) (-3384.748) * (-3382.185) (-3386.520) (-3385.546) [-3388.837] -- 0:05:14 154000 -- (-3392.404) (-3385.449) (-3388.804) [-3383.141] * (-3389.323) (-3387.745) (-3395.085) [-3389.409] -- 0:05:13 154500 -- (-3384.961) [-3386.744] (-3400.792) (-3401.180) * [-3382.673] (-3396.333) (-3398.815) (-3381.382) -- 0:05:11 155000 -- (-3383.727) [-3383.428] (-3388.211) (-3393.602) * (-3388.492) (-3389.814) (-3389.380) [-3384.527] -- 0:05:10 Average standard deviation of split frequencies: 0.000000 155500 -- [-3379.372] (-3391.295) (-3399.469) (-3388.446) * (-3385.231) (-3383.955) [-3382.446] (-3388.029) -- 0:05:14 156000 -- (-3380.892) (-3383.016) (-3388.635) [-3389.421] * (-3385.968) (-3383.803) [-3385.285] (-3389.121) -- 0:05:13 156500 -- (-3386.403) (-3386.251) (-3397.592) [-3387.767] * (-3385.420) (-3382.473) [-3380.584] (-3395.348) -- 0:05:12 157000 -- (-3388.059) (-3385.728) [-3385.224] (-3387.714) * (-3391.556) [-3382.771] (-3393.407) (-3390.832) -- 0:05:11 157500 -- [-3391.253] (-3388.984) (-3383.891) (-3386.911) * (-3397.065) [-3385.194] (-3392.883) (-3382.199) -- 0:05:10 158000 -- (-3389.148) [-3388.888] (-3393.667) (-3389.356) * (-3392.708) [-3386.498] (-3388.447) (-3394.418) -- 0:05:14 158500 -- (-3390.032) (-3388.467) [-3389.229] (-3385.158) * (-3402.807) (-3390.561) (-3388.917) [-3386.810] -- 0:05:13 159000 -- (-3387.232) (-3386.822) (-3391.744) [-3388.849] * (-3394.763) (-3391.235) (-3388.561) [-3382.675] -- 0:05:12 159500 -- (-3385.504) [-3384.728] (-3394.616) (-3389.566) * (-3388.975) (-3393.463) [-3388.235] (-3383.279) -- 0:05:10 160000 -- (-3389.589) (-3386.355) [-3389.246] (-3386.479) * [-3384.506] (-3391.167) (-3389.739) (-3389.905) -- 0:05:09 Average standard deviation of split frequencies: 0.000000 160500 -- (-3392.190) (-3383.882) [-3395.048] (-3390.391) * (-3389.214) (-3391.330) [-3388.807] (-3393.612) -- 0:05:08 161000 -- (-3392.922) (-3392.437) (-3387.900) [-3388.781] * (-3390.200) [-3387.552] (-3387.270) (-3390.082) -- 0:05:12 161500 -- [-3385.375] (-3382.968) (-3380.752) (-3386.484) * (-3387.538) [-3385.910] (-3389.321) (-3400.163) -- 0:05:11 162000 -- (-3389.114) (-3383.946) [-3387.283] (-3401.340) * (-3388.693) (-3387.450) [-3386.492] (-3395.135) -- 0:05:10 162500 -- (-3389.767) (-3390.737) (-3389.730) [-3386.330] * [-3386.502] (-3387.146) (-3384.965) (-3385.625) -- 0:05:09 163000 -- [-3385.371] (-3386.798) (-3386.714) (-3387.435) * (-3391.595) [-3387.993] (-3386.872) (-3390.576) -- 0:05:08 163500 -- (-3390.208) (-3388.293) [-3385.786] (-3384.157) * (-3394.304) (-3390.918) (-3392.440) [-3387.937] -- 0:05:12 164000 -- [-3385.340] (-3390.666) (-3387.398) (-3391.053) * (-3386.094) (-3387.521) [-3395.524] (-3399.083) -- 0:05:10 164500 -- (-3385.330) (-3389.454) [-3389.062] (-3387.590) * [-3389.485] (-3393.361) (-3391.711) (-3389.276) -- 0:05:09 165000 -- (-3387.804) (-3387.616) [-3384.479] (-3386.934) * (-3388.210) [-3386.342] (-3394.073) (-3386.283) -- 0:05:08 Average standard deviation of split frequencies: 0.000000 165500 -- (-3388.086) (-3384.086) [-3385.683] (-3384.552) * (-3390.743) [-3383.497] (-3397.237) (-3383.774) -- 0:05:07 166000 -- [-3385.984] (-3384.294) (-3389.375) (-3383.099) * (-3385.096) (-3382.645) [-3396.938] (-3395.102) -- 0:05:06 166500 -- [-3381.405] (-3386.853) (-3390.664) (-3390.751) * [-3386.799] (-3389.948) (-3381.994) (-3386.815) -- 0:05:10 167000 -- (-3382.603) (-3394.178) [-3389.398] (-3385.530) * (-3393.072) (-3391.674) [-3384.267] (-3388.183) -- 0:05:09 167500 -- [-3385.658] (-3392.745) (-3388.959) (-3400.590) * [-3389.756] (-3384.930) (-3385.290) (-3387.081) -- 0:05:08 168000 -- (-3390.632) [-3385.558] (-3391.038) (-3386.695) * [-3384.354] (-3390.908) (-3394.939) (-3392.516) -- 0:05:07 168500 -- (-3391.816) [-3381.478] (-3392.085) (-3388.263) * (-3381.507) (-3384.646) (-3389.392) [-3381.945] -- 0:05:05 169000 -- (-3392.112) (-3387.189) (-3387.414) [-3390.424] * (-3388.825) [-3386.151] (-3389.318) (-3386.945) -- 0:05:09 169500 -- [-3385.173] (-3384.157) (-3396.349) (-3390.346) * [-3387.729] (-3398.268) (-3385.975) (-3383.712) -- 0:05:08 170000 -- (-3384.895) [-3383.029] (-3386.124) (-3396.771) * (-3396.372) (-3389.550) [-3391.058] (-3385.439) -- 0:05:07 Average standard deviation of split frequencies: 0.000000 170500 -- (-3394.481) [-3384.336] (-3389.777) (-3391.434) * (-3392.420) (-3388.294) (-3381.702) [-3386.320] -- 0:05:06 171000 -- (-3389.087) (-3383.557) [-3386.901] (-3385.301) * (-3388.647) [-3386.958] (-3391.908) (-3394.234) -- 0:05:05 171500 -- (-3387.102) [-3382.324] (-3389.019) (-3393.349) * (-3393.685) (-3385.434) (-3384.650) [-3389.876] -- 0:05:09 172000 -- (-3387.061) (-3384.585) [-3385.433] (-3385.929) * (-3391.998) (-3383.011) (-3389.697) [-3393.918] -- 0:05:08 172500 -- [-3385.073] (-3385.541) (-3395.759) (-3384.121) * (-3392.320) (-3389.173) [-3389.045] (-3388.852) -- 0:05:07 173000 -- (-3380.950) [-3383.938] (-3389.796) (-3383.943) * (-3393.355) (-3383.513) (-3382.478) [-3383.775] -- 0:05:05 173500 -- [-3392.609] (-3390.362) (-3394.375) (-3383.982) * (-3394.587) [-3381.623] (-3384.360) (-3387.352) -- 0:05:04 174000 -- [-3392.847] (-3386.227) (-3384.197) (-3395.573) * (-3387.767) (-3391.879) [-3385.419] (-3382.707) -- 0:05:03 174500 -- (-3392.139) (-3389.315) [-3391.200] (-3385.293) * (-3399.764) [-3389.396] (-3385.482) (-3383.084) -- 0:05:07 175000 -- (-3396.816) (-3395.247) [-3401.059] (-3391.055) * (-3389.884) (-3384.670) [-3390.037] (-3389.145) -- 0:05:06 Average standard deviation of split frequencies: 0.000000 175500 -- (-3388.472) [-3384.073] (-3385.962) (-3385.787) * (-3385.130) [-3391.806] (-3386.238) (-3391.179) -- 0:05:05 176000 -- (-3381.841) [-3382.693] (-3387.388) (-3389.432) * [-3384.796] (-3387.184) (-3388.831) (-3388.160) -- 0:05:04 176500 -- [-3383.694] (-3385.218) (-3383.634) (-3387.285) * (-3393.165) (-3383.743) (-3391.616) [-3386.498] -- 0:05:03 177000 -- (-3382.706) [-3390.169] (-3385.793) (-3383.704) * (-3397.679) [-3393.686] (-3387.240) (-3396.399) -- 0:05:06 177500 -- (-3385.344) (-3389.333) (-3390.938) [-3382.399] * [-3386.380] (-3393.059) (-3387.569) (-3389.808) -- 0:05:05 178000 -- (-3385.856) (-3387.064) (-3397.431) [-3385.746] * [-3381.247] (-3385.501) (-3388.066) (-3397.471) -- 0:05:04 178500 -- (-3393.140) (-3389.452) [-3385.395] (-3394.922) * (-3386.252) (-3388.570) [-3383.231] (-3393.305) -- 0:05:03 179000 -- (-3382.457) (-3384.066) [-3393.668] (-3389.125) * (-3388.422) (-3391.285) [-3386.594] (-3391.973) -- 0:05:02 179500 -- [-3383.148] (-3385.125) (-3383.645) (-3391.926) * (-3388.874) [-3381.681] (-3390.558) (-3391.012) -- 0:05:06 180000 -- (-3387.282) [-3392.803] (-3386.661) (-3387.352) * [-3385.636] (-3384.268) (-3392.215) (-3389.501) -- 0:05:05 Average standard deviation of split frequencies: 0.000000 180500 -- [-3392.699] (-3385.323) (-3388.339) (-3390.232) * [-3392.112] (-3385.784) (-3387.175) (-3391.059) -- 0:05:04 181000 -- [-3384.182] (-3384.524) (-3388.730) (-3391.228) * (-3386.319) [-3383.515] (-3397.724) (-3386.516) -- 0:05:03 181500 -- (-3387.107) [-3382.756] (-3386.138) (-3390.934) * (-3389.694) [-3381.383] (-3388.088) (-3386.543) -- 0:05:02 182000 -- (-3386.301) (-3385.643) [-3383.817] (-3386.856) * [-3392.154] (-3391.204) (-3390.432) (-3388.691) -- 0:05:01 182500 -- (-3387.382) (-3390.034) [-3384.209] (-3388.076) * (-3389.855) (-3385.672) [-3392.027] (-3383.028) -- 0:05:04 183000 -- [-3381.042] (-3387.971) (-3384.979) (-3383.811) * (-3385.899) (-3392.668) (-3392.391) [-3384.081] -- 0:05:03 183500 -- [-3386.532] (-3388.125) (-3384.582) (-3389.899) * (-3386.480) (-3392.262) (-3385.802) [-3383.808] -- 0:05:02 184000 -- [-3386.648] (-3390.067) (-3389.531) (-3390.805) * [-3391.647] (-3395.027) (-3390.422) (-3394.641) -- 0:05:01 184500 -- (-3384.556) (-3388.380) (-3384.262) [-3383.657] * [-3383.473] (-3389.071) (-3392.608) (-3388.177) -- 0:05:00 185000 -- (-3386.722) [-3384.056] (-3390.914) (-3388.764) * [-3388.765] (-3389.586) (-3396.169) (-3383.500) -- 0:05:03 Average standard deviation of split frequencies: 0.000000 185500 -- (-3386.462) (-3403.835) [-3387.747] (-3385.324) * (-3387.526) [-3387.972] (-3394.663) (-3390.391) -- 0:05:02 186000 -- (-3388.868) [-3389.614] (-3388.512) (-3390.714) * (-3393.935) (-3397.578) [-3388.897] (-3387.279) -- 0:05:01 186500 -- (-3388.417) (-3392.704) (-3386.132) [-3388.657] * [-3385.122] (-3390.796) (-3387.492) (-3387.350) -- 0:05:00 187000 -- (-3389.609) [-3384.163] (-3391.755) (-3386.554) * (-3393.919) [-3386.736] (-3383.573) (-3386.694) -- 0:04:59 187500 -- [-3393.806] (-3384.554) (-3381.639) (-3388.767) * (-3390.128) [-3385.016] (-3383.090) (-3385.440) -- 0:05:03 188000 -- (-3393.507) (-3388.025) (-3390.579) [-3387.651] * (-3390.608) (-3391.958) (-3390.335) [-3383.709] -- 0:05:02 188500 -- (-3392.852) (-3388.556) [-3388.349] (-3387.691) * [-3380.311] (-3389.876) (-3399.040) (-3387.558) -- 0:05:01 189000 -- [-3384.941] (-3394.769) (-3388.512) (-3387.402) * (-3393.761) [-3386.392] (-3392.025) (-3389.792) -- 0:05:00 189500 -- (-3406.385) [-3386.908] (-3384.315) (-3385.650) * (-3396.560) (-3391.357) [-3395.695] (-3390.903) -- 0:04:59 190000 -- (-3395.055) (-3390.650) (-3386.379) [-3388.068] * [-3382.766] (-3381.573) (-3385.608) (-3392.328) -- 0:05:02 Average standard deviation of split frequencies: 0.000000 190500 -- (-3389.350) (-3385.501) (-3395.647) [-3385.260] * (-3388.666) (-3383.117) [-3386.099] (-3386.875) -- 0:05:01 191000 -- (-3386.519) [-3386.131] (-3390.224) (-3384.599) * (-3398.866) (-3386.688) [-3395.726] (-3386.816) -- 0:05:00 191500 -- [-3382.170] (-3388.265) (-3392.113) (-3389.574) * (-3390.462) [-3381.432] (-3391.406) (-3390.813) -- 0:04:59 192000 -- (-3385.297) (-3398.323) (-3389.931) [-3382.770] * (-3394.785) (-3393.182) [-3388.584] (-3388.904) -- 0:05:03 192500 -- (-3386.444) (-3389.167) (-3393.473) [-3386.036] * (-3397.967) (-3386.918) (-3393.745) [-3383.390] -- 0:05:02 193000 -- [-3389.035] (-3390.049) (-3394.990) (-3385.361) * (-3390.244) (-3387.693) (-3392.753) [-3384.467] -- 0:05:01 193500 -- (-3394.050) (-3387.477) (-3404.069) [-3397.995] * (-3382.785) (-3393.872) (-3386.532) [-3389.087] -- 0:05:00 194000 -- (-3394.699) [-3382.761] (-3399.911) (-3391.266) * [-3383.120] (-3392.191) (-3387.890) (-3394.647) -- 0:04:59 194500 -- (-3389.533) (-3391.010) [-3390.536] (-3384.489) * [-3385.208] (-3391.991) (-3385.589) (-3385.577) -- 0:04:58 195000 -- (-3388.027) (-3386.656) (-3396.047) [-3383.869] * (-3385.368) [-3392.756] (-3383.789) (-3382.670) -- 0:05:01 Average standard deviation of split frequencies: 0.000000 195500 -- (-3383.167) (-3389.931) (-3386.474) [-3384.889] * (-3387.168) (-3384.246) (-3387.255) [-3388.951] -- 0:05:00 196000 -- (-3384.981) (-3386.644) (-3397.988) [-3386.511] * [-3383.158] (-3387.967) (-3395.120) (-3400.141) -- 0:04:59 196500 -- (-3392.409) [-3389.276] (-3405.180) (-3389.828) * (-3393.623) [-3381.685] (-3380.015) (-3391.242) -- 0:04:58 197000 -- [-3384.010] (-3390.448) (-3392.874) (-3393.586) * (-3392.465) [-3378.131] (-3389.545) (-3391.836) -- 0:04:57 197500 -- (-3384.036) (-3387.306) (-3390.157) [-3384.778] * (-3390.205) [-3382.429] (-3388.754) (-3382.612) -- 0:05:00 198000 -- (-3388.983) (-3383.769) (-3392.187) [-3385.630] * (-3394.257) (-3384.368) (-3394.412) [-3381.258] -- 0:04:59 198500 -- (-3380.361) (-3390.373) [-3393.883] (-3393.295) * (-3388.813) [-3389.570] (-3398.240) (-3390.692) -- 0:04:58 199000 -- (-3386.354) (-3387.812) (-3387.007) [-3388.257] * (-3379.523) (-3382.890) (-3404.744) [-3385.744] -- 0:04:57 199500 -- (-3393.598) (-3385.170) [-3389.612] (-3391.018) * [-3385.939] (-3388.919) (-3395.553) (-3388.494) -- 0:04:56 200000 -- (-3393.350) [-3387.783] (-3399.295) (-3386.847) * (-3388.844) [-3381.952] (-3397.369) (-3385.222) -- 0:04:56 Average standard deviation of split frequencies: 0.000000 200500 -- (-3387.130) [-3392.004] (-3382.306) (-3389.606) * (-3395.919) (-3385.653) [-3390.021] (-3389.441) -- 0:04:59 201000 -- [-3382.644] (-3391.304) (-3387.115) (-3383.506) * [-3388.195] (-3387.795) (-3385.668) (-3390.410) -- 0:04:58 201500 -- (-3387.861) [-3387.311] (-3382.113) (-3386.373) * (-3383.206) (-3389.013) (-3386.363) [-3384.821] -- 0:04:57 202000 -- (-3386.498) [-3384.267] (-3382.162) (-3396.191) * [-3386.127] (-3387.309) (-3395.510) (-3389.143) -- 0:04:56 202500 -- (-3389.378) (-3389.019) (-3385.753) [-3390.443] * (-3386.136) (-3385.964) [-3385.763] (-3384.579) -- 0:04:55 203000 -- [-3387.336] (-3398.395) (-3393.307) (-3385.909) * [-3386.319] (-3385.400) (-3390.135) (-3387.736) -- 0:04:58 203500 -- (-3393.598) [-3385.228] (-3379.754) (-3381.352) * [-3384.089] (-3387.519) (-3386.298) (-3390.220) -- 0:04:57 204000 -- (-3389.589) (-3395.585) [-3380.194] (-3392.858) * (-3397.831) [-3380.438] (-3392.760) (-3389.405) -- 0:04:56 204500 -- [-3384.284] (-3384.298) (-3391.679) (-3391.318) * (-3386.250) (-3383.389) (-3388.244) [-3388.418] -- 0:04:55 205000 -- (-3391.462) (-3391.295) [-3389.297] (-3382.235) * (-3391.319) (-3389.441) [-3386.091] (-3386.957) -- 0:04:54 Average standard deviation of split frequencies: 0.000000 205500 -- (-3384.309) (-3388.172) [-3386.827] (-3386.854) * (-3383.160) (-3391.471) [-3388.749] (-3383.322) -- 0:04:57 206000 -- [-3383.022] (-3395.527) (-3384.923) (-3393.185) * (-3384.840) (-3402.883) (-3388.820) [-3387.015] -- 0:04:56 206500 -- (-3385.008) (-3391.280) [-3388.927] (-3392.359) * [-3381.389] (-3402.591) (-3387.653) (-3386.044) -- 0:04:55 207000 -- [-3391.605] (-3390.552) (-3396.346) (-3384.346) * (-3386.238) (-3388.046) (-3392.164) [-3392.244] -- 0:04:54 207500 -- (-3385.532) (-3388.998) [-3390.333] (-3389.217) * (-3392.339) (-3397.401) [-3383.124] (-3392.402) -- 0:04:54 208000 -- (-3388.424) (-3393.896) [-3383.258] (-3383.304) * [-3381.547] (-3397.254) (-3390.173) (-3387.962) -- 0:04:53 208500 -- [-3388.277] (-3388.738) (-3384.918) (-3390.293) * (-3386.546) (-3394.825) [-3384.742] (-3398.580) -- 0:04:56 209000 -- [-3389.509] (-3391.976) (-3387.680) (-3388.306) * (-3385.235) (-3389.357) [-3389.452] (-3390.953) -- 0:04:55 209500 -- (-3392.703) (-3384.637) [-3381.845] (-3391.725) * [-3386.238] (-3386.071) (-3385.048) (-3397.909) -- 0:04:54 210000 -- [-3387.331] (-3388.250) (-3381.232) (-3387.633) * [-3386.825] (-3385.845) (-3391.794) (-3391.669) -- 0:04:53 Average standard deviation of split frequencies: 0.000000 210500 -- [-3393.066] (-3387.036) (-3386.494) (-3386.020) * [-3386.812] (-3387.983) (-3398.263) (-3389.618) -- 0:04:52 211000 -- (-3391.626) [-3392.079] (-3379.158) (-3391.043) * (-3385.739) [-3390.149] (-3385.818) (-3394.745) -- 0:04:55 211500 -- (-3389.022) [-3383.740] (-3379.737) (-3391.851) * (-3383.809) [-3392.897] (-3386.919) (-3396.944) -- 0:04:54 212000 -- (-3400.957) (-3389.837) (-3384.298) [-3384.688] * (-3391.929) (-3384.819) [-3387.248] (-3391.567) -- 0:04:53 212500 -- (-3395.202) (-3390.368) (-3388.103) [-3385.411] * (-3388.063) (-3383.362) [-3385.749] (-3390.528) -- 0:04:52 213000 -- (-3399.272) (-3389.334) (-3390.959) [-3393.506] * [-3384.315] (-3391.472) (-3384.858) (-3387.860) -- 0:04:51 213500 -- (-3387.046) [-3383.254] (-3384.829) (-3393.093) * (-3389.967) (-3391.327) [-3381.831] (-3396.823) -- 0:04:51 214000 -- (-3393.831) (-3396.300) (-3391.220) [-3390.547] * (-3395.071) [-3388.603] (-3393.569) (-3387.045) -- 0:04:53 214500 -- (-3385.893) [-3379.748] (-3392.774) (-3383.389) * [-3389.226] (-3401.733) (-3395.841) (-3387.778) -- 0:04:52 215000 -- (-3387.284) (-3385.894) (-3383.339) [-3386.426] * (-3391.715) [-3392.882] (-3393.984) (-3382.509) -- 0:04:52 Average standard deviation of split frequencies: 0.000000 215500 -- (-3387.699) (-3395.833) [-3386.735] (-3390.808) * [-3385.847] (-3393.877) (-3393.981) (-3389.952) -- 0:04:51 216000 -- (-3397.881) [-3392.141] (-3383.357) (-3389.803) * (-3391.451) [-3385.546] (-3386.086) (-3386.301) -- 0:04:50 216500 -- (-3396.732) (-3394.842) (-3384.101) [-3380.430] * (-3393.739) (-3385.537) (-3395.922) [-3391.395] -- 0:04:53 217000 -- (-3397.189) (-3385.883) (-3391.000) [-3385.084] * (-3389.995) (-3391.493) (-3398.280) [-3388.340] -- 0:04:52 217500 -- (-3388.254) (-3390.197) (-3393.361) [-3383.600] * (-3401.149) [-3391.941] (-3397.196) (-3388.556) -- 0:04:51 218000 -- (-3385.816) (-3384.244) [-3389.226] (-3388.054) * [-3388.084] (-3395.000) (-3383.953) (-3389.894) -- 0:04:50 218500 -- (-3395.480) (-3388.084) [-3391.531] (-3396.442) * (-3388.798) (-3389.765) (-3386.154) [-3383.979] -- 0:04:49 219000 -- (-3390.709) (-3390.305) [-3382.632] (-3390.373) * (-3385.561) [-3383.669] (-3387.174) (-3384.935) -- 0:04:48 219500 -- (-3391.967) (-3393.968) [-3384.865] (-3389.334) * (-3391.836) (-3399.843) (-3389.917) [-3390.042] -- 0:04:51 220000 -- (-3398.578) (-3396.402) (-3396.018) [-3388.113] * (-3383.698) (-3388.467) [-3387.801] (-3393.052) -- 0:04:50 Average standard deviation of split frequencies: 0.000000 220500 -- (-3391.826) [-3386.347] (-3397.471) (-3390.664) * [-3383.227] (-3385.518) (-3383.631) (-3395.859) -- 0:04:49 221000 -- [-3385.138] (-3390.347) (-3394.186) (-3385.318) * (-3394.466) (-3384.400) (-3387.473) [-3388.635] -- 0:04:49 221500 -- (-3388.302) (-3384.202) (-3391.415) [-3384.396] * (-3388.323) (-3388.962) [-3389.048] (-3383.413) -- 0:04:48 222000 -- (-3385.064) (-3385.738) [-3389.217] (-3383.673) * (-3383.907) (-3383.454) (-3393.615) [-3379.098] -- 0:04:50 222500 -- (-3388.208) [-3388.639] (-3394.288) (-3386.043) * (-3386.170) (-3388.788) [-3385.132] (-3382.988) -- 0:04:50 223000 -- (-3403.707) (-3390.795) [-3384.510] (-3388.581) * [-3383.666] (-3393.701) (-3393.080) (-3395.019) -- 0:04:49 223500 -- (-3388.864) [-3385.995] (-3387.109) (-3384.981) * [-3382.109] (-3393.945) (-3387.028) (-3395.391) -- 0:04:48 224000 -- (-3386.122) (-3391.797) (-3388.564) [-3390.935] * (-3390.898) [-3388.352] (-3388.598) (-3388.341) -- 0:04:47 224500 -- (-3388.758) [-3393.200] (-3387.850) (-3398.857) * (-3385.669) (-3385.592) [-3389.167] (-3385.081) -- 0:04:50 225000 -- (-3393.754) (-3393.873) (-3391.642) [-3385.728] * (-3388.527) (-3389.804) [-3386.552] (-3389.102) -- 0:04:49 Average standard deviation of split frequencies: 0.000000 225500 -- [-3396.990] (-3393.788) (-3400.568) (-3389.698) * (-3388.158) [-3390.369] (-3386.191) (-3400.152) -- 0:04:48 226000 -- (-3388.936) (-3387.241) (-3391.252) [-3385.771] * [-3386.176] (-3384.826) (-3387.133) (-3389.332) -- 0:04:47 226500 -- [-3388.528] (-3389.710) (-3384.263) (-3386.779) * [-3383.258] (-3385.967) (-3385.784) (-3379.292) -- 0:04:46 227000 -- (-3392.127) [-3387.576] (-3387.330) (-3387.190) * (-3387.614) [-3388.227] (-3385.908) (-3392.282) -- 0:04:46 227500 -- [-3383.871] (-3394.686) (-3388.930) (-3388.693) * [-3388.990] (-3399.679) (-3385.437) (-3385.798) -- 0:04:48 228000 -- (-3386.506) (-3388.426) [-3385.373] (-3387.926) * [-3381.108] (-3387.440) (-3390.889) (-3388.628) -- 0:04:47 228500 -- [-3382.214] (-3397.056) (-3387.355) (-3398.595) * (-3383.461) [-3382.690] (-3394.003) (-3388.931) -- 0:04:46 229000 -- (-3386.621) (-3394.175) (-3393.441) [-3379.574] * (-3383.677) (-3383.079) (-3390.801) [-3383.329] -- 0:04:46 229500 -- [-3386.795] (-3389.574) (-3397.768) (-3384.842) * (-3392.455) [-3384.606] (-3386.027) (-3387.264) -- 0:04:45 230000 -- (-3389.757) (-3387.638) [-3383.325] (-3383.526) * [-3380.706] (-3385.313) (-3385.511) (-3388.141) -- 0:04:47 Average standard deviation of split frequencies: 0.000000 230500 -- (-3385.165) [-3399.491] (-3386.436) (-3387.583) * (-3392.250) [-3393.756] (-3390.422) (-3385.694) -- 0:04:47 231000 -- (-3395.382) [-3383.785] (-3379.223) (-3387.823) * (-3384.359) [-3393.288] (-3392.112) (-3386.638) -- 0:04:46 231500 -- (-3381.550) (-3390.672) [-3394.357] (-3384.874) * [-3387.777] (-3391.098) (-3385.756) (-3382.389) -- 0:04:45 232000 -- (-3397.205) [-3383.922] (-3384.227) (-3389.722) * (-3388.076) (-3382.253) (-3383.782) [-3393.852] -- 0:04:44 232500 -- (-3389.429) [-3386.727] (-3388.085) (-3392.073) * [-3388.243] (-3383.824) (-3386.334) (-3397.228) -- 0:04:47 233000 -- [-3385.601] (-3384.683) (-3391.808) (-3386.358) * (-3381.858) [-3383.615] (-3387.683) (-3388.070) -- 0:04:46 233500 -- [-3391.392] (-3393.367) (-3385.643) (-3395.479) * (-3385.184) (-3378.839) [-3390.625] (-3391.676) -- 0:04:45 234000 -- (-3392.674) (-3388.898) [-3383.953] (-3380.653) * (-3386.517) (-3384.856) [-3389.671] (-3387.005) -- 0:04:44 234500 -- (-3391.437) (-3388.500) (-3385.789) [-3383.761] * (-3391.623) (-3392.822) [-3391.598] (-3382.523) -- 0:04:44 235000 -- (-3396.435) (-3388.333) [-3392.348] (-3388.338) * (-3381.724) (-3384.816) (-3385.252) [-3385.524] -- 0:04:43 Average standard deviation of split frequencies: 0.000000 235500 -- [-3384.081] (-3393.864) (-3396.318) (-3382.827) * (-3394.102) (-3388.656) (-3391.542) [-3380.290] -- 0:04:45 236000 -- (-3394.866) (-3386.467) (-3380.598) [-3390.372] * (-3393.182) [-3385.077] (-3382.885) (-3399.527) -- 0:04:44 236500 -- (-3388.756) (-3385.014) (-3396.375) [-3389.017] * (-3383.203) (-3385.841) (-3389.530) [-3382.958] -- 0:04:44 237000 -- (-3388.804) [-3388.460] (-3388.838) (-3397.595) * (-3387.312) (-3389.303) (-3389.799) [-3389.426] -- 0:04:43 237500 -- (-3382.710) (-3383.751) [-3386.448] (-3390.928) * (-3393.374) (-3392.485) (-3393.725) [-3386.986] -- 0:04:42 238000 -- [-3385.152] (-3394.902) (-3386.450) (-3389.125) * (-3389.030) (-3385.196) (-3385.744) [-3385.254] -- 0:04:44 238500 -- (-3384.700) (-3384.651) [-3384.904] (-3388.789) * (-3395.735) (-3392.596) [-3388.003] (-3388.354) -- 0:04:44 239000 -- (-3393.017) (-3386.228) [-3381.226] (-3397.601) * (-3396.877) (-3380.603) (-3397.854) [-3392.673] -- 0:04:43 239500 -- (-3388.847) [-3385.054] (-3392.231) (-3385.080) * (-3390.951) (-3393.977) (-3397.112) [-3384.579] -- 0:04:42 240000 -- [-3391.077] (-3388.417) (-3407.180) (-3388.040) * (-3388.159) (-3391.681) (-3386.937) [-3384.878] -- 0:04:41 Average standard deviation of split frequencies: 0.000000 240500 -- [-3386.866] (-3386.844) (-3387.461) (-3384.726) * (-3390.250) [-3385.895] (-3386.921) (-3387.951) -- 0:04:44 241000 -- (-3382.404) (-3390.720) (-3388.210) [-3391.243] * [-3388.619] (-3393.654) (-3399.840) (-3384.898) -- 0:04:43 241500 -- [-3384.423] (-3388.728) (-3382.431) (-3381.915) * (-3391.428) [-3386.084] (-3388.106) (-3389.003) -- 0:04:42 242000 -- (-3388.299) (-3397.414) [-3385.064] (-3393.517) * (-3387.849) (-3392.115) (-3391.804) [-3392.866] -- 0:04:41 242500 -- [-3383.057] (-3387.157) (-3394.921) (-3390.223) * (-3392.843) [-3388.122] (-3387.361) (-3386.449) -- 0:04:41 243000 -- (-3388.976) (-3390.664) (-3382.712) [-3389.456] * (-3390.320) (-3387.758) [-3389.665] (-3388.473) -- 0:04:40 243500 -- [-3389.742] (-3398.629) (-3389.348) (-3386.299) * (-3385.437) [-3387.468] (-3383.605) (-3392.744) -- 0:04:42 244000 -- [-3386.866] (-3387.047) (-3385.069) (-3392.106) * [-3383.006] (-3393.090) (-3386.547) (-3389.668) -- 0:04:41 244500 -- (-3390.747) [-3383.337] (-3389.003) (-3386.832) * (-3380.240) (-3380.934) (-3395.352) [-3385.747] -- 0:04:41 245000 -- (-3390.537) (-3389.311) [-3389.015] (-3391.395) * (-3383.699) [-3384.151] (-3385.832) (-3393.984) -- 0:04:40 Average standard deviation of split frequencies: 0.000000 245500 -- [-3388.058] (-3387.842) (-3384.562) (-3385.633) * [-3388.475] (-3393.371) (-3385.969) (-3389.544) -- 0:04:39 246000 -- [-3388.298] (-3397.902) (-3385.653) (-3384.402) * (-3389.550) (-3382.516) (-3387.392) [-3386.035] -- 0:04:41 246500 -- (-3395.086) (-3383.302) (-3389.589) [-3386.225] * [-3387.059] (-3384.373) (-3385.922) (-3386.595) -- 0:04:41 247000 -- (-3389.376) [-3387.399] (-3389.915) (-3387.474) * (-3384.881) (-3381.047) (-3386.648) [-3387.043] -- 0:04:40 247500 -- (-3388.118) (-3387.556) (-3391.221) [-3388.217] * (-3382.542) (-3384.634) (-3393.696) [-3389.717] -- 0:04:39 248000 -- (-3390.486) [-3385.792] (-3390.700) (-3386.587) * (-3391.262) (-3383.181) (-3391.410) [-3383.691] -- 0:04:38 248500 -- (-3387.047) (-3386.883) (-3387.777) [-3383.041] * (-3392.427) (-3396.398) [-3386.915] (-3387.283) -- 0:04:41 249000 -- (-3389.272) [-3384.327] (-3385.194) (-3385.107) * [-3388.869] (-3388.699) (-3395.490) (-3386.094) -- 0:04:40 249500 -- [-3384.996] (-3384.875) (-3383.080) (-3387.184) * [-3388.655] (-3380.749) (-3383.991) (-3386.741) -- 0:04:39 250000 -- (-3388.292) [-3385.321] (-3396.238) (-3384.961) * (-3385.614) [-3385.181] (-3391.832) (-3383.623) -- 0:04:39 Average standard deviation of split frequencies: 0.000000 250500 -- [-3384.297] (-3388.987) (-3386.254) (-3379.408) * (-3402.528) (-3385.746) [-3387.406] (-3388.084) -- 0:04:38 251000 -- (-3384.085) (-3383.954) (-3399.208) [-3384.083] * (-3389.876) (-3383.202) (-3387.362) [-3386.992] -- 0:04:37 251500 -- (-3388.803) [-3389.056] (-3388.278) (-3382.759) * (-3384.085) [-3381.308] (-3391.241) (-3392.120) -- 0:04:39 252000 -- (-3387.941) (-3389.488) [-3384.529] (-3389.643) * [-3386.895] (-3386.304) (-3386.048) (-3386.120) -- 0:04:39 252500 -- (-3386.418) (-3387.327) (-3394.544) [-3383.046] * (-3381.983) [-3385.621] (-3393.386) (-3393.491) -- 0:04:38 253000 -- (-3384.815) (-3392.167) (-3389.333) [-3384.920] * (-3386.085) (-3384.910) [-3389.898] (-3391.149) -- 0:04:37 253500 -- [-3383.992] (-3390.703) (-3384.406) (-3387.649) * (-3388.654) [-3383.151] (-3389.026) (-3386.717) -- 0:04:36 254000 -- (-3380.413) (-3386.074) (-3383.749) [-3386.951] * (-3395.011) (-3388.557) (-3389.247) [-3388.366] -- 0:04:39 254500 -- (-3387.926) (-3383.873) (-3392.299) [-3386.415] * (-3391.832) [-3386.564] (-3389.703) (-3383.183) -- 0:04:38 255000 -- [-3389.400] (-3398.040) (-3395.440) (-3392.699) * (-3391.818) (-3385.427) (-3391.657) [-3389.218] -- 0:04:37 Average standard deviation of split frequencies: 0.000000 255500 -- [-3383.733] (-3385.219) (-3387.533) (-3392.041) * [-3385.219] (-3390.600) (-3387.412) (-3383.821) -- 0:04:36 256000 -- (-3387.723) (-3389.350) [-3380.126] (-3388.330) * (-3387.107) (-3391.638) [-3386.210] (-3388.437) -- 0:04:36 256500 -- (-3389.526) (-3390.401) (-3388.033) [-3389.160] * [-3389.431] (-3385.841) (-3392.378) (-3389.722) -- 0:04:35 257000 -- [-3391.128] (-3387.363) (-3385.522) (-3392.706) * [-3386.510] (-3386.185) (-3389.836) (-3392.215) -- 0:04:37 257500 -- [-3387.367] (-3390.780) (-3387.891) (-3392.963) * (-3390.979) [-3384.201] (-3386.856) (-3391.713) -- 0:04:36 258000 -- (-3388.414) [-3387.449] (-3394.027) (-3393.740) * [-3392.954] (-3388.138) (-3386.996) (-3387.603) -- 0:04:36 258500 -- (-3397.695) (-3382.987) [-3386.253] (-3390.004) * (-3389.497) [-3394.028] (-3395.380) (-3389.940) -- 0:04:35 259000 -- (-3388.821) (-3389.875) [-3382.544] (-3385.522) * (-3388.762) (-3384.631) [-3388.228] (-3389.449) -- 0:04:34 259500 -- (-3388.634) (-3388.830) [-3381.649] (-3379.522) * (-3396.905) [-3389.350] (-3385.344) (-3392.962) -- 0:04:36 260000 -- (-3386.273) [-3385.475] (-3386.569) (-3386.153) * (-3393.324) (-3385.516) (-3382.934) [-3395.425] -- 0:04:36 Average standard deviation of split frequencies: 0.000000 260500 -- (-3385.452) (-3386.850) [-3384.210] (-3390.697) * (-3388.175) (-3394.648) [-3390.710] (-3391.227) -- 0:04:35 261000 -- [-3385.256] (-3382.427) (-3385.637) (-3382.237) * (-3390.003) (-3392.789) (-3381.715) [-3387.083] -- 0:04:34 261500 -- (-3389.052) (-3388.432) (-3390.177) [-3382.777] * (-3388.351) (-3393.028) [-3387.355] (-3396.480) -- 0:04:33 262000 -- (-3390.695) [-3387.124] (-3385.156) (-3387.305) * [-3386.684] (-3396.538) (-3386.758) (-3387.125) -- 0:04:36 262500 -- (-3393.220) (-3385.731) [-3386.858] (-3389.229) * (-3394.191) [-3388.677] (-3386.096) (-3380.235) -- 0:04:35 263000 -- (-3386.883) (-3388.892) (-3384.907) [-3389.439] * (-3395.380) (-3392.426) (-3390.009) [-3382.750] -- 0:04:34 263500 -- (-3385.739) (-3393.705) [-3390.408] (-3391.539) * (-3390.994) (-3389.050) (-3395.245) [-3385.280] -- 0:04:33 264000 -- (-3385.043) [-3391.328] (-3390.717) (-3393.422) * (-3395.047) [-3386.465] (-3392.039) (-3379.680) -- 0:04:33 264500 -- (-3389.375) (-3398.430) [-3384.591] (-3382.016) * (-3388.078) [-3384.743] (-3391.388) (-3388.203) -- 0:04:32 265000 -- (-3385.984) (-3394.555) (-3389.184) [-3387.821] * (-3399.265) [-3387.669] (-3389.581) (-3394.049) -- 0:04:34 Average standard deviation of split frequencies: 0.000000 265500 -- (-3393.871) [-3383.423] (-3384.823) (-3389.593) * (-3388.743) (-3383.530) (-3391.253) [-3390.130] -- 0:04:33 266000 -- (-3391.191) [-3384.056] (-3390.446) (-3386.487) * (-3386.266) (-3386.616) (-3393.736) [-3390.739] -- 0:04:33 266500 -- (-3382.728) [-3390.308] (-3389.247) (-3385.004) * (-3400.770) (-3389.337) [-3386.380] (-3381.866) -- 0:04:32 267000 -- (-3390.777) (-3389.428) [-3385.503] (-3388.861) * (-3383.662) (-3385.732) (-3389.980) [-3394.814] -- 0:04:34 267500 -- (-3391.215) (-3391.421) (-3394.003) [-3396.828] * (-3384.882) (-3400.588) [-3384.086] (-3391.642) -- 0:04:33 268000 -- [-3382.336] (-3392.800) (-3382.705) (-3390.497) * (-3388.385) (-3388.190) [-3382.028] (-3391.513) -- 0:04:33 268500 -- (-3385.374) (-3393.186) [-3391.730] (-3396.275) * (-3384.700) (-3384.045) (-3390.067) [-3391.570] -- 0:04:32 269000 -- (-3386.796) [-3390.991] (-3395.184) (-3391.339) * (-3386.017) (-3390.094) (-3387.452) [-3388.204] -- 0:04:31 269500 -- (-3389.073) (-3393.248) (-3397.211) [-3392.592] * [-3391.128] (-3391.733) (-3384.367) (-3382.397) -- 0:04:33 270000 -- (-3388.381) [-3384.007] (-3387.962) (-3398.108) * (-3385.033) [-3387.593] (-3385.593) (-3389.133) -- 0:04:33 Average standard deviation of split frequencies: 0.000000 270500 -- (-3388.908) (-3386.675) (-3403.402) [-3384.619] * [-3396.585] (-3388.437) (-3387.200) (-3391.444) -- 0:04:32 271000 -- [-3385.361] (-3384.715) (-3395.308) (-3383.772) * [-3381.073] (-3388.757) (-3390.569) (-3381.378) -- 0:04:31 271500 -- (-3388.390) (-3386.180) (-3393.936) [-3381.970] * [-3385.319] (-3391.476) (-3398.947) (-3391.235) -- 0:04:31 272000 -- [-3387.367] (-3398.129) (-3392.482) (-3384.307) * (-3387.445) (-3389.993) (-3391.417) [-3385.692] -- 0:04:30 272500 -- (-3389.135) (-3392.903) (-3388.790) [-3383.315] * (-3385.795) (-3394.719) [-3390.337] (-3388.623) -- 0:04:32 273000 -- [-3380.275] (-3395.609) (-3390.014) (-3386.778) * (-3390.355) (-3395.214) (-3401.181) [-3389.075] -- 0:04:31 273500 -- (-3383.482) (-3386.719) (-3391.234) [-3387.985] * (-3383.510) (-3383.679) (-3384.912) [-3386.104] -- 0:04:30 274000 -- (-3384.302) (-3381.952) [-3384.639] (-3382.209) * [-3385.307] (-3392.233) (-3381.045) (-3387.402) -- 0:04:30 274500 -- (-3387.882) (-3386.980) [-3385.198] (-3384.763) * (-3385.901) (-3384.811) [-3384.856] (-3386.011) -- 0:04:29 275000 -- (-3386.266) (-3387.682) [-3383.605] (-3392.089) * [-3381.781] (-3388.751) (-3386.003) (-3385.489) -- 0:04:31 Average standard deviation of split frequencies: 0.000000 275500 -- (-3386.813) [-3384.826] (-3384.312) (-3382.121) * [-3388.778] (-3388.560) (-3388.928) (-3392.558) -- 0:04:30 276000 -- (-3389.428) [-3385.599] (-3394.605) (-3398.517) * [-3384.150] (-3388.621) (-3389.990) (-3392.096) -- 0:04:30 276500 -- (-3385.466) (-3382.302) (-3392.270) [-3388.247] * (-3391.213) (-3386.904) (-3388.177) [-3382.923] -- 0:04:29 277000 -- (-3385.113) (-3394.495) (-3391.951) [-3389.470] * (-3387.705) (-3387.943) (-3385.518) [-3387.468] -- 0:04:28 277500 -- (-3386.340) (-3388.731) (-3385.690) [-3389.685] * (-3388.296) (-3386.114) [-3384.166] (-3388.721) -- 0:04:30 278000 -- [-3390.032] (-3392.603) (-3384.783) (-3394.075) * [-3385.121] (-3385.423) (-3391.675) (-3387.362) -- 0:04:30 278500 -- (-3393.793) (-3384.344) [-3385.213] (-3389.829) * (-3391.481) [-3386.709] (-3390.027) (-3391.368) -- 0:04:29 279000 -- (-3391.235) [-3385.003] (-3386.265) (-3384.052) * [-3385.573] (-3384.785) (-3394.133) (-3386.724) -- 0:04:28 279500 -- (-3384.273) (-3388.070) (-3386.595) [-3385.730] * (-3389.268) [-3390.747] (-3384.690) (-3383.919) -- 0:04:28 280000 -- (-3393.724) (-3382.073) (-3389.128) [-3386.529] * (-3395.978) (-3393.904) (-3392.727) [-3387.413] -- 0:04:27 Average standard deviation of split frequencies: 0.000000 280500 -- (-3382.008) (-3390.034) [-3394.167] (-3392.289) * (-3396.781) [-3384.188] (-3381.722) (-3387.553) -- 0:04:29 281000 -- (-3390.544) (-3387.366) (-3391.195) [-3384.915] * (-3387.730) (-3386.635) [-3386.043] (-3396.102) -- 0:04:28 281500 -- (-3404.138) (-3400.375) (-3385.523) [-3385.817] * (-3387.618) (-3392.298) (-3385.138) [-3387.000] -- 0:04:28 282000 -- [-3392.997] (-3388.864) (-3388.453) (-3396.479) * (-3387.177) [-3380.252] (-3402.546) (-3390.619) -- 0:04:27 282500 -- [-3389.419] (-3391.342) (-3387.060) (-3382.317) * (-3391.202) [-3385.521] (-3390.641) (-3396.157) -- 0:04:26 283000 -- (-3393.136) (-3384.374) (-3382.394) [-3386.130] * (-3391.012) (-3385.299) [-3385.920] (-3393.516) -- 0:04:28 283500 -- (-3385.193) (-3392.301) [-3381.032] (-3393.524) * (-3393.546) (-3384.781) (-3383.193) [-3385.600] -- 0:04:27 284000 -- (-3391.756) [-3384.621] (-3387.049) (-3385.078) * (-3388.495) [-3385.768] (-3387.177) (-3386.975) -- 0:04:27 284500 -- (-3384.049) (-3385.931) [-3381.433] (-3387.055) * (-3389.698) (-3387.395) [-3382.597] (-3387.534) -- 0:04:26 285000 -- (-3383.115) [-3392.919] (-3391.014) (-3388.877) * (-3393.060) [-3386.708] (-3394.186) (-3389.431) -- 0:04:25 Average standard deviation of split frequencies: 0.000000 285500 -- (-3390.375) (-3385.323) (-3386.947) [-3391.127] * (-3393.248) [-3383.436] (-3385.437) (-3383.398) -- 0:04:25 286000 -- (-3390.900) [-3390.131] (-3388.907) (-3390.020) * (-3391.041) [-3386.625] (-3383.214) (-3391.439) -- 0:04:27 286500 -- [-3391.763] (-3389.960) (-3392.379) (-3384.947) * [-3390.435] (-3395.841) (-3393.628) (-3394.487) -- 0:04:26 287000 -- (-3381.966) [-3383.019] (-3391.250) (-3385.242) * [-3384.830] (-3392.885) (-3387.391) (-3388.192) -- 0:04:25 287500 -- (-3384.497) (-3391.636) [-3389.498] (-3387.185) * (-3391.286) [-3386.783] (-3393.710) (-3393.188) -- 0:04:25 288000 -- [-3386.189] (-3384.404) (-3394.955) (-3392.357) * (-3383.338) (-3388.271) [-3384.036] (-3391.040) -- 0:04:24 288500 -- (-3387.417) [-3389.370] (-3397.261) (-3397.130) * [-3385.709] (-3389.348) (-3390.827) (-3395.043) -- 0:04:26 289000 -- (-3389.459) (-3388.366) (-3387.536) [-3384.860] * (-3384.373) (-3395.521) [-3386.552] (-3393.004) -- 0:04:25 289500 -- (-3384.323) (-3386.758) (-3386.803) [-3382.656] * (-3384.018) [-3388.127] (-3386.633) (-3389.154) -- 0:04:25 290000 -- [-3383.393] (-3405.589) (-3394.181) (-3389.394) * [-3381.916] (-3391.399) (-3389.473) (-3389.127) -- 0:04:24 Average standard deviation of split frequencies: 0.000000 290500 -- (-3388.764) (-3391.223) [-3391.099] (-3391.679) * (-3384.804) (-3386.389) (-3382.471) [-3385.233] -- 0:04:23 291000 -- (-3386.084) [-3383.331] (-3391.778) (-3391.886) * (-3388.932) [-3382.613] (-3384.381) (-3388.984) -- 0:04:25 291500 -- (-3385.241) (-3382.649) [-3389.029] (-3393.675) * [-3386.036] (-3388.365) (-3387.594) (-3395.931) -- 0:04:24 292000 -- (-3382.935) (-3392.302) (-3388.791) [-3386.956] * (-3397.435) (-3386.702) (-3394.980) [-3395.853] -- 0:04:24 292500 -- [-3387.105] (-3386.261) (-3394.748) (-3388.615) * (-3390.795) (-3385.418) (-3386.460) [-3394.144] -- 0:04:26 293000 -- (-3383.372) [-3384.045] (-3399.935) (-3390.231) * (-3382.760) [-3388.770] (-3396.587) (-3397.370) -- 0:04:25 293500 -- (-3386.496) (-3385.709) (-3397.905) [-3390.256] * (-3393.083) (-3382.938) [-3386.115] (-3389.950) -- 0:04:24 294000 -- [-3385.869] (-3394.350) (-3391.464) (-3389.728) * (-3381.726) [-3392.705] (-3390.717) (-3392.723) -- 0:04:24 294500 -- (-3384.549) [-3388.493] (-3391.022) (-3393.891) * (-3390.476) [-3380.591] (-3388.779) (-3384.304) -- 0:04:25 295000 -- (-3389.823) (-3389.901) (-3383.281) [-3389.997] * (-3388.697) [-3387.894] (-3392.765) (-3394.969) -- 0:04:25 Average standard deviation of split frequencies: 0.000000 295500 -- (-3384.986) (-3387.841) [-3387.296] (-3389.660) * (-3400.372) (-3386.674) [-3388.216] (-3387.747) -- 0:04:24 296000 -- (-3389.228) (-3385.755) (-3386.941) [-3386.549] * (-3397.880) (-3382.358) (-3385.662) [-3385.707] -- 0:04:24 296500 -- (-3384.902) [-3384.415] (-3388.590) (-3384.069) * (-3385.715) [-3384.216] (-3391.513) (-3383.042) -- 0:04:23 297000 -- (-3387.789) (-3388.943) (-3393.245) [-3385.859] * [-3388.307] (-3393.056) (-3387.171) (-3384.209) -- 0:04:22 297500 -- (-3388.004) [-3392.382] (-3384.165) (-3386.884) * (-3393.703) [-3385.516] (-3389.203) (-3395.106) -- 0:04:24 298000 -- (-3390.798) (-3386.151) (-3391.040) [-3392.257] * (-3385.126) (-3391.960) (-3385.458) [-3385.756] -- 0:04:23 298500 -- (-3379.047) [-3389.499] (-3388.642) (-3390.505) * (-3397.208) (-3391.622) [-3384.050] (-3394.310) -- 0:04:23 299000 -- (-3385.280) (-3384.575) (-3387.271) [-3386.882] * (-3382.251) (-3393.390) [-3390.083] (-3395.145) -- 0:04:22 299500 -- (-3396.029) [-3383.523] (-3387.441) (-3393.337) * [-3384.079] (-3393.204) (-3399.337) (-3388.144) -- 0:04:21 300000 -- (-3389.488) (-3389.851) [-3385.570] (-3391.080) * (-3386.078) (-3386.578) [-3397.280] (-3396.615) -- 0:04:23 Average standard deviation of split frequencies: 0.000000 300500 -- (-3385.975) (-3387.343) (-3387.356) [-3384.781] * (-3387.327) [-3384.423] (-3387.839) (-3387.333) -- 0:04:23 301000 -- [-3387.056] (-3391.056) (-3391.157) (-3393.913) * (-3393.683) [-3389.967] (-3386.901) (-3392.847) -- 0:04:22 301500 -- (-3392.201) (-3389.414) (-3389.151) [-3382.621] * [-3388.943] (-3393.001) (-3388.942) (-3397.437) -- 0:04:21 302000 -- (-3398.902) [-3384.640] (-3386.929) (-3388.449) * (-3392.907) [-3390.747] (-3385.024) (-3387.433) -- 0:04:21 302500 -- (-3396.591) [-3386.331] (-3382.964) (-3391.668) * (-3388.490) (-3387.495) [-3384.354] (-3384.751) -- 0:04:20 303000 -- (-3392.991) (-3386.408) [-3390.638] (-3388.087) * (-3392.372) [-3385.921] (-3388.945) (-3386.009) -- 0:04:22 303500 -- (-3392.691) [-3388.627] (-3382.637) (-3395.349) * (-3389.889) (-3382.267) (-3393.095) [-3386.308] -- 0:04:21 304000 -- (-3387.489) (-3388.794) (-3384.722) [-3390.127] * (-3387.547) [-3385.329] (-3392.766) (-3393.679) -- 0:04:21 304500 -- [-3387.882] (-3390.070) (-3387.771) (-3384.938) * (-3389.512) [-3385.938] (-3394.021) (-3389.612) -- 0:04:20 305000 -- (-3386.153) (-3391.613) (-3389.139) [-3387.429] * (-3388.633) [-3386.236] (-3399.691) (-3394.824) -- 0:04:19 Average standard deviation of split frequencies: 0.000000 305500 -- [-3385.865] (-3383.321) (-3386.453) (-3386.929) * (-3388.700) (-3391.523) [-3388.123] (-3389.842) -- 0:04:21 306000 -- (-3381.653) (-3395.181) (-3387.879) [-3383.554] * (-3387.441) (-3390.728) (-3383.446) [-3384.734] -- 0:04:20 306500 -- (-3387.848) (-3392.484) [-3391.495] (-3386.939) * (-3384.081) [-3383.660] (-3390.696) (-3386.752) -- 0:04:20 307000 -- (-3392.059) (-3391.221) (-3385.603) [-3391.578] * (-3396.161) (-3386.946) (-3387.798) [-3387.415] -- 0:04:19 307500 -- (-3388.966) (-3400.258) [-3391.619] (-3392.290) * (-3385.278) (-3387.923) (-3392.339) [-3390.073] -- 0:04:18 308000 -- (-3385.950) (-3390.080) [-3383.136] (-3397.472) * (-3401.299) (-3384.834) (-3388.808) [-3389.869] -- 0:04:20 308500 -- (-3389.152) [-3393.509] (-3386.586) (-3386.004) * [-3387.392] (-3385.992) (-3387.081) (-3381.367) -- 0:04:20 309000 -- (-3394.318) (-3390.777) [-3388.955] (-3389.923) * (-3392.839) (-3391.159) (-3382.293) [-3386.913] -- 0:04:19 309500 -- (-3395.766) (-3391.820) [-3388.993] (-3390.052) * (-3394.881) (-3384.864) (-3394.253) [-3384.647] -- 0:04:18 310000 -- (-3394.108) [-3384.655] (-3387.552) (-3384.893) * (-3385.834) [-3385.734] (-3384.938) (-3386.252) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 310500 -- [-3384.700] (-3384.859) (-3390.308) (-3384.676) * (-3387.530) [-3390.068] (-3387.202) (-3396.546) -- 0:04:17 311000 -- (-3389.096) [-3390.529] (-3389.620) (-3390.370) * (-3389.458) [-3388.521] (-3384.596) (-3380.019) -- 0:04:19 311500 -- (-3389.681) (-3396.741) (-3386.862) [-3388.386] * (-3386.379) [-3384.729] (-3389.508) (-3384.607) -- 0:04:18 312000 -- [-3388.246] (-3386.363) (-3392.267) (-3388.599) * [-3384.765] (-3386.948) (-3394.521) (-3392.755) -- 0:04:18 312500 -- (-3392.122) (-3397.119) (-3383.415) [-3386.332] * (-3397.879) (-3388.015) (-3392.129) [-3393.429] -- 0:04:17 313000 -- (-3391.152) [-3387.343] (-3389.920) (-3390.874) * [-3391.199] (-3392.209) (-3388.263) (-3383.273) -- 0:04:16 313500 -- [-3387.379] (-3384.347) (-3389.484) (-3396.023) * (-3391.979) (-3387.064) (-3388.640) [-3384.657] -- 0:04:18 314000 -- (-3390.742) [-3390.097] (-3383.179) (-3391.777) * (-3392.598) (-3392.042) (-3389.805) [-3380.287] -- 0:04:17 314500 -- [-3388.556] (-3388.122) (-3395.715) (-3393.001) * (-3391.983) (-3388.254) (-3395.139) [-3393.183] -- 0:04:17 315000 -- (-3390.356) (-3391.262) (-3396.052) [-3386.426] * [-3393.400] (-3397.250) (-3387.667) (-3383.333) -- 0:04:16 Average standard deviation of split frequencies: 0.000000 315500 -- (-3381.949) (-3387.027) (-3393.303) [-3388.156] * (-3388.933) (-3384.512) (-3390.440) [-3387.859] -- 0:04:16 316000 -- [-3387.237] (-3395.328) (-3390.466) (-3388.090) * (-3388.903) (-3391.208) [-3390.863] (-3386.939) -- 0:04:15 316500 -- (-3390.005) (-3390.516) [-3382.198] (-3394.967) * (-3388.008) (-3387.445) [-3388.049] (-3384.470) -- 0:04:16 317000 -- (-3386.509) [-3382.099] (-3382.657) (-3392.236) * (-3386.771) [-3385.476] (-3381.848) (-3396.788) -- 0:04:16 317500 -- (-3391.063) (-3384.514) [-3388.383] (-3397.368) * (-3390.204) [-3386.165] (-3386.773) (-3389.389) -- 0:04:15 318000 -- (-3384.989) (-3384.316) (-3389.085) [-3389.430] * (-3395.316) [-3383.364] (-3388.211) (-3393.013) -- 0:04:15 318500 -- (-3383.550) (-3388.642) [-3385.443] (-3388.309) * (-3392.645) (-3389.732) (-3384.473) [-3392.614] -- 0:04:14 319000 -- (-3389.068) (-3385.005) (-3384.394) [-3390.940] * (-3384.043) (-3390.535) [-3389.561] (-3389.207) -- 0:04:16 319500 -- (-3394.460) (-3390.343) [-3384.236] (-3390.950) * (-3388.279) [-3384.926] (-3385.174) (-3386.152) -- 0:04:15 320000 -- [-3389.003] (-3385.098) (-3388.491) (-3388.306) * (-3392.246) (-3387.904) [-3382.936] (-3386.829) -- 0:04:15 Average standard deviation of split frequencies: 0.000000 320500 -- [-3390.755] (-3388.909) (-3388.208) (-3386.968) * (-3386.107) (-3391.365) (-3397.244) [-3386.687] -- 0:04:14 321000 -- (-3391.870) (-3393.640) [-3389.056] (-3380.991) * (-3383.458) (-3387.836) [-3387.890] (-3387.931) -- 0:04:13 321500 -- (-3387.315) (-3396.322) (-3388.435) [-3382.138] * (-3391.755) (-3387.053) (-3387.624) [-3387.341] -- 0:04:15 322000 -- (-3384.714) (-3391.734) [-3393.039] (-3383.738) * (-3387.553) [-3381.755] (-3385.827) (-3396.641) -- 0:04:14 322500 -- [-3386.477] (-3385.989) (-3387.770) (-3386.826) * (-3388.022) (-3387.795) (-3388.331) [-3387.010] -- 0:04:14 323000 -- (-3383.144) (-3385.017) (-3388.615) [-3381.506] * (-3391.000) [-3386.025] (-3387.216) (-3398.440) -- 0:04:13 323500 -- (-3384.717) (-3393.161) [-3389.109] (-3387.047) * [-3383.033] (-3389.375) (-3389.916) (-3391.299) -- 0:04:13 324000 -- [-3382.115] (-3384.817) (-3382.668) (-3388.022) * [-3385.470] (-3388.256) (-3391.530) (-3395.509) -- 0:04:12 324500 -- (-3383.697) (-3386.191) (-3398.711) [-3388.922] * [-3394.090] (-3388.039) (-3390.969) (-3390.064) -- 0:04:13 325000 -- [-3388.599] (-3381.323) (-3391.157) (-3384.825) * (-3391.147) (-3387.939) [-3388.846] (-3387.866) -- 0:04:13 Average standard deviation of split frequencies: 0.000000 325500 -- (-3393.426) (-3378.251) (-3399.512) [-3387.362] * (-3396.927) [-3386.257] (-3401.952) (-3389.803) -- 0:04:12 326000 -- (-3388.866) (-3382.032) (-3388.232) [-3385.587] * (-3382.453) (-3387.664) [-3394.746] (-3388.111) -- 0:04:12 326500 -- [-3389.544] (-3386.531) (-3384.970) (-3395.016) * (-3383.294) [-3384.777] (-3395.902) (-3388.013) -- 0:04:11 327000 -- (-3388.838) [-3387.356] (-3387.856) (-3400.417) * (-3390.775) [-3387.797] (-3394.288) (-3385.527) -- 0:04:13 327500 -- (-3391.187) (-3387.914) [-3383.384] (-3396.960) * [-3382.280] (-3380.154) (-3387.874) (-3399.411) -- 0:04:12 328000 -- (-3386.363) (-3384.461) [-3385.766] (-3386.344) * [-3396.384] (-3392.342) (-3387.319) (-3391.107) -- 0:04:12 328500 -- (-3385.038) [-3384.253] (-3387.541) (-3384.024) * (-3394.034) (-3385.708) [-3389.352] (-3383.044) -- 0:04:11 329000 -- [-3386.795] (-3388.264) (-3386.591) (-3388.992) * [-3393.949] (-3398.428) (-3388.647) (-3386.223) -- 0:04:10 329500 -- (-3392.282) [-3385.056] (-3385.931) (-3397.505) * (-3389.406) (-3399.557) (-3389.952) [-3384.371] -- 0:04:10 330000 -- (-3382.458) [-3383.406] (-3394.679) (-3393.380) * [-3388.251] (-3387.229) (-3389.523) (-3389.655) -- 0:04:11 Average standard deviation of split frequencies: 0.000000 330500 -- [-3376.399] (-3388.944) (-3392.966) (-3395.696) * (-3382.886) [-3384.273] (-3391.197) (-3389.784) -- 0:04:11 331000 -- (-3385.476) (-3388.906) [-3387.075] (-3387.867) * (-3390.573) [-3383.678] (-3390.808) (-3384.943) -- 0:04:10 331500 -- [-3383.831] (-3393.471) (-3386.456) (-3387.171) * (-3382.169) [-3382.973] (-3391.843) (-3390.514) -- 0:04:10 332000 -- (-3390.887) (-3387.676) (-3390.592) [-3392.003] * (-3384.691) [-3386.537] (-3390.246) (-3391.833) -- 0:04:09 332500 -- (-3392.877) [-3384.489] (-3388.196) (-3391.992) * (-3389.530) [-3386.017] (-3401.494) (-3384.765) -- 0:04:10 333000 -- (-3388.029) [-3388.000] (-3392.158) (-3396.338) * [-3380.211] (-3388.233) (-3384.481) (-3383.114) -- 0:04:10 333500 -- (-3388.829) [-3389.078] (-3384.946) (-3393.667) * (-3391.342) (-3389.708) (-3387.190) [-3383.261] -- 0:04:09 334000 -- (-3392.612) (-3385.485) [-3382.092] (-3382.537) * [-3393.962] (-3384.854) (-3387.106) (-3388.928) -- 0:04:09 334500 -- (-3390.856) (-3387.334) (-3385.179) [-3388.629] * (-3392.065) (-3387.284) [-3389.056] (-3386.356) -- 0:04:08 335000 -- (-3384.845) (-3384.948) (-3386.190) [-3384.106] * (-3394.126) (-3393.447) (-3385.816) [-3392.579] -- 0:04:08 Average standard deviation of split frequencies: 0.000000 335500 -- [-3386.884] (-3387.270) (-3391.433) (-3384.911) * (-3386.168) (-3385.261) [-3381.884] (-3385.480) -- 0:04:09 336000 -- (-3385.082) (-3392.018) [-3393.789] (-3396.511) * [-3386.290] (-3391.364) (-3391.360) (-3391.285) -- 0:04:09 336500 -- (-3386.949) [-3393.420] (-3386.131) (-3385.152) * (-3381.850) (-3385.033) [-3388.499] (-3389.914) -- 0:04:08 337000 -- (-3385.945) (-3384.921) [-3381.734] (-3391.143) * [-3393.105] (-3384.853) (-3388.277) (-3387.175) -- 0:04:07 337500 -- [-3386.046] (-3392.815) (-3383.701) (-3388.759) * (-3390.555) [-3387.094] (-3387.756) (-3391.155) -- 0:04:07 338000 -- (-3398.216) [-3385.463] (-3385.476) (-3389.325) * [-3387.920] (-3392.116) (-3383.386) (-3386.787) -- 0:04:08 338500 -- [-3385.838] (-3393.651) (-3383.188) (-3386.647) * [-3385.453] (-3388.819) (-3384.944) (-3385.192) -- 0:04:08 339000 -- (-3384.021) (-3385.099) (-3389.342) [-3383.670] * (-3387.434) (-3390.853) [-3391.367] (-3386.517) -- 0:04:07 339500 -- (-3391.724) (-3392.142) (-3388.425) [-3386.318] * (-3387.470) (-3395.824) (-3397.544) [-3380.530] -- 0:04:07 340000 -- [-3383.894] (-3394.897) (-3386.916) (-3386.339) * [-3383.049] (-3390.730) (-3384.552) (-3382.483) -- 0:04:06 Average standard deviation of split frequencies: 0.000000 340500 -- [-3391.215] (-3390.567) (-3382.639) (-3394.270) * [-3383.902] (-3390.352) (-3394.889) (-3384.861) -- 0:04:05 341000 -- (-3388.425) (-3394.620) [-3392.542] (-3387.809) * (-3396.795) (-3396.575) [-3390.394] (-3385.191) -- 0:04:07 341500 -- (-3390.457) (-3382.797) (-3394.113) [-3386.489] * (-3390.100) [-3387.936] (-3393.700) (-3382.069) -- 0:04:06 342000 -- (-3389.945) [-3383.738] (-3386.193) (-3389.216) * (-3390.603) (-3388.059) (-3391.458) [-3384.086] -- 0:04:06 342500 -- (-3391.949) (-3383.056) (-3390.190) [-3388.750] * (-3388.581) (-3387.528) [-3393.173] (-3394.906) -- 0:04:05 343000 -- (-3391.537) [-3385.403] (-3393.261) (-3390.927) * (-3396.650) [-3383.292] (-3398.437) (-3389.553) -- 0:04:05 343500 -- [-3388.495] (-3389.209) (-3388.984) (-3388.576) * [-3392.377] (-3391.264) (-3396.562) (-3387.469) -- 0:04:06 344000 -- (-3399.381) (-3395.086) (-3393.292) [-3387.331] * (-3389.307) [-3391.648] (-3405.372) (-3384.342) -- 0:04:06 344500 -- (-3386.792) (-3379.886) [-3387.079] (-3390.898) * [-3387.069] (-3397.835) (-3387.258) (-3391.983) -- 0:04:05 345000 -- (-3389.849) (-3386.649) (-3387.763) [-3386.765] * (-3387.486) (-3391.054) [-3393.757] (-3386.130) -- 0:04:04 Average standard deviation of split frequencies: 0.000000 345500 -- (-3391.753) [-3393.161] (-3392.042) (-3390.068) * (-3388.895) (-3395.927) (-3393.071) [-3389.425] -- 0:04:04 346000 -- (-3387.746) (-3384.471) (-3387.580) [-3387.760] * (-3387.025) (-3392.454) [-3384.312] (-3389.379) -- 0:04:05 346500 -- [-3381.930] (-3386.432) (-3388.039) (-3388.349) * (-3384.999) [-3389.229] (-3384.261) (-3389.469) -- 0:04:05 347000 -- (-3391.253) (-3388.958) [-3384.640] (-3390.022) * (-3384.656) (-3395.480) [-3391.947] (-3386.293) -- 0:04:04 347500 -- (-3391.869) [-3382.619] (-3387.699) (-3392.927) * [-3389.938] (-3390.819) (-3391.037) (-3385.830) -- 0:04:04 348000 -- (-3389.214) (-3384.307) [-3379.831] (-3391.630) * (-3387.078) [-3392.857] (-3395.563) (-3383.820) -- 0:04:03 348500 -- [-3379.432] (-3387.378) (-3384.909) (-3395.963) * (-3389.592) [-3387.890] (-3390.570) (-3381.157) -- 0:04:03 349000 -- (-3393.371) (-3383.348) [-3385.312] (-3398.857) * (-3387.131) (-3389.092) (-3384.546) [-3382.193] -- 0:04:04 349500 -- (-3386.950) [-3380.768] (-3393.066) (-3393.076) * (-3385.677) (-3382.214) [-3383.732] (-3389.687) -- 0:04:03 350000 -- (-3386.433) [-3385.205] (-3390.321) (-3384.317) * [-3385.155] (-3388.127) (-3390.332) (-3389.178) -- 0:04:03 Average standard deviation of split frequencies: 0.000000 350500 -- (-3381.752) (-3386.077) (-3386.381) [-3384.923] * (-3383.103) (-3397.305) [-3382.397] (-3400.871) -- 0:04:02 351000 -- (-3389.256) (-3391.474) (-3388.351) [-3388.031] * (-3389.854) [-3380.891] (-3387.360) (-3398.701) -- 0:04:02 351500 -- (-3386.131) (-3397.986) (-3388.696) [-3381.787] * [-3394.157] (-3385.170) (-3386.672) (-3397.490) -- 0:04:03 352000 -- (-3389.969) [-3396.354] (-3387.004) (-3382.599) * (-3394.208) [-3389.668] (-3383.390) (-3392.685) -- 0:04:03 352500 -- (-3388.989) [-3391.453] (-3391.053) (-3388.817) * (-3389.523) (-3390.214) (-3386.233) [-3388.739] -- 0:04:02 353000 -- [-3384.853] (-3391.161) (-3387.328) (-3392.488) * [-3383.360] (-3390.058) (-3385.412) (-3386.603) -- 0:04:01 353500 -- [-3385.767] (-3384.952) (-3385.993) (-3393.458) * (-3387.908) [-3386.817] (-3390.537) (-3394.062) -- 0:04:01 354000 -- (-3392.516) (-3390.627) [-3392.362] (-3387.238) * (-3389.676) [-3384.565] (-3390.811) (-3393.333) -- 0:04:00 354500 -- (-3379.022) [-3386.004] (-3393.454) (-3389.694) * (-3391.470) [-3382.249] (-3381.113) (-3384.164) -- 0:04:02 355000 -- (-3379.861) [-3389.066] (-3389.038) (-3395.226) * (-3393.333) (-3387.611) [-3388.689] (-3391.315) -- 0:04:01 Average standard deviation of split frequencies: 0.000000 355500 -- (-3390.015) (-3383.792) [-3378.632] (-3390.452) * (-3390.959) (-3396.560) (-3392.632) [-3387.130] -- 0:04:01 356000 -- (-3395.655) [-3389.089] (-3385.275) (-3391.092) * (-3384.654) [-3385.349] (-3387.320) (-3394.160) -- 0:04:00 356500 -- (-3397.843) [-3381.825] (-3385.172) (-3388.979) * (-3389.963) (-3384.787) [-3383.003] (-3386.188) -- 0:04:00 357000 -- (-3396.035) (-3387.092) (-3385.925) [-3389.119] * (-3383.035) [-3383.411] (-3398.591) (-3387.789) -- 0:04:01 357500 -- [-3390.105] (-3393.187) (-3400.867) (-3392.493) * [-3387.415] (-3393.791) (-3388.450) (-3397.492) -- 0:04:00 358000 -- (-3382.110) (-3393.798) (-3396.766) [-3384.235] * (-3391.829) (-3396.298) [-3386.164] (-3388.504) -- 0:04:00 358500 -- [-3387.411] (-3394.550) (-3391.100) (-3387.673) * (-3399.420) (-3394.956) [-3387.273] (-3389.708) -- 0:03:59 359000 -- (-3391.126) [-3387.661] (-3395.884) (-3392.234) * (-3396.789) [-3381.635] (-3388.802) (-3388.550) -- 0:03:59 359500 -- (-3390.966) (-3390.256) [-3385.712] (-3393.612) * (-3410.602) (-3386.388) (-3388.339) [-3384.278] -- 0:03:58 360000 -- (-3388.136) (-3390.616) [-3394.547] (-3394.261) * (-3396.622) (-3392.394) [-3384.700] (-3382.847) -- 0:04:00 Average standard deviation of split frequencies: 0.000000 360500 -- (-3385.262) [-3395.237] (-3388.248) (-3389.115) * (-3389.659) (-3382.790) [-3387.915] (-3386.168) -- 0:03:59 361000 -- [-3389.282] (-3398.978) (-3392.809) (-3387.783) * (-3391.150) (-3382.864) (-3384.645) [-3393.196] -- 0:03:58 361500 -- (-3387.936) (-3395.260) (-3387.057) [-3383.083] * (-3390.489) [-3387.307] (-3391.676) (-3384.147) -- 0:03:58 362000 -- (-3385.875) (-3390.300) [-3386.801] (-3390.693) * (-3400.050) (-3383.548) (-3390.933) [-3384.588] -- 0:03:57 362500 -- (-3389.690) (-3390.645) [-3385.585] (-3394.517) * (-3390.490) (-3387.430) [-3395.311] (-3383.377) -- 0:03:59 363000 -- (-3394.438) (-3391.363) [-3387.408] (-3381.956) * (-3383.301) (-3386.980) (-3387.308) [-3384.067] -- 0:03:58 363500 -- (-3386.235) [-3388.685] (-3384.450) (-3382.100) * [-3391.684] (-3386.934) (-3395.450) (-3388.207) -- 0:03:58 364000 -- (-3384.950) [-3387.342] (-3386.784) (-3390.631) * (-3391.131) [-3388.487] (-3387.459) (-3389.727) -- 0:03:57 364500 -- (-3390.272) (-3384.274) (-3381.575) [-3388.732] * (-3388.476) [-3387.677] (-3388.409) (-3386.674) -- 0:03:57 365000 -- (-3391.898) (-3400.053) [-3383.250] (-3383.979) * [-3387.393] (-3391.053) (-3397.113) (-3379.998) -- 0:03:58 Average standard deviation of split frequencies: 0.000000 365500 -- (-3387.944) [-3395.085] (-3389.634) (-3396.698) * [-3385.462] (-3385.731) (-3385.820) (-3385.277) -- 0:03:57 366000 -- (-3385.650) (-3392.172) [-3388.280] (-3393.485) * (-3388.315) (-3387.444) [-3391.407] (-3390.082) -- 0:03:57 366500 -- [-3380.443] (-3385.987) (-3387.233) (-3392.531) * (-3384.732) (-3386.244) (-3400.849) [-3381.692] -- 0:03:56 367000 -- (-3389.635) [-3382.206] (-3393.415) (-3390.464) * (-3383.394) (-3394.062) [-3386.873] (-3390.679) -- 0:03:56 367500 -- (-3388.107) (-3385.845) [-3385.444] (-3389.625) * [-3388.750] (-3393.915) (-3388.410) (-3386.548) -- 0:03:55 368000 -- (-3384.366) (-3386.395) [-3392.536] (-3384.859) * (-3396.798) [-3386.811] (-3384.529) (-3386.243) -- 0:03:57 368500 -- (-3390.100) [-3389.507] (-3392.595) (-3386.203) * (-3394.916) (-3394.823) (-3388.852) [-3384.059] -- 0:03:56 369000 -- (-3396.640) (-3389.568) (-3402.436) [-3391.815] * (-3395.022) (-3388.244) [-3387.833] (-3385.136) -- 0:03:55 369500 -- [-3390.904] (-3383.540) (-3391.439) (-3387.542) * (-3394.385) (-3388.808) [-3391.816] (-3389.336) -- 0:03:55 370000 -- (-3386.928) (-3392.094) [-3390.444] (-3384.035) * (-3393.776) (-3388.399) [-3383.579] (-3385.742) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 370500 -- (-3384.842) (-3389.733) (-3393.728) [-3380.120] * [-3385.162] (-3391.961) (-3383.120) (-3392.537) -- 0:03:56 371000 -- (-3383.619) [-3392.664] (-3398.949) (-3390.872) * [-3387.318] (-3389.138) (-3385.778) (-3389.656) -- 0:03:55 371500 -- (-3383.662) (-3385.132) [-3389.878] (-3387.352) * [-3390.374] (-3392.092) (-3384.410) (-3385.450) -- 0:03:55 372000 -- [-3386.891] (-3387.768) (-3398.218) (-3388.907) * [-3387.623] (-3389.447) (-3389.835) (-3387.981) -- 0:03:54 372500 -- (-3384.368) [-3387.301] (-3395.345) (-3384.555) * (-3383.309) (-3384.676) [-3381.649] (-3389.148) -- 0:03:54 373000 -- (-3385.929) (-3385.612) (-3392.358) [-3386.210] * (-3390.909) (-3383.094) (-3385.400) [-3391.518] -- 0:03:55 373500 -- (-3389.627) [-3386.186] (-3389.795) (-3390.182) * (-3396.720) (-3384.735) (-3381.666) [-3390.665] -- 0:03:54 374000 -- (-3390.058) [-3381.973] (-3387.131) (-3388.281) * (-3388.320) [-3385.805] (-3380.752) (-3388.605) -- 0:03:54 374500 -- (-3393.876) [-3387.812] (-3391.002) (-3390.755) * (-3389.114) [-3393.922] (-3396.086) (-3381.725) -- 0:03:53 375000 -- (-3387.127) [-3397.022] (-3390.693) (-3391.454) * (-3387.509) (-3387.506) [-3392.937] (-3388.846) -- 0:03:53 Average standard deviation of split frequencies: 0.000000 375500 -- [-3388.949] (-3395.184) (-3391.367) (-3398.725) * [-3385.018] (-3382.521) (-3387.059) (-3394.691) -- 0:03:52 376000 -- [-3385.196] (-3387.738) (-3386.330) (-3396.944) * (-3391.074) [-3388.472] (-3388.223) (-3391.030) -- 0:03:54 376500 -- (-3386.896) [-3383.075] (-3389.033) (-3389.489) * [-3383.595] (-3390.264) (-3385.473) (-3388.295) -- 0:03:53 377000 -- [-3385.212] (-3391.266) (-3389.512) (-3403.383) * [-3386.530] (-3388.762) (-3383.560) (-3388.828) -- 0:03:53 377500 -- [-3386.222] (-3384.517) (-3393.055) (-3394.547) * (-3391.640) (-3379.409) [-3385.739] (-3382.798) -- 0:03:52 378000 -- [-3383.367] (-3391.737) (-3389.731) (-3385.542) * [-3390.668] (-3388.412) (-3390.263) (-3385.152) -- 0:03:52 378500 -- (-3388.805) [-3383.652] (-3391.818) (-3389.989) * [-3392.233] (-3391.269) (-3393.975) (-3383.767) -- 0:03:53 379000 -- (-3385.966) (-3387.535) (-3388.698) [-3391.918] * (-3391.058) [-3390.977] (-3385.912) (-3394.392) -- 0:03:52 379500 -- [-3385.702] (-3400.481) (-3390.649) (-3382.589) * [-3383.521] (-3391.914) (-3390.390) (-3386.557) -- 0:03:52 380000 -- [-3383.973] (-3392.428) (-3385.243) (-3395.530) * (-3388.521) (-3384.027) (-3385.058) [-3390.403] -- 0:03:51 Average standard deviation of split frequencies: 0.000000 380500 -- [-3389.826] (-3388.984) (-3394.744) (-3394.563) * (-3386.308) [-3389.965] (-3388.533) (-3389.051) -- 0:03:51 381000 -- (-3390.803) (-3391.702) (-3387.620) [-3387.646] * [-3387.052] (-3396.466) (-3396.346) (-3378.620) -- 0:03:50 381500 -- (-3387.358) [-3389.727] (-3388.273) (-3387.138) * [-3384.073] (-3390.333) (-3387.953) (-3391.348) -- 0:03:51 382000 -- (-3388.725) (-3387.363) (-3382.842) [-3386.270] * (-3385.414) (-3386.787) (-3386.947) [-3384.352] -- 0:03:51 382500 -- (-3390.548) (-3389.249) [-3383.144] (-3388.800) * (-3384.188) [-3381.238] (-3382.871) (-3395.630) -- 0:03:50 383000 -- [-3388.146] (-3388.186) (-3392.445) (-3391.775) * (-3390.653) (-3382.923) [-3385.972] (-3388.296) -- 0:03:50 383500 -- (-3385.283) (-3388.477) (-3386.474) [-3388.788] * (-3386.760) (-3392.650) [-3382.995] (-3386.530) -- 0:03:49 384000 -- (-3388.996) [-3387.981] (-3387.509) (-3384.429) * (-3393.191) (-3402.198) [-3387.779] (-3397.766) -- 0:03:51 384500 -- (-3389.215) (-3389.193) (-3389.073) [-3386.052] * [-3381.997] (-3390.651) (-3393.692) (-3387.790) -- 0:03:50 385000 -- (-3385.467) [-3391.383] (-3389.995) (-3393.538) * [-3384.111] (-3388.111) (-3389.312) (-3387.409) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 385500 -- (-3398.523) (-3391.862) (-3388.900) [-3381.081] * (-3384.994) (-3390.714) (-3397.854) [-3387.112] -- 0:03:49 386000 -- (-3393.330) (-3386.022) [-3380.963] (-3385.578) * (-3385.576) (-3394.272) [-3390.160] (-3386.131) -- 0:03:49 386500 -- (-3387.681) (-3387.533) (-3384.060) [-3381.535] * (-3384.952) (-3390.724) [-3382.235] (-3387.417) -- 0:03:48 387000 -- (-3391.559) (-3385.105) [-3385.180] (-3390.587) * (-3387.888) (-3386.684) (-3387.058) [-3396.541] -- 0:03:49 387500 -- (-3388.638) (-3394.700) [-3394.812] (-3387.890) * (-3391.498) (-3386.044) [-3390.988] (-3391.197) -- 0:03:49 388000 -- (-3385.243) (-3392.911) [-3386.863] (-3389.302) * (-3386.001) [-3387.620] (-3386.356) (-3389.361) -- 0:03:48 388500 -- (-3383.939) (-3385.257) [-3387.774] (-3393.443) * (-3391.438) [-3382.169] (-3387.690) (-3384.600) -- 0:03:48 389000 -- (-3384.438) [-3382.672] (-3390.950) (-3393.581) * (-3390.083) (-3387.632) (-3380.921) [-3393.008] -- 0:03:47 389500 -- (-3382.198) [-3389.125] (-3392.050) (-3390.623) * (-3381.932) [-3385.522] (-3388.027) (-3398.565) -- 0:03:48 390000 -- (-3387.633) (-3387.484) (-3392.691) [-3383.077] * (-3384.227) (-3392.610) [-3384.649] (-3396.667) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 390500 -- (-3386.815) (-3403.260) [-3385.064] (-3388.767) * [-3385.258] (-3390.138) (-3383.825) (-3385.870) -- 0:03:47 391000 -- (-3385.013) [-3391.917] (-3386.765) (-3393.010) * [-3385.178] (-3402.399) (-3390.534) (-3399.424) -- 0:03:47 391500 -- [-3385.735] (-3389.478) (-3388.688) (-3389.697) * (-3387.134) [-3397.655] (-3386.104) (-3385.780) -- 0:03:46 392000 -- (-3383.881) [-3383.916] (-3389.616) (-3386.471) * (-3385.515) [-3390.574] (-3387.122) (-3395.812) -- 0:03:48 392500 -- (-3385.306) (-3385.730) (-3392.035) [-3387.314] * [-3387.931] (-3399.315) (-3384.460) (-3396.297) -- 0:03:47 393000 -- (-3383.574) (-3400.006) (-3387.852) [-3385.797] * (-3390.563) (-3383.623) [-3384.744] (-3387.600) -- 0:03:47 393500 -- [-3388.008] (-3393.533) (-3386.203) (-3388.701) * (-3388.169) [-3383.965] (-3391.648) (-3389.717) -- 0:03:46 394000 -- (-3385.949) (-3385.304) [-3385.043] (-3388.971) * (-3386.503) [-3391.072] (-3383.212) (-3382.376) -- 0:03:46 394500 -- (-3386.478) [-3384.443] (-3391.102) (-3388.235) * (-3389.694) (-3392.261) (-3392.021) [-3390.020] -- 0:03:45 395000 -- (-3384.885) [-3385.917] (-3386.854) (-3388.206) * (-3392.977) [-3389.849] (-3386.054) (-3387.155) -- 0:03:46 Average standard deviation of split frequencies: 0.000000 395500 -- [-3386.510] (-3393.420) (-3390.805) (-3393.822) * (-3386.329) (-3387.417) [-3380.900] (-3386.511) -- 0:03:46 396000 -- [-3392.502] (-3392.731) (-3389.017) (-3382.941) * (-3388.463) (-3391.781) (-3387.958) [-3386.884] -- 0:03:45 396500 -- (-3391.130) (-3392.249) (-3385.821) [-3385.279] * (-3387.505) [-3382.143] (-3385.851) (-3397.358) -- 0:03:45 397000 -- (-3389.523) (-3388.565) (-3388.322) [-3383.097] * (-3389.079) [-3383.973] (-3396.128) (-3382.045) -- 0:03:44 397500 -- (-3385.346) [-3391.051] (-3389.210) (-3386.520) * (-3385.635) [-3386.068] (-3382.997) (-3394.839) -- 0:03:45 398000 -- (-3386.763) (-3387.195) (-3382.907) [-3383.612] * (-3395.765) [-3382.541] (-3385.311) (-3382.949) -- 0:03:45 398500 -- (-3392.819) [-3383.004] (-3391.414) (-3383.798) * (-3388.792) (-3389.387) (-3384.103) [-3387.777] -- 0:03:44 399000 -- (-3390.282) (-3389.754) [-3386.776] (-3390.680) * (-3388.657) (-3391.519) [-3388.405] (-3381.643) -- 0:03:44 399500 -- (-3384.170) [-3389.135] (-3395.068) (-3384.558) * (-3385.967) (-3391.962) [-3394.626] (-3390.594) -- 0:03:43 400000 -- [-3386.884] (-3386.263) (-3402.449) (-3385.465) * (-3379.068) (-3383.200) [-3382.228] (-3390.688) -- 0:03:43 Average standard deviation of split frequencies: 0.000000 400500 -- (-3385.411) [-3385.848] (-3386.791) (-3382.894) * [-3386.564] (-3385.844) (-3393.574) (-3390.802) -- 0:03:44 401000 -- (-3383.954) (-3384.107) (-3386.587) [-3381.988] * (-3382.117) (-3389.544) [-3392.948] (-3393.318) -- 0:03:44 401500 -- (-3386.075) (-3388.072) (-3388.891) [-3383.253] * [-3383.795] (-3386.552) (-3386.616) (-3384.040) -- 0:03:43 402000 -- (-3387.242) [-3388.178] (-3385.818) (-3398.322) * (-3392.677) (-3385.839) (-3385.559) [-3383.551] -- 0:03:43 402500 -- (-3387.597) [-3384.525] (-3390.180) (-3381.214) * (-3396.904) (-3386.205) [-3386.556] (-3389.052) -- 0:03:42 403000 -- [-3389.010] (-3385.648) (-3390.523) (-3391.927) * (-3398.492) (-3400.445) (-3396.987) [-3392.043] -- 0:03:43 403500 -- (-3384.565) (-3392.776) [-3387.113] (-3385.510) * (-3390.059) (-3386.857) (-3386.209) [-3387.758] -- 0:03:43 404000 -- (-3393.710) [-3386.054] (-3390.008) (-3385.731) * (-3389.955) (-3385.558) (-3381.155) [-3392.205] -- 0:03:42 404500 -- (-3396.201) [-3390.785] (-3389.937) (-3387.603) * (-3386.932) (-3395.432) [-3385.431] (-3390.785) -- 0:03:42 405000 -- (-3388.177) [-3385.288] (-3386.404) (-3386.871) * (-3396.563) [-3379.302] (-3388.810) (-3387.751) -- 0:03:41 Average standard deviation of split frequencies: 0.000000 405500 -- [-3384.119] (-3393.664) (-3394.336) (-3389.643) * (-3401.274) (-3384.497) (-3392.826) [-3385.110] -- 0:03:42 406000 -- (-3387.570) [-3384.109] (-3388.486) (-3381.306) * (-3403.849) (-3389.114) (-3386.454) [-3385.848] -- 0:03:42 406500 -- [-3386.097] (-3387.968) (-3383.699) (-3389.427) * (-3391.941) (-3384.124) (-3384.249) [-3384.244] -- 0:03:41 407000 -- (-3383.316) (-3394.493) [-3385.907] (-3393.152) * (-3392.762) [-3383.504] (-3392.264) (-3390.048) -- 0:03:41 407500 -- (-3393.405) [-3388.403] (-3384.498) (-3387.331) * (-3395.681) (-3385.812) (-3388.167) [-3392.489] -- 0:03:41 408000 -- (-3397.083) (-3393.060) (-3381.592) [-3388.022] * (-3391.410) (-3392.223) (-3394.922) [-3387.040] -- 0:03:40 408500 -- [-3390.800] (-3391.692) (-3389.104) (-3387.441) * [-3393.664] (-3388.078) (-3388.902) (-3388.156) -- 0:03:41 409000 -- [-3388.471] (-3389.545) (-3385.815) (-3385.962) * (-3387.511) (-3387.965) (-3394.448) [-3387.439] -- 0:03:41 409500 -- (-3394.149) (-3384.219) [-3389.840] (-3391.563) * (-3385.697) [-3387.219] (-3385.902) (-3384.087) -- 0:03:40 410000 -- [-3388.836] (-3387.129) (-3389.073) (-3393.378) * (-3389.298) (-3390.098) (-3383.436) [-3385.311] -- 0:03:40 Average standard deviation of split frequencies: 0.000000 410500 -- [-3392.467] (-3387.839) (-3383.094) (-3394.326) * (-3389.756) (-3388.659) (-3390.979) [-3384.295] -- 0:03:39 411000 -- (-3387.347) (-3389.014) [-3386.634] (-3388.857) * (-3404.625) (-3384.920) (-3389.311) [-3380.904] -- 0:03:40 411500 -- [-3391.231] (-3393.495) (-3384.170) (-3394.307) * (-3395.217) (-3392.310) (-3391.898) [-3401.707] -- 0:03:40 412000 -- [-3386.942] (-3391.106) (-3387.052) (-3397.182) * (-3391.976) (-3384.697) [-3384.477] (-3387.197) -- 0:03:39 412500 -- (-3384.599) [-3386.370] (-3386.088) (-3390.378) * [-3390.498] (-3381.136) (-3388.723) (-3387.384) -- 0:03:39 413000 -- (-3385.772) (-3391.677) (-3384.099) [-3389.509] * (-3391.248) (-3399.340) (-3388.610) [-3387.046] -- 0:03:38 413500 -- [-3387.341] (-3390.090) (-3386.872) (-3385.441) * (-3387.935) (-3385.821) (-3389.359) [-3386.183] -- 0:03:38 414000 -- (-3379.942) (-3388.145) [-3381.406] (-3386.296) * (-3389.828) (-3382.686) (-3389.238) [-3382.727] -- 0:03:39 414500 -- (-3386.671) (-3386.110) [-3379.916] (-3388.249) * [-3381.989] (-3397.789) (-3391.240) (-3392.866) -- 0:03:38 415000 -- [-3389.220] (-3392.517) (-3398.659) (-3388.659) * (-3388.878) (-3392.198) [-3390.184] (-3384.830) -- 0:03:38 Average standard deviation of split frequencies: 0.000000 415500 -- [-3386.146] (-3385.370) (-3388.796) (-3384.072) * (-3387.771) [-3392.738] (-3394.029) (-3392.757) -- 0:03:38 416000 -- (-3388.073) (-3400.451) [-3384.926] (-3395.160) * [-3380.906] (-3385.878) (-3386.526) (-3387.876) -- 0:03:37 416500 -- [-3389.535] (-3385.924) (-3390.269) (-3384.241) * [-3384.538] (-3387.027) (-3399.810) (-3388.343) -- 0:03:38 417000 -- (-3390.428) (-3385.214) (-3385.903) [-3391.070] * (-3390.926) [-3384.644] (-3401.465) (-3391.491) -- 0:03:38 417500 -- (-3389.853) (-3395.468) [-3385.516] (-3385.853) * [-3386.113] (-3392.437) (-3388.132) (-3379.512) -- 0:03:37 418000 -- (-3387.740) (-3386.333) (-3381.058) [-3387.731] * (-3389.508) (-3386.734) [-3389.474] (-3388.580) -- 0:03:37 418500 -- (-3386.646) (-3392.256) (-3390.496) [-3385.268] * (-3391.475) (-3388.173) (-3387.068) [-3381.254] -- 0:03:36 419000 -- [-3385.912] (-3385.430) (-3390.254) (-3391.614) * (-3385.308) [-3385.091] (-3383.856) (-3384.904) -- 0:03:37 419500 -- (-3382.121) (-3381.028) [-3388.157] (-3392.244) * (-3391.371) [-3392.833] (-3389.884) (-3389.048) -- 0:03:37 420000 -- (-3386.015) [-3388.468] (-3387.237) (-3396.989) * (-3387.239) (-3390.793) [-3383.430] (-3388.721) -- 0:03:36 Average standard deviation of split frequencies: 0.000000 420500 -- (-3383.701) (-3389.886) (-3388.023) [-3389.681] * [-3379.978] (-3388.555) (-3391.419) (-3386.926) -- 0:03:36 421000 -- (-3385.818) (-3388.358) (-3393.956) [-3395.018] * (-3384.970) (-3394.306) (-3391.681) [-3389.113] -- 0:03:35 421500 -- (-3380.791) (-3387.081) [-3386.508] (-3392.255) * (-3385.312) (-3410.245) [-3386.328] (-3383.753) -- 0:03:35 422000 -- (-3387.698) [-3388.634] (-3383.763) (-3394.145) * [-3392.006] (-3387.459) (-3386.184) (-3391.587) -- 0:03:36 422500 -- [-3386.182] (-3392.490) (-3388.497) (-3390.635) * (-3391.839) (-3381.655) [-3390.788] (-3388.298) -- 0:03:35 423000 -- (-3384.835) [-3384.218] (-3396.064) (-3385.714) * (-3398.776) [-3383.237] (-3386.349) (-3399.077) -- 0:03:35 423500 -- (-3384.186) [-3392.852] (-3391.337) (-3388.892) * (-3387.967) (-3389.613) (-3379.883) [-3392.026] -- 0:03:35 424000 -- (-3389.008) (-3386.163) (-3399.878) [-3387.838] * [-3388.989] (-3397.532) (-3386.790) (-3387.310) -- 0:03:34 424500 -- (-3396.799) (-3386.807) [-3391.699] (-3379.879) * (-3386.286) [-3384.727] (-3395.684) (-3390.683) -- 0:03:35 425000 -- [-3385.608] (-3388.298) (-3388.857) (-3387.944) * [-3382.847] (-3390.179) (-3388.395) (-3389.447) -- 0:03:35 Average standard deviation of split frequencies: 0.000000 425500 -- (-3387.458) [-3388.812] (-3383.981) (-3390.316) * (-3383.801) [-3385.403] (-3389.763) (-3384.129) -- 0:03:34 426000 -- (-3388.905) [-3391.716] (-3391.957) (-3383.118) * (-3392.263) [-3385.886] (-3399.874) (-3390.161) -- 0:03:34 426500 -- (-3395.374) (-3385.509) (-3395.268) [-3385.771] * (-3383.518) (-3390.779) [-3387.136] (-3383.011) -- 0:03:33 427000 -- (-3394.904) (-3391.792) (-3394.906) [-3390.107] * (-3383.336) (-3392.157) [-3395.347] (-3389.927) -- 0:03:34 427500 -- (-3391.881) (-3389.572) (-3397.257) [-3386.231] * (-3387.467) [-3385.150] (-3390.520) (-3395.122) -- 0:03:34 428000 -- (-3391.560) (-3392.547) [-3389.188] (-3395.595) * (-3384.125) [-3389.909] (-3397.705) (-3391.297) -- 0:03:33 428500 -- (-3384.390) [-3385.032] (-3387.573) (-3389.183) * (-3386.456) (-3394.256) [-3398.888] (-3384.752) -- 0:03:33 429000 -- (-3388.861) (-3393.197) [-3383.858] (-3387.250) * (-3391.378) (-3394.951) (-3388.472) [-3387.578] -- 0:03:32 429500 -- (-3382.733) [-3386.857] (-3395.976) (-3386.619) * (-3394.197) (-3389.181) (-3388.925) [-3385.941] -- 0:03:32 430000 -- (-3390.186) (-3385.235) (-3389.951) [-3387.731] * (-3385.146) [-3386.060] (-3387.404) (-3385.065) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 430500 -- (-3384.971) (-3389.898) (-3385.505) [-3390.024] * [-3390.327] (-3389.882) (-3385.424) (-3384.337) -- 0:03:32 431000 -- (-3394.295) (-3388.030) [-3388.411] (-3385.954) * (-3385.084) (-3384.296) [-3381.156] (-3384.398) -- 0:03:32 431500 -- (-3389.690) (-3389.378) (-3387.356) [-3386.732] * (-3392.697) (-3388.138) (-3386.060) [-3386.958] -- 0:03:32 432000 -- (-3388.151) [-3390.020] (-3396.158) (-3386.169) * [-3384.512] (-3389.531) (-3400.965) (-3389.253) -- 0:03:31 432500 -- (-3393.424) (-3385.346) (-3386.919) [-3385.555] * (-3383.302) [-3387.283] (-3393.799) (-3385.082) -- 0:03:32 433000 -- (-3384.148) [-3384.130] (-3385.392) (-3394.576) * (-3386.247) [-3383.119] (-3388.364) (-3392.713) -- 0:03:32 433500 -- (-3391.142) [-3384.956] (-3387.146) (-3390.611) * (-3389.973) [-3384.942] (-3386.104) (-3388.243) -- 0:03:31 434000 -- (-3392.330) (-3388.460) [-3385.807] (-3392.657) * (-3388.230) [-3381.783] (-3385.000) (-3382.160) -- 0:03:31 434500 -- (-3384.511) [-3383.003] (-3387.378) (-3392.421) * (-3391.764) (-3390.390) (-3381.688) [-3387.815] -- 0:03:30 435000 -- [-3385.022] (-3386.748) (-3391.859) (-3390.430) * (-3391.387) (-3390.695) (-3392.258) [-3383.344] -- 0:03:30 Average standard deviation of split frequencies: 0.000000 435500 -- [-3387.379] (-3391.375) (-3387.448) (-3387.414) * [-3381.487] (-3400.075) (-3397.136) (-3384.906) -- 0:03:31 436000 -- (-3385.171) (-3390.996) (-3387.825) [-3388.087] * (-3387.870) (-3387.884) (-3386.593) [-3386.908] -- 0:03:30 436500 -- (-3384.754) (-3387.896) [-3391.605] (-3387.489) * (-3387.553) (-3390.687) (-3396.574) [-3383.242] -- 0:03:30 437000 -- (-3390.812) [-3386.137] (-3390.322) (-3391.414) * (-3388.994) (-3393.748) (-3383.185) [-3382.682] -- 0:03:29 437500 -- (-3386.863) (-3389.230) [-3388.839] (-3389.417) * (-3389.984) (-3385.475) (-3383.076) [-3393.027] -- 0:03:29 438000 -- (-3382.402) (-3385.011) (-3392.775) [-3396.513] * (-3389.367) (-3381.223) [-3389.421] (-3390.261) -- 0:03:30 438500 -- (-3389.372) [-3392.003] (-3394.086) (-3388.585) * (-3391.489) [-3387.735] (-3388.349) (-3394.400) -- 0:03:30 439000 -- [-3384.342] (-3393.332) (-3383.836) (-3391.849) * (-3399.474) (-3382.848) [-3386.018] (-3397.451) -- 0:03:29 439500 -- (-3386.667) (-3394.016) [-3387.975] (-3382.957) * (-3392.654) (-3384.142) [-3385.559] (-3391.785) -- 0:03:29 440000 -- (-3388.609) [-3382.634] (-3385.113) (-3388.565) * (-3399.114) (-3391.141) [-3384.871] (-3404.556) -- 0:03:28 Average standard deviation of split frequencies: 0.000267 440500 -- (-3387.209) (-3376.864) [-3389.547] (-3390.826) * (-3387.166) (-3388.404) (-3386.794) [-3393.206] -- 0:03:28 441000 -- (-3388.700) (-3386.302) (-3395.643) [-3385.827] * (-3389.358) (-3386.920) (-3390.829) [-3396.869] -- 0:03:29 441500 -- (-3397.635) [-3386.950] (-3397.891) (-3385.666) * [-3382.920] (-3391.601) (-3385.621) (-3394.943) -- 0:03:28 442000 -- (-3394.845) (-3387.885) [-3386.957] (-3392.063) * [-3386.609] (-3390.893) (-3390.549) (-3391.418) -- 0:03:28 442500 -- (-3394.167) [-3387.540] (-3387.215) (-3388.648) * [-3387.595] (-3389.010) (-3384.649) (-3389.705) -- 0:03:27 443000 -- (-3385.989) (-3391.278) [-3393.516] (-3390.991) * (-3398.799) (-3384.761) (-3385.190) [-3388.513] -- 0:03:27 443500 -- (-3398.526) [-3385.658] (-3384.534) (-3387.165) * (-3390.592) (-3385.261) [-3387.186] (-3403.298) -- 0:03:28 444000 -- [-3388.840] (-3389.623) (-3388.168) (-3396.576) * (-3387.092) [-3387.759] (-3381.305) (-3400.137) -- 0:03:27 444500 -- (-3386.791) (-3395.567) (-3392.274) [-3387.326] * (-3398.762) [-3383.397] (-3392.106) (-3384.638) -- 0:03:27 445000 -- (-3387.942) (-3387.531) (-3390.983) [-3387.433] * [-3383.316] (-3394.456) (-3394.930) (-3395.280) -- 0:03:27 Average standard deviation of split frequencies: 0.000264 445500 -- (-3389.478) (-3388.546) [-3390.974] (-3387.038) * (-3393.164) (-3391.083) [-3389.981] (-3385.111) -- 0:03:26 446000 -- (-3388.566) (-3391.609) (-3382.964) [-3385.979] * (-3398.408) (-3394.245) [-3391.460] (-3391.296) -- 0:03:26 446500 -- (-3388.322) (-3386.721) (-3390.051) [-3389.231] * (-3403.858) (-3389.827) (-3391.120) [-3389.338] -- 0:03:27 447000 -- (-3386.037) (-3386.653) (-3388.685) [-3385.632] * (-3394.049) [-3386.589] (-3391.110) (-3383.663) -- 0:03:26 447500 -- (-3390.715) [-3378.597] (-3390.448) (-3388.984) * (-3394.742) (-3385.558) [-3390.301] (-3395.739) -- 0:03:26 448000 -- (-3387.868) (-3386.241) [-3382.643] (-3383.962) * (-3388.133) (-3393.127) (-3393.493) [-3391.395] -- 0:03:25 448500 -- [-3382.152] (-3390.850) (-3391.359) (-3384.034) * [-3389.592] (-3388.154) (-3391.291) (-3394.962) -- 0:03:25 449000 -- (-3386.610) (-3386.900) (-3393.905) [-3384.657] * [-3389.151] (-3380.023) (-3387.040) (-3393.104) -- 0:03:26 449500 -- [-3384.056] (-3390.003) (-3399.999) (-3380.509) * [-3384.521] (-3388.356) (-3388.627) (-3388.912) -- 0:03:25 450000 -- (-3389.220) [-3384.869] (-3390.174) (-3387.597) * (-3383.117) (-3395.257) (-3388.059) [-3386.754] -- 0:03:25 Average standard deviation of split frequencies: 0.000262 450500 -- (-3387.789) (-3385.204) (-3392.361) [-3385.733] * [-3384.362] (-3396.770) (-3384.310) (-3391.405) -- 0:03:24 451000 -- (-3385.586) (-3388.507) (-3391.052) [-3390.842] * (-3389.848) (-3403.523) [-3393.785] (-3394.655) -- 0:03:24 451500 -- (-3394.955) (-3394.107) [-3388.497] (-3391.088) * [-3386.340] (-3384.600) (-3387.852) (-3382.179) -- 0:03:24 452000 -- (-3390.579) (-3384.361) (-3397.659) [-3384.836] * (-3392.145) (-3383.170) (-3390.357) [-3381.213] -- 0:03:24 452500 -- [-3385.549] (-3388.477) (-3387.104) (-3389.108) * [-3393.677] (-3382.469) (-3391.925) (-3390.666) -- 0:03:24 453000 -- (-3400.363) [-3384.642] (-3381.286) (-3395.148) * [-3397.266] (-3401.212) (-3387.247) (-3390.751) -- 0:03:24 453500 -- (-3399.537) (-3395.974) [-3390.207] (-3390.529) * (-3395.112) (-3383.989) [-3390.546] (-3388.159) -- 0:03:23 454000 -- (-3394.742) (-3387.984) [-3382.558] (-3388.386) * [-3382.594] (-3387.711) (-3397.779) (-3390.964) -- 0:03:23 454500 -- (-3393.581) [-3383.084] (-3398.203) (-3385.812) * [-3383.404] (-3381.227) (-3394.178) (-3395.455) -- 0:03:24 455000 -- [-3391.550] (-3389.255) (-3390.335) (-3393.484) * (-3391.004) (-3389.788) [-3391.398] (-3386.374) -- 0:03:23 Average standard deviation of split frequencies: 0.000517 455500 -- [-3383.250] (-3389.148) (-3390.907) (-3389.665) * (-3402.447) (-3385.302) (-3393.574) [-3385.292] -- 0:03:23 456000 -- [-3385.793] (-3381.290) (-3389.506) (-3395.167) * (-3390.915) (-3390.309) [-3393.096] (-3387.468) -- 0:03:22 456500 -- [-3378.389] (-3388.500) (-3387.035) (-3392.068) * [-3384.062] (-3391.470) (-3401.054) (-3393.830) -- 0:03:22 457000 -- (-3383.698) [-3387.846] (-3389.990) (-3390.419) * [-3383.256] (-3386.887) (-3397.604) (-3386.299) -- 0:03:21 457500 -- (-3385.182) [-3387.263] (-3393.643) (-3395.024) * (-3393.800) (-3387.344) [-3391.085] (-3385.013) -- 0:03:22 458000 -- (-3385.820) [-3382.322] (-3390.910) (-3387.693) * [-3392.346] (-3392.592) (-3387.261) (-3386.821) -- 0:03:22 458500 -- [-3388.012] (-3387.206) (-3397.290) (-3384.996) * (-3384.747) (-3387.348) [-3387.775] (-3385.198) -- 0:03:21 459000 -- [-3394.953] (-3388.137) (-3388.177) (-3396.328) * (-3386.725) (-3384.821) [-3389.020] (-3392.916) -- 0:03:21 459500 -- (-3387.534) (-3385.194) [-3380.077] (-3392.184) * (-3390.163) [-3383.952] (-3389.174) (-3392.036) -- 0:03:21 460000 -- (-3392.194) [-3387.003] (-3383.748) (-3390.682) * (-3396.178) (-3389.852) [-3388.503] (-3383.739) -- 0:03:21 Average standard deviation of split frequencies: 0.000512 460500 -- (-3387.106) (-3390.434) [-3390.873] (-3400.136) * (-3389.631) (-3382.840) (-3391.305) [-3385.570] -- 0:03:21 461000 -- (-3386.474) [-3389.679] (-3390.245) (-3390.304) * [-3384.558] (-3388.671) (-3386.995) (-3386.491) -- 0:03:21 461500 -- (-3393.389) [-3388.002] (-3385.762) (-3395.793) * (-3392.196) (-3390.685) [-3384.937] (-3386.699) -- 0:03:20 462000 -- (-3386.138) [-3385.036] (-3389.499) (-3384.902) * (-3385.035) [-3391.746] (-3390.847) (-3385.128) -- 0:03:20 462500 -- (-3388.750) (-3395.606) [-3390.283] (-3386.065) * (-3389.499) (-3386.924) (-3393.561) [-3388.084] -- 0:03:21 463000 -- (-3402.830) (-3395.656) (-3387.239) [-3387.218] * (-3394.996) (-3390.816) [-3389.376] (-3383.669) -- 0:03:20 463500 -- (-3390.650) (-3394.181) (-3386.086) [-3393.387] * (-3393.050) (-3388.931) (-3386.200) [-3383.117] -- 0:03:20 464000 -- (-3389.611) (-3391.762) (-3403.515) [-3390.852] * (-3391.890) (-3391.635) (-3389.303) [-3382.508] -- 0:03:19 464500 -- (-3385.377) (-3386.125) (-3390.470) [-3386.310] * [-3390.497] (-3385.247) (-3389.010) (-3392.142) -- 0:03:19 465000 -- (-3390.124) (-3392.138) [-3392.180] (-3390.815) * (-3395.349) (-3391.845) [-3389.212] (-3385.444) -- 0:03:19 Average standard deviation of split frequencies: 0.000506 465500 -- (-3389.096) [-3382.559] (-3393.276) (-3392.096) * (-3394.748) (-3386.537) (-3399.130) [-3388.168] -- 0:03:19 466000 -- (-3385.508) (-3385.215) (-3385.227) [-3385.576] * [-3388.669] (-3390.198) (-3385.873) (-3399.607) -- 0:03:19 466500 -- [-3386.051] (-3380.720) (-3390.872) (-3385.160) * (-3390.787) [-3390.724] (-3388.163) (-3384.254) -- 0:03:18 467000 -- [-3388.615] (-3381.291) (-3395.319) (-3388.709) * [-3383.758] (-3380.042) (-3382.596) (-3385.081) -- 0:03:18 467500 -- [-3383.713] (-3384.004) (-3389.696) (-3396.794) * (-3386.633) (-3380.546) (-3383.133) [-3382.091] -- 0:03:18 468000 -- [-3390.581] (-3391.738) (-3395.990) (-3388.915) * (-3390.122) (-3393.352) (-3387.097) [-3383.659] -- 0:03:18 468500 -- (-3379.249) [-3385.374] (-3392.148) (-3392.327) * (-3386.798) [-3390.704] (-3388.077) (-3387.321) -- 0:03:18 469000 -- [-3383.257] (-3387.350) (-3391.434) (-3387.874) * (-3392.034) (-3393.478) [-3384.665] (-3402.165) -- 0:03:18 469500 -- (-3383.841) (-3392.394) [-3387.866] (-3390.533) * [-3392.256] (-3392.521) (-3384.956) (-3385.986) -- 0:03:17 470000 -- (-3395.013) (-3394.277) [-3385.360] (-3393.315) * (-3396.407) (-3386.581) (-3385.157) [-3390.079] -- 0:03:17 Average standard deviation of split frequencies: 0.000501 470500 -- (-3393.221) (-3387.074) [-3384.307] (-3397.501) * [-3387.419] (-3387.809) (-3386.278) (-3400.202) -- 0:03:18 471000 -- (-3390.649) [-3394.976] (-3389.160) (-3388.665) * [-3381.295] (-3385.685) (-3387.442) (-3390.815) -- 0:03:17 471500 -- [-3384.564] (-3394.304) (-3385.163) (-3390.845) * [-3383.621] (-3381.519) (-3383.072) (-3393.011) -- 0:03:17 472000 -- (-3391.674) [-3392.086] (-3383.243) (-3396.321) * [-3385.476] (-3386.997) (-3384.632) (-3390.075) -- 0:03:16 472500 -- (-3389.729) (-3390.597) [-3393.535] (-3387.318) * [-3386.547] (-3386.194) (-3387.796) (-3386.875) -- 0:03:16 473000 -- (-3386.608) [-3384.945] (-3394.173) (-3388.971) * [-3388.020] (-3387.778) (-3387.371) (-3391.854) -- 0:03:16 473500 -- [-3385.201] (-3381.251) (-3388.181) (-3388.152) * (-3386.113) (-3393.454) [-3389.124] (-3389.706) -- 0:03:16 474000 -- [-3388.811] (-3394.633) (-3394.810) (-3386.264) * (-3392.227) [-3387.874] (-3386.608) (-3386.612) -- 0:03:16 474500 -- (-3388.950) (-3397.304) [-3395.608] (-3391.455) * (-3387.322) [-3385.833] (-3390.850) (-3388.960) -- 0:03:16 475000 -- (-3380.071) [-3386.045] (-3395.736) (-3391.794) * (-3385.927) (-3379.812) (-3386.310) [-3391.275] -- 0:03:15 Average standard deviation of split frequencies: 0.000495 475500 -- (-3390.866) (-3391.809) (-3384.449) [-3394.773] * (-3383.598) (-3388.597) (-3394.471) [-3386.485] -- 0:03:15 476000 -- (-3388.631) (-3394.552) (-3379.853) [-3391.325] * (-3386.175) (-3400.028) [-3388.459] (-3383.173) -- 0:03:15 476500 -- (-3387.999) (-3391.928) [-3387.215] (-3392.686) * (-3387.480) [-3387.318] (-3382.748) (-3387.791) -- 0:03:15 477000 -- (-3399.543) [-3389.906] (-3381.043) (-3395.368) * (-3390.085) (-3386.850) (-3389.045) [-3383.335] -- 0:03:15 477500 -- (-3382.102) (-3391.050) [-3380.367] (-3391.612) * [-3387.367] (-3388.449) (-3389.921) (-3388.579) -- 0:03:14 478000 -- (-3390.447) (-3386.846) (-3392.109) [-3389.071] * (-3383.878) [-3381.691] (-3386.538) (-3383.600) -- 0:03:14 478500 -- (-3387.312) (-3385.255) [-3386.632] (-3388.456) * (-3401.846) (-3387.075) (-3393.323) [-3385.755] -- 0:03:13 479000 -- (-3392.943) [-3380.931] (-3387.756) (-3389.668) * (-3389.318) (-3381.487) (-3389.808) [-3382.228] -- 0:03:14 479500 -- (-3383.973) (-3390.058) [-3383.682] (-3395.780) * (-3387.184) [-3385.325] (-3386.645) (-3388.095) -- 0:03:14 480000 -- [-3379.831] (-3384.869) (-3387.589) (-3401.772) * (-3394.764) [-3387.372] (-3397.835) (-3385.820) -- 0:03:13 Average standard deviation of split frequencies: 0.000490 480500 -- [-3383.094] (-3388.660) (-3393.185) (-3388.501) * (-3389.564) (-3395.279) [-3385.234] (-3381.402) -- 0:03:13 481000 -- (-3384.885) (-3383.290) (-3392.142) [-3382.697] * (-3392.015) [-3385.479] (-3387.962) (-3384.859) -- 0:03:13 481500 -- [-3386.214] (-3393.852) (-3391.259) (-3388.072) * (-3390.807) (-3393.772) [-3390.493] (-3386.519) -- 0:03:13 482000 -- (-3386.238) (-3392.709) [-3390.286] (-3392.976) * (-3391.469) [-3384.060] (-3387.703) (-3386.507) -- 0:03:13 482500 -- (-3386.645) (-3382.238) (-3383.443) [-3389.433] * [-3386.708] (-3389.785) (-3388.746) (-3389.458) -- 0:03:13 483000 -- (-3387.568) (-3393.046) [-3383.081] (-3393.924) * (-3390.276) (-3381.837) (-3388.648) [-3392.885] -- 0:03:12 483500 -- [-3395.678] (-3395.095) (-3382.518) (-3390.270) * (-3392.167) [-3385.344] (-3390.645) (-3388.879) -- 0:03:12 484000 -- (-3395.149) (-3390.961) (-3386.530) [-3386.941] * [-3382.116] (-3403.673) (-3385.340) (-3391.736) -- 0:03:11 484500 -- (-3387.285) (-3393.739) (-3387.817) [-3388.248] * (-3388.976) (-3394.628) [-3383.292] (-3387.826) -- 0:03:12 485000 -- (-3392.783) (-3394.418) [-3383.835] (-3384.779) * (-3388.722) (-3384.728) [-3385.706] (-3388.498) -- 0:03:12 Average standard deviation of split frequencies: 0.000485 485500 -- (-3386.624) (-3388.898) [-3385.707] (-3381.572) * (-3389.711) [-3386.528] (-3394.866) (-3392.208) -- 0:03:11 486000 -- (-3395.057) (-3385.482) (-3387.452) [-3393.561] * (-3386.730) (-3392.414) (-3390.849) [-3386.311] -- 0:03:11 486500 -- [-3399.831] (-3390.931) (-3389.374) (-3392.292) * (-3388.336) (-3388.328) [-3383.758] (-3387.864) -- 0:03:11 487000 -- (-3388.490) (-3384.883) (-3387.730) [-3393.527] * [-3386.338] (-3388.261) (-3385.963) (-3399.315) -- 0:03:11 487500 -- (-3388.057) (-3386.994) (-3394.775) [-3390.708] * [-3387.799] (-3394.150) (-3395.419) (-3386.425) -- 0:03:11 488000 -- (-3383.924) (-3394.454) [-3384.872] (-3391.711) * [-3385.943] (-3387.219) (-3395.415) (-3390.379) -- 0:03:10 488500 -- [-3390.844] (-3392.511) (-3385.272) (-3385.733) * [-3385.598] (-3388.051) (-3388.085) (-3394.110) -- 0:03:10 489000 -- (-3385.036) (-3385.980) [-3382.175] (-3393.416) * [-3389.544] (-3389.317) (-3396.362) (-3387.786) -- 0:03:10 489500 -- (-3389.645) (-3384.898) (-3396.432) [-3384.204] * (-3393.211) [-3391.986] (-3387.301) (-3389.177) -- 0:03:10 490000 -- (-3385.244) (-3390.666) [-3388.548] (-3390.370) * (-3387.276) [-3389.291] (-3388.327) (-3385.937) -- 0:03:10 Average standard deviation of split frequencies: 0.000480 490500 -- (-3388.496) [-3382.600] (-3389.881) (-3391.889) * (-3390.818) [-3391.882] (-3383.065) (-3388.694) -- 0:03:10 491000 -- (-3398.522) (-3389.475) [-3392.663] (-3393.103) * (-3385.614) (-3392.839) [-3387.112] (-3386.790) -- 0:03:09 491500 -- [-3389.431] (-3388.487) (-3388.836) (-3386.475) * (-3388.168) (-3397.149) [-3388.909] (-3388.089) -- 0:03:09 492000 -- (-3397.517) (-3383.646) (-3386.757) [-3385.929] * (-3389.755) [-3386.832] (-3384.504) (-3384.507) -- 0:03:08 492500 -- (-3382.714) [-3382.985] (-3391.561) (-3386.827) * (-3392.162) (-3390.049) (-3386.049) [-3387.717] -- 0:03:09 493000 -- [-3383.914] (-3389.029) (-3387.101) (-3391.469) * (-3390.427) (-3389.303) [-3382.622] (-3393.472) -- 0:03:09 493500 -- (-3388.924) (-3388.334) (-3389.194) [-3380.494] * (-3386.547) (-3399.094) (-3384.310) [-3383.589] -- 0:03:08 494000 -- (-3399.252) (-3383.154) [-3391.551] (-3383.263) * (-3391.745) (-3392.527) (-3388.354) [-3382.049] -- 0:03:08 494500 -- [-3388.064] (-3386.178) (-3389.523) (-3384.192) * (-3388.378) (-3385.596) (-3385.086) [-3388.585] -- 0:03:08 495000 -- (-3386.851) [-3386.965] (-3399.727) (-3382.311) * [-3391.556] (-3392.765) (-3382.550) (-3388.984) -- 0:03:08 Average standard deviation of split frequencies: 0.000475 495500 -- (-3386.832) (-3385.397) (-3391.369) [-3385.314] * (-3392.125) (-3382.447) (-3387.126) [-3387.576] -- 0:03:08 496000 -- [-3385.430] (-3390.902) (-3384.449) (-3391.160) * (-3395.630) (-3391.141) (-3385.302) [-3388.004] -- 0:03:07 496500 -- (-3381.941) (-3398.347) (-3388.157) [-3385.012] * (-3386.211) (-3392.995) (-3381.454) [-3382.297] -- 0:03:07 497000 -- (-3390.594) [-3381.128] (-3392.501) (-3387.364) * (-3388.620) (-3384.647) [-3386.768] (-3388.436) -- 0:03:07 497500 -- (-3391.498) (-3387.818) (-3388.401) [-3386.218] * (-3383.714) (-3385.731) (-3389.789) [-3383.962] -- 0:03:06 498000 -- (-3390.226) (-3387.820) [-3385.379] (-3390.980) * [-3385.151] (-3387.838) (-3392.298) (-3392.729) -- 0:03:07 498500 -- (-3389.242) (-3383.057) [-3386.661] (-3391.198) * (-3383.733) (-3388.262) [-3386.235] (-3386.566) -- 0:03:07 499000 -- (-3391.622) [-3384.864] (-3387.512) (-3388.416) * (-3393.072) [-3388.169] (-3382.858) (-3388.042) -- 0:03:06 499500 -- (-3390.827) [-3381.747] (-3385.151) (-3392.079) * (-3396.811) [-3384.857] (-3381.545) (-3390.437) -- 0:03:06 500000 -- (-3381.072) [-3381.498] (-3385.161) (-3387.360) * (-3396.473) (-3386.202) [-3380.593] (-3388.311) -- 0:03:06 Average standard deviation of split frequencies: 0.000471 500500 -- (-3389.537) (-3388.621) (-3387.632) [-3389.040] * (-3385.969) (-3387.372) [-3383.694] (-3401.341) -- 0:03:06 501000 -- (-3392.929) (-3385.420) (-3389.163) [-3386.849] * (-3390.725) (-3397.278) (-3380.545) [-3385.957] -- 0:03:06 501500 -- (-3394.403) (-3387.628) (-3387.132) [-3385.484] * (-3387.777) (-3384.922) (-3391.878) [-3388.402] -- 0:03:05 502000 -- (-3398.408) (-3388.862) [-3393.059] (-3383.011) * (-3386.444) [-3384.403] (-3389.773) (-3387.518) -- 0:03:05 502500 -- [-3387.498] (-3395.673) (-3388.893) (-3385.163) * (-3385.673) [-3386.623] (-3386.166) (-3385.806) -- 0:03:05 503000 -- (-3396.013) (-3390.602) [-3379.684] (-3386.245) * (-3388.115) (-3388.242) (-3389.383) [-3387.698] -- 0:03:05 503500 -- (-3383.251) [-3383.798] (-3385.501) (-3387.434) * [-3387.700] (-3381.514) (-3390.987) (-3393.505) -- 0:03:05 504000 -- (-3385.349) (-3392.194) [-3394.290] (-3391.552) * (-3383.072) (-3385.936) [-3384.060] (-3391.854) -- 0:03:05 504500 -- (-3388.619) [-3384.206] (-3385.698) (-3392.747) * (-3392.627) (-3390.778) [-3388.494] (-3385.449) -- 0:03:04 505000 -- (-3385.437) (-3388.307) (-3386.583) [-3380.687] * (-3393.690) (-3385.769) (-3385.081) [-3393.348] -- 0:03:04 Average standard deviation of split frequencies: 0.000466 505500 -- [-3383.136] (-3388.760) (-3384.094) (-3384.050) * (-3400.490) (-3387.946) (-3383.328) [-3381.765] -- 0:03:03 506000 -- (-3393.131) (-3389.011) [-3387.157] (-3384.837) * (-3387.585) (-3387.903) (-3387.755) [-3382.398] -- 0:03:04 506500 -- (-3389.641) (-3392.581) (-3384.545) [-3381.925] * (-3385.636) [-3387.704] (-3387.747) (-3390.023) -- 0:03:04 507000 -- [-3387.874] (-3389.686) (-3383.914) (-3385.849) * (-3382.496) (-3389.869) (-3393.884) [-3392.387] -- 0:03:03 507500 -- (-3389.573) (-3398.286) (-3387.773) [-3391.074] * (-3394.285) (-3385.866) [-3395.100] (-3389.890) -- 0:03:03 508000 -- (-3386.783) (-3392.247) (-3394.203) [-3387.430] * [-3386.590] (-3389.739) (-3394.159) (-3388.097) -- 0:03:03 508500 -- [-3386.372] (-3391.358) (-3397.586) (-3393.492) * (-3389.730) [-3390.032] (-3395.183) (-3397.918) -- 0:03:03 509000 -- (-3387.445) [-3389.049] (-3381.508) (-3391.046) * [-3390.195] (-3400.947) (-3385.973) (-3384.036) -- 0:03:03 509500 -- [-3385.565] (-3394.661) (-3391.105) (-3387.294) * (-3389.568) [-3384.187] (-3391.834) (-3388.517) -- 0:03:02 510000 -- [-3384.362] (-3391.646) (-3390.061) (-3387.279) * (-3388.307) (-3395.687) (-3392.416) [-3384.101] -- 0:03:02 Average standard deviation of split frequencies: 0.000462 510500 -- [-3387.991] (-3391.252) (-3385.457) (-3394.261) * (-3384.999) (-3383.654) [-3387.642] (-3391.221) -- 0:03:02 511000 -- [-3388.671] (-3394.093) (-3392.917) (-3387.491) * [-3388.610] (-3396.056) (-3383.191) (-3386.563) -- 0:03:01 511500 -- (-3391.672) [-3392.295] (-3384.246) (-3390.420) * [-3386.922] (-3389.499) (-3390.670) (-3390.014) -- 0:03:02 512000 -- (-3388.273) [-3389.210] (-3386.168) (-3389.165) * (-3394.043) (-3383.166) [-3384.952] (-3385.501) -- 0:03:02 512500 -- (-3390.362) (-3391.431) [-3390.844] (-3385.038) * (-3390.417) (-3394.344) [-3390.642] (-3381.244) -- 0:03:01 513000 -- (-3390.809) (-3388.262) (-3382.680) [-3384.059] * (-3390.306) (-3391.428) (-3393.672) [-3382.246] -- 0:03:01 513500 -- (-3399.781) (-3393.286) (-3386.939) [-3384.200] * [-3388.009] (-3389.310) (-3395.836) (-3390.119) -- 0:03:00 514000 -- (-3385.124) [-3382.822] (-3389.207) (-3390.531) * (-3384.463) (-3395.244) [-3383.486] (-3394.651) -- 0:03:01 514500 -- (-3384.453) (-3390.410) (-3389.085) [-3385.224] * (-3387.211) [-3387.348] (-3385.950) (-3391.649) -- 0:03:01 515000 -- (-3387.293) (-3384.329) (-3392.963) [-3388.611] * (-3391.392) (-3387.213) [-3382.317] (-3394.392) -- 0:03:00 Average standard deviation of split frequencies: 0.000457 515500 -- (-3388.447) [-3384.009] (-3394.701) (-3389.355) * (-3388.932) (-3394.284) (-3388.036) [-3385.100] -- 0:03:00 516000 -- (-3394.331) (-3384.692) [-3391.761] (-3385.990) * [-3391.834] (-3389.590) (-3387.445) (-3389.476) -- 0:03:00 516500 -- (-3387.563) (-3385.865) [-3389.783] (-3387.485) * [-3387.346] (-3392.347) (-3389.731) (-3381.544) -- 0:02:59 517000 -- (-3389.944) [-3392.107] (-3404.986) (-3387.983) * (-3394.933) [-3388.223] (-3388.614) (-3384.879) -- 0:03:00 517500 -- (-3383.266) (-3390.838) [-3391.405] (-3391.297) * (-3394.589) [-3384.337] (-3389.051) (-3390.955) -- 0:02:59 518000 -- (-3386.278) (-3390.091) [-3384.736] (-3387.360) * (-3391.546) (-3383.518) (-3389.224) [-3390.586] -- 0:02:59 518500 -- (-3392.633) [-3384.698] (-3383.196) (-3391.628) * (-3393.856) (-3388.067) [-3387.994] (-3385.880) -- 0:02:59 519000 -- [-3390.540] (-3393.905) (-3391.190) (-3391.266) * (-3399.134) (-3380.816) (-3394.538) [-3381.158] -- 0:02:58 519500 -- (-3385.921) (-3389.374) [-3382.526] (-3387.876) * (-3386.780) [-3389.644] (-3392.929) (-3397.465) -- 0:02:59 520000 -- (-3393.226) [-3386.564] (-3387.267) (-3393.165) * (-3390.716) (-3386.706) (-3383.558) [-3388.699] -- 0:02:59 Average standard deviation of split frequencies: 0.000453 520500 -- (-3389.940) (-3390.762) [-3384.604] (-3387.971) * (-3389.903) [-3385.514] (-3386.664) (-3396.172) -- 0:02:58 521000 -- (-3386.064) (-3388.084) (-3381.991) [-3396.845] * [-3389.385] (-3388.705) (-3385.838) (-3390.916) -- 0:02:58 521500 -- (-3390.857) (-3391.977) [-3386.768] (-3398.019) * [-3394.281] (-3386.902) (-3389.310) (-3381.457) -- 0:02:58 522000 -- (-3388.520) (-3391.337) [-3387.482] (-3388.413) * (-3392.155) (-3382.145) [-3391.332] (-3383.825) -- 0:02:57 522500 -- (-3384.780) (-3389.889) (-3382.685) [-3390.913] * (-3386.320) (-3386.698) [-3382.654] (-3388.117) -- 0:02:58 523000 -- [-3384.827] (-3381.811) (-3383.490) (-3397.071) * (-3385.561) [-3382.856] (-3390.678) (-3394.663) -- 0:02:57 523500 -- (-3389.028) (-3387.782) [-3384.307] (-3390.929) * [-3387.017] (-3385.613) (-3394.777) (-3390.368) -- 0:02:57 524000 -- (-3392.639) (-3387.257) [-3386.752] (-3389.824) * (-3390.050) [-3382.670] (-3392.920) (-3389.777) -- 0:02:57 524500 -- (-3391.844) (-3390.703) [-3379.777] (-3394.496) * (-3389.549) [-3381.526] (-3386.388) (-3392.539) -- 0:02:56 525000 -- [-3392.552] (-3388.178) (-3382.414) (-3400.324) * [-3381.704] (-3383.006) (-3388.822) (-3381.991) -- 0:02:57 Average standard deviation of split frequencies: 0.000448 525500 -- (-3385.366) [-3385.079] (-3388.940) (-3393.664) * (-3387.088) (-3387.357) (-3385.742) [-3391.305] -- 0:02:56 526000 -- [-3383.583] (-3389.330) (-3393.378) (-3394.192) * (-3382.387) (-3389.181) [-3379.796] (-3383.797) -- 0:02:56 526500 -- (-3390.692) (-3386.922) [-3383.456] (-3393.215) * (-3384.519) (-3389.083) [-3386.784] (-3393.798) -- 0:02:56 527000 -- [-3387.003] (-3394.534) (-3396.472) (-3388.354) * (-3397.998) (-3382.249) [-3382.721] (-3388.982) -- 0:02:55 527500 -- [-3387.631] (-3385.448) (-3396.797) (-3390.370) * (-3394.307) (-3385.763) [-3390.056] (-3384.369) -- 0:02:56 528000 -- (-3388.695) (-3385.850) (-3393.299) [-3384.167] * (-3389.283) (-3384.740) (-3388.797) [-3386.352] -- 0:02:56 528500 -- (-3389.616) (-3384.591) [-3389.828] (-3381.123) * [-3388.266] (-3381.762) (-3387.816) (-3393.689) -- 0:02:55 529000 -- (-3382.336) [-3389.342] (-3387.887) (-3389.523) * (-3386.073) [-3381.204] (-3386.662) (-3385.155) -- 0:02:55 529500 -- (-3387.698) (-3384.996) [-3393.431] (-3387.959) * (-3383.771) (-3394.163) (-3387.959) [-3387.392] -- 0:02:55 530000 -- (-3386.855) (-3393.853) (-3383.599) [-3383.465] * (-3387.310) (-3396.647) [-3385.911] (-3387.305) -- 0:02:54 Average standard deviation of split frequencies: 0.000444 530500 -- (-3383.658) (-3384.519) (-3392.189) [-3383.700] * [-3382.435] (-3381.303) (-3389.359) (-3384.466) -- 0:02:55 531000 -- (-3390.514) (-3392.790) (-3391.213) [-3381.264] * [-3390.361] (-3387.678) (-3388.232) (-3388.130) -- 0:02:54 531500 -- (-3387.587) (-3384.871) (-3392.015) [-3392.047] * (-3385.082) [-3387.661] (-3385.181) (-3398.929) -- 0:02:54 532000 -- (-3389.467) (-3387.405) [-3389.005] (-3388.656) * [-3385.101] (-3385.180) (-3384.635) (-3388.148) -- 0:02:54 532500 -- (-3393.106) (-3386.082) (-3388.009) [-3388.248] * (-3384.598) (-3398.539) (-3381.112) [-3384.756] -- 0:02:53 533000 -- (-3391.343) (-3392.562) (-3388.647) [-3383.887] * (-3399.543) (-3389.858) (-3388.602) [-3386.137] -- 0:02:54 533500 -- (-3391.744) (-3397.216) [-3390.458] (-3389.560) * (-3386.508) (-3386.638) (-3395.137) [-3382.056] -- 0:02:54 534000 -- (-3398.481) (-3393.194) [-3388.116] (-3395.123) * (-3386.218) [-3384.562] (-3398.186) (-3381.392) -- 0:02:53 534500 -- (-3387.343) [-3385.661] (-3405.201) (-3384.725) * (-3387.880) (-3382.185) (-3388.700) [-3391.844] -- 0:02:53 535000 -- (-3392.171) (-3379.503) [-3391.883] (-3394.436) * (-3387.173) (-3388.603) [-3385.275] (-3387.751) -- 0:02:52 Average standard deviation of split frequencies: 0.000440 535500 -- (-3386.419) [-3385.475] (-3392.373) (-3385.690) * (-3394.727) [-3384.122] (-3386.982) (-3396.024) -- 0:02:52 536000 -- (-3391.799) (-3389.388) (-3385.785) [-3385.198] * (-3386.615) (-3389.803) [-3386.018] (-3395.493) -- 0:02:53 536500 -- (-3388.136) (-3382.694) (-3399.367) [-3391.482] * [-3384.242] (-3388.498) (-3387.943) (-3390.826) -- 0:02:52 537000 -- (-3388.985) (-3388.237) (-3385.708) [-3393.426] * (-3390.123) [-3389.557] (-3389.529) (-3392.064) -- 0:02:52 537500 -- [-3385.206] (-3390.816) (-3388.984) (-3390.097) * [-3384.040] (-3393.805) (-3387.610) (-3388.614) -- 0:02:52 538000 -- (-3384.836) (-3385.707) [-3381.674] (-3388.907) * (-3386.721) (-3391.005) (-3387.809) [-3384.752] -- 0:02:51 538500 -- [-3381.098] (-3385.358) (-3389.059) (-3396.591) * (-3394.335) (-3385.937) [-3386.838] (-3386.978) -- 0:02:52 539000 -- [-3385.578] (-3392.125) (-3390.299) (-3396.517) * (-3382.542) [-3394.989] (-3398.975) (-3383.932) -- 0:02:51 539500 -- (-3383.660) (-3385.811) [-3382.957] (-3386.776) * (-3384.604) (-3388.237) [-3387.298] (-3387.977) -- 0:02:51 540000 -- (-3387.090) [-3382.968] (-3387.860) (-3387.807) * (-3392.826) (-3387.989) [-3384.221] (-3401.353) -- 0:02:51 Average standard deviation of split frequencies: 0.000654 540500 -- (-3387.010) [-3381.255] (-3397.362) (-3391.508) * (-3387.869) [-3392.982] (-3389.208) (-3384.584) -- 0:02:50 541000 -- (-3386.963) (-3383.261) (-3386.130) [-3384.853] * (-3396.425) [-3392.912] (-3393.599) (-3383.791) -- 0:02:51 541500 -- (-3384.006) [-3385.688] (-3387.006) (-3394.925) * (-3393.843) (-3389.405) (-3388.874) [-3381.696] -- 0:02:51 542000 -- (-3387.061) [-3387.891] (-3393.398) (-3385.433) * (-3388.066) [-3389.348] (-3390.937) (-3383.313) -- 0:02:50 542500 -- [-3386.533] (-3392.588) (-3393.736) (-3390.048) * (-3387.604) [-3387.278] (-3385.657) (-3387.726) -- 0:02:50 543000 -- (-3389.459) (-3388.305) (-3389.889) [-3386.511] * (-3392.125) [-3381.589] (-3391.146) (-3388.416) -- 0:02:50 543500 -- (-3394.169) [-3382.765] (-3389.680) (-3393.136) * (-3388.645) (-3384.701) [-3388.213] (-3390.896) -- 0:02:49 544000 -- [-3380.978] (-3395.400) (-3383.962) (-3390.036) * (-3387.250) (-3387.974) [-3389.216] (-3400.282) -- 0:02:50 544500 -- (-3385.425) (-3387.548) [-3383.392] (-3390.994) * (-3387.065) (-3390.404) [-3392.231] (-3392.846) -- 0:02:49 545000 -- [-3387.772] (-3385.042) (-3385.829) (-3394.651) * (-3385.925) (-3386.704) (-3388.147) [-3392.410] -- 0:02:49 Average standard deviation of split frequencies: 0.000648 545500 -- (-3386.931) (-3390.258) (-3384.244) [-3386.945] * (-3384.490) [-3382.944] (-3389.535) (-3389.584) -- 0:02:49 546000 -- (-3400.445) (-3389.632) (-3383.610) [-3382.854] * (-3383.217) (-3392.895) [-3396.937] (-3395.455) -- 0:02:48 546500 -- (-3388.921) (-3391.801) [-3389.059] (-3385.182) * [-3385.822] (-3395.652) (-3385.626) (-3386.047) -- 0:02:49 547000 -- (-3390.037) (-3386.865) (-3381.934) [-3386.457] * [-3389.204] (-3390.760) (-3386.336) (-3383.508) -- 0:02:48 547500 -- (-3389.030) (-3384.668) (-3388.072) [-3386.215] * (-3387.375) (-3384.362) (-3389.010) [-3391.353] -- 0:02:48 548000 -- (-3391.561) (-3384.250) [-3385.468] (-3382.426) * (-3388.506) (-3386.089) [-3386.412] (-3391.874) -- 0:02:48 548500 -- (-3384.987) [-3389.136] (-3387.729) (-3384.545) * (-3386.048) (-3387.681) [-3386.821] (-3384.317) -- 0:02:47 549000 -- (-3388.690) (-3383.126) (-3380.185) [-3388.068] * (-3391.907) (-3389.835) [-3384.857] (-3389.509) -- 0:02:47 549500 -- (-3384.786) [-3387.571] (-3389.356) (-3386.617) * (-3385.106) [-3387.295] (-3393.660) (-3387.868) -- 0:02:48 550000 -- (-3384.226) [-3385.922] (-3395.253) (-3390.682) * [-3386.753] (-3389.738) (-3394.510) (-3398.412) -- 0:02:47 Average standard deviation of split frequencies: 0.000642 550500 -- [-3390.167] (-3386.546) (-3400.162) (-3384.821) * [-3389.335] (-3391.151) (-3394.968) (-3400.507) -- 0:02:47 551000 -- [-3392.118] (-3387.045) (-3392.208) (-3396.948) * (-3392.481) (-3383.969) (-3389.194) [-3386.685] -- 0:02:47 551500 -- (-3387.132) [-3391.901] (-3393.706) (-3388.753) * (-3387.469) (-3388.103) [-3387.439] (-3391.018) -- 0:02:46 552000 -- (-3387.803) (-3380.781) [-3382.202] (-3391.553) * (-3390.453) (-3383.296) [-3383.384] (-3380.769) -- 0:02:47 552500 -- (-3388.495) (-3386.043) [-3387.738] (-3392.391) * (-3383.919) (-3388.567) (-3386.204) [-3389.055] -- 0:02:46 553000 -- (-3381.397) (-3381.825) (-3393.975) [-3389.246] * (-3389.366) (-3381.128) [-3382.547] (-3390.799) -- 0:02:46 553500 -- (-3400.454) (-3385.715) (-3391.961) [-3382.661] * (-3385.699) [-3380.707] (-3388.636) (-3384.902) -- 0:02:46 554000 -- [-3383.468] (-3383.619) (-3396.769) (-3392.182) * (-3390.843) [-3385.881] (-3385.827) (-3382.049) -- 0:02:45 554500 -- (-3384.683) [-3388.869] (-3391.908) (-3388.866) * (-3396.541) [-3387.039] (-3382.410) (-3389.770) -- 0:02:45 555000 -- (-3392.197) (-3391.627) (-3390.762) [-3388.248] * [-3383.894] (-3394.762) (-3386.951) (-3395.479) -- 0:02:45 Average standard deviation of split frequencies: 0.000636 555500 -- [-3390.136] (-3383.214) (-3385.235) (-3390.511) * [-3385.652] (-3391.884) (-3384.093) (-3393.051) -- 0:02:45 556000 -- (-3387.890) (-3391.362) (-3390.588) [-3384.079] * (-3391.072) [-3384.865] (-3393.447) (-3390.541) -- 0:02:45 556500 -- (-3388.433) [-3383.273] (-3386.612) (-3382.947) * [-3390.259] (-3384.367) (-3392.241) (-3386.613) -- 0:02:44 557000 -- (-3392.871) (-3389.512) (-3392.866) [-3382.730] * (-3389.513) [-3390.846] (-3391.347) (-3395.357) -- 0:02:44 557500 -- [-3386.544] (-3380.873) (-3392.626) (-3390.603) * (-3392.150) [-3384.890] (-3387.620) (-3383.181) -- 0:02:45 558000 -- (-3386.115) (-3399.307) (-3384.791) [-3388.043] * (-3389.444) (-3387.366) [-3394.000] (-3389.029) -- 0:02:44 558500 -- [-3386.977] (-3391.217) (-3382.322) (-3382.214) * (-3401.444) (-3387.281) (-3382.330) [-3384.228] -- 0:02:44 559000 -- (-3386.274) (-3382.147) [-3386.114] (-3389.812) * (-3393.635) (-3389.143) (-3390.505) [-3386.553] -- 0:02:44 559500 -- (-3391.288) (-3391.737) (-3383.482) [-3388.128] * (-3387.114) (-3394.576) [-3381.268] (-3383.584) -- 0:02:43 560000 -- (-3399.066) (-3389.810) [-3383.220] (-3395.911) * (-3391.486) (-3385.889) [-3385.492] (-3392.666) -- 0:02:44 Average standard deviation of split frequencies: 0.000631 560500 -- (-3391.827) [-3393.901] (-3394.538) (-3391.256) * (-3387.305) [-3384.359] (-3386.431) (-3383.574) -- 0:02:43 561000 -- (-3387.319) (-3386.306) [-3389.809] (-3391.328) * (-3384.901) (-3396.088) [-3387.251] (-3387.993) -- 0:02:43 561500 -- [-3389.188] (-3385.366) (-3393.561) (-3393.701) * (-3388.852) (-3387.099) (-3396.362) [-3395.692] -- 0:02:43 562000 -- (-3385.491) [-3386.231] (-3387.400) (-3396.894) * [-3382.819] (-3393.270) (-3387.062) (-3395.961) -- 0:02:42 562500 -- (-3393.239) (-3384.164) [-3382.966] (-3394.271) * (-3381.878) (-3389.746) [-3383.798] (-3386.065) -- 0:02:42 563000 -- [-3385.404] (-3381.979) (-3384.301) (-3397.010) * (-3398.751) (-3384.342) (-3386.804) [-3383.920] -- 0:02:43 563500 -- (-3394.581) (-3385.958) (-3383.904) [-3388.593] * (-3400.134) (-3386.355) (-3393.442) [-3397.385] -- 0:02:42 564000 -- [-3395.656] (-3389.795) (-3397.880) (-3390.124) * [-3385.739] (-3391.276) (-3383.577) (-3393.926) -- 0:02:42 564500 -- (-3387.186) (-3387.472) [-3383.293] (-3389.042) * [-3390.503] (-3387.043) (-3387.550) (-3392.184) -- 0:02:42 565000 -- (-3388.851) (-3386.186) [-3383.753] (-3383.709) * (-3391.708) (-3388.601) [-3388.033] (-3389.329) -- 0:02:41 Average standard deviation of split frequencies: 0.000833 565500 -- (-3389.217) (-3386.199) (-3391.681) [-3391.564] * (-3388.343) (-3389.939) [-3385.792] (-3388.546) -- 0:02:42 566000 -- (-3391.870) [-3384.989] (-3388.624) (-3396.023) * (-3396.632) [-3385.739] (-3386.810) (-3388.175) -- 0:02:41 566500 -- (-3385.043) (-3390.057) (-3389.646) [-3386.879] * [-3379.277] (-3394.650) (-3388.578) (-3386.299) -- 0:02:41 567000 -- (-3386.878) (-3395.340) [-3387.670] (-3388.131) * (-3388.116) (-3402.955) (-3390.427) [-3386.380] -- 0:02:41 567500 -- (-3385.617) (-3384.405) (-3387.930) [-3392.376] * (-3384.521) (-3384.534) (-3390.796) [-3382.126] -- 0:02:40 568000 -- [-3389.715] (-3385.255) (-3387.962) (-3397.141) * (-3392.296) (-3396.552) [-3392.562] (-3385.177) -- 0:02:40 568500 -- (-3387.700) [-3384.881] (-3384.694) (-3386.865) * (-3385.998) (-3389.784) (-3391.645) [-3383.943] -- 0:02:40 569000 -- [-3391.556] (-3393.864) (-3389.486) (-3406.409) * (-3394.329) (-3392.393) (-3383.634) [-3388.586] -- 0:02:40 569500 -- (-3389.724) [-3385.703] (-3385.386) (-3390.332) * (-3382.373) (-3383.615) (-3389.521) [-3386.100] -- 0:02:40 570000 -- (-3388.469) (-3382.645) (-3389.372) [-3383.572] * [-3385.409] (-3388.604) (-3391.297) (-3385.721) -- 0:02:39 Average standard deviation of split frequencies: 0.000826 570500 -- (-3382.357) [-3386.972] (-3385.987) (-3389.027) * (-3394.697) [-3390.255] (-3387.455) (-3390.802) -- 0:02:39 571000 -- (-3388.204) (-3389.295) (-3394.405) [-3390.242] * [-3385.907] (-3389.706) (-3390.462) (-3383.157) -- 0:02:40 571500 -- (-3393.491) (-3386.300) [-3384.322] (-3389.570) * (-3389.150) [-3385.554] (-3390.834) (-3391.020) -- 0:02:39 572000 -- [-3384.048] (-3393.227) (-3392.597) (-3387.009) * (-3381.214) (-3389.479) [-3384.572] (-3394.982) -- 0:02:39 572500 -- (-3395.110) (-3386.553) [-3388.154] (-3396.674) * (-3391.669) [-3389.522] (-3385.084) (-3384.817) -- 0:02:39 573000 -- [-3388.059] (-3380.188) (-3386.958) (-3389.897) * (-3386.935) [-3386.077] (-3398.991) (-3385.388) -- 0:02:38 573500 -- [-3381.378] (-3391.921) (-3387.687) (-3394.721) * [-3385.513] (-3395.570) (-3386.617) (-3388.893) -- 0:02:38 574000 -- (-3386.103) (-3388.530) (-3393.154) [-3386.296] * [-3391.407] (-3388.742) (-3395.949) (-3391.055) -- 0:02:38 574500 -- [-3388.156] (-3382.158) (-3383.031) (-3386.272) * [-3384.618] (-3386.094) (-3395.741) (-3392.574) -- 0:02:38 575000 -- (-3389.836) (-3386.811) (-3385.589) [-3383.843] * (-3387.458) (-3387.558) [-3385.207] (-3384.422) -- 0:02:38 Average standard deviation of split frequencies: 0.000818 575500 -- (-3386.064) (-3386.549) [-3388.717] (-3389.187) * (-3390.936) [-3384.832] (-3387.397) (-3393.512) -- 0:02:37 576000 -- (-3391.423) (-3386.998) [-3383.496] (-3387.498) * (-3390.708) (-3385.440) [-3389.132] (-3398.766) -- 0:02:37 576500 -- (-3388.111) (-3391.329) (-3390.951) [-3392.819] * (-3387.791) (-3386.637) (-3389.968) [-3385.894] -- 0:02:37 577000 -- (-3386.376) [-3387.794] (-3381.006) (-3385.133) * (-3389.577) (-3387.032) (-3387.789) [-3386.476] -- 0:02:37 577500 -- (-3386.708) (-3382.638) (-3382.514) [-3388.983] * (-3385.295) (-3400.992) [-3390.123] (-3388.530) -- 0:02:37 578000 -- (-3391.985) [-3382.456] (-3381.513) (-3388.284) * [-3394.425] (-3390.772) (-3385.201) (-3384.472) -- 0:02:36 578500 -- (-3387.859) (-3384.938) [-3389.504] (-3392.207) * (-3387.743) [-3387.902] (-3382.955) (-3388.621) -- 0:02:36 579000 -- (-3391.789) [-3388.282] (-3387.378) (-3395.052) * (-3392.562) [-3384.468] (-3380.487) (-3392.822) -- 0:02:37 579500 -- (-3399.565) [-3384.609] (-3385.700) (-3388.850) * (-3391.849) (-3390.005) (-3388.024) [-3385.064] -- 0:02:36 580000 -- (-3385.148) (-3391.116) [-3387.880] (-3383.272) * (-3392.765) (-3381.533) (-3388.235) [-3384.221] -- 0:02:36 Average standard deviation of split frequencies: 0.000812 580500 -- (-3385.278) (-3384.511) [-3380.999] (-3395.210) * (-3385.011) [-3387.542] (-3392.883) (-3383.390) -- 0:02:36 581000 -- (-3385.208) [-3385.724] (-3396.992) (-3388.483) * (-3388.894) [-3388.773] (-3398.724) (-3396.242) -- 0:02:35 581500 -- (-3381.844) [-3382.654] (-3392.301) (-3396.034) * (-3388.773) (-3390.319) (-3391.582) [-3384.901] -- 0:02:35 582000 -- (-3385.005) [-3382.903] (-3389.169) (-3383.981) * (-3392.520) (-3386.043) (-3386.868) [-3389.743] -- 0:02:35 582500 -- (-3388.736) (-3388.411) (-3386.054) [-3384.995] * (-3393.133) [-3383.349] (-3386.362) (-3395.129) -- 0:02:35 583000 -- (-3391.915) (-3389.157) (-3392.581) [-3386.751] * (-3396.900) [-3383.257] (-3390.525) (-3392.063) -- 0:02:35 583500 -- [-3392.565] (-3390.252) (-3388.544) (-3387.693) * (-3394.793) [-3380.557] (-3394.125) (-3391.456) -- 0:02:34 584000 -- (-3393.559) [-3398.257] (-3390.512) (-3392.122) * (-3397.255) [-3387.113] (-3388.039) (-3391.349) -- 0:02:34 584500 -- [-3383.620] (-3385.345) (-3387.142) (-3390.620) * [-3389.385] (-3385.526) (-3383.856) (-3394.166) -- 0:02:34 585000 -- (-3387.632) (-3389.244) [-3388.130] (-3385.813) * (-3392.222) (-3389.830) [-3389.893] (-3387.859) -- 0:02:34 Average standard deviation of split frequencies: 0.000804 585500 -- (-3390.120) [-3390.314] (-3387.965) (-3390.493) * (-3387.845) [-3382.481] (-3396.264) (-3384.183) -- 0:02:34 586000 -- (-3386.005) (-3384.827) (-3385.832) [-3393.046] * (-3385.666) (-3390.213) (-3392.153) [-3392.009] -- 0:02:34 586500 -- [-3382.274] (-3386.702) (-3384.726) (-3386.058) * [-3386.304] (-3392.228) (-3389.025) (-3393.442) -- 0:02:33 587000 -- (-3388.527) (-3388.689) [-3384.777] (-3386.488) * (-3385.325) (-3387.179) (-3383.845) [-3387.429] -- 0:02:33 587500 -- (-3397.591) (-3388.185) (-3391.014) [-3383.851] * (-3388.875) [-3389.504] (-3384.387) (-3385.327) -- 0:02:33 588000 -- (-3385.083) [-3388.234] (-3396.360) (-3383.091) * (-3392.889) (-3381.973) (-3391.784) [-3384.023] -- 0:02:33 588500 -- [-3385.196] (-3394.673) (-3388.436) (-3386.489) * (-3391.972) (-3389.189) [-3389.395] (-3391.282) -- 0:02:33 589000 -- (-3390.325) (-3392.209) (-3395.726) [-3386.385] * (-3388.997) (-3391.817) (-3389.306) [-3397.990] -- 0:02:32 589500 -- (-3389.498) (-3384.059) [-3396.329] (-3388.732) * (-3379.129) (-3388.662) [-3385.484] (-3382.344) -- 0:02:32 590000 -- (-3385.053) (-3387.798) [-3385.665] (-3387.365) * (-3387.573) (-3384.906) [-3387.062] (-3393.571) -- 0:02:32 Average standard deviation of split frequencies: 0.000798 590500 -- [-3389.047] (-3388.791) (-3393.791) (-3385.290) * (-3389.035) (-3388.130) (-3391.698) [-3391.115] -- 0:02:32 591000 -- (-3393.891) [-3389.786] (-3384.163) (-3385.960) * (-3391.624) (-3384.544) [-3390.656] (-3393.454) -- 0:02:32 591500 -- (-3385.166) [-3383.343] (-3394.427) (-3396.320) * [-3387.451] (-3391.558) (-3383.122) (-3389.280) -- 0:02:31 592000 -- (-3385.333) (-3392.995) (-3386.612) [-3391.172] * [-3384.632] (-3388.460) (-3389.306) (-3385.691) -- 0:02:31 592500 -- [-3386.949] (-3386.285) (-3385.102) (-3385.725) * (-3390.708) [-3389.268] (-3389.633) (-3399.050) -- 0:02:31 593000 -- (-3387.656) (-3392.003) [-3388.657] (-3384.480) * (-3385.975) (-3386.119) (-3381.855) [-3385.191] -- 0:02:31 593500 -- (-3389.487) (-3388.853) (-3389.091) [-3383.741] * (-3386.906) (-3381.869) (-3390.052) [-3381.211] -- 0:02:31 594000 -- (-3388.034) [-3391.105] (-3383.438) (-3384.159) * (-3388.191) (-3389.307) (-3391.330) [-3390.546] -- 0:02:31 594500 -- [-3389.717] (-3384.000) (-3388.727) (-3384.910) * (-3387.657) [-3385.844] (-3385.709) (-3391.976) -- 0:02:30 595000 -- (-3385.805) (-3391.529) [-3386.819] (-3390.594) * [-3384.121] (-3390.099) (-3383.373) (-3384.748) -- 0:02:30 Average standard deviation of split frequencies: 0.000791 595500 -- (-3390.320) (-3388.301) (-3387.603) [-3380.616] * [-3387.997] (-3381.973) (-3384.333) (-3387.725) -- 0:02:30 596000 -- [-3385.383] (-3390.949) (-3389.508) (-3394.078) * (-3388.419) [-3390.273] (-3396.738) (-3387.907) -- 0:02:30 596500 -- (-3383.817) (-3387.637) (-3388.521) [-3388.136] * (-3382.633) [-3390.303] (-3394.786) (-3389.372) -- 0:02:30 597000 -- [-3383.435] (-3391.362) (-3395.047) (-3383.244) * [-3384.282] (-3380.076) (-3394.653) (-3390.347) -- 0:02:29 597500 -- (-3386.438) [-3395.439] (-3385.800) (-3381.079) * (-3389.172) (-3379.040) [-3386.313] (-3392.643) -- 0:02:29 598000 -- (-3382.105) (-3382.957) (-3398.480) [-3386.543] * (-3388.341) [-3388.965] (-3379.873) (-3393.748) -- 0:02:29 598500 -- (-3389.349) (-3386.356) (-3385.418) [-3388.600] * (-3398.220) [-3385.813] (-3386.456) (-3382.361) -- 0:02:29 599000 -- (-3384.375) (-3385.892) [-3386.905] (-3390.911) * (-3386.066) (-3395.538) (-3388.594) [-3385.482] -- 0:02:29 599500 -- (-3386.207) (-3382.492) (-3388.786) [-3398.641] * (-3391.263) (-3388.168) (-3384.839) [-3385.692] -- 0:02:28 600000 -- (-3381.114) [-3381.227] (-3397.453) (-3396.041) * (-3388.348) (-3382.488) (-3386.546) [-3389.321] -- 0:02:28 Average standard deviation of split frequencies: 0.000785 600500 -- (-3386.792) (-3379.857) [-3387.729] (-3385.652) * (-3386.928) [-3384.707] (-3391.781) (-3388.067) -- 0:02:28 601000 -- (-3388.473) (-3386.087) (-3387.163) [-3388.228] * (-3389.550) (-3386.523) (-3390.360) [-3383.798] -- 0:02:28 601500 -- (-3392.631) (-3386.844) [-3391.249] (-3384.455) * (-3386.810) (-3387.845) (-3387.436) [-3385.176] -- 0:02:28 602000 -- (-3393.355) [-3390.665] (-3393.806) (-3390.779) * (-3386.263) (-3394.510) [-3382.333] (-3383.311) -- 0:02:28 602500 -- (-3391.228) (-3387.627) [-3384.160] (-3389.996) * (-3391.044) [-3380.479] (-3386.656) (-3395.746) -- 0:02:27 603000 -- (-3389.580) (-3394.128) [-3396.108] (-3388.144) * (-3389.997) (-3386.040) [-3384.936] (-3392.246) -- 0:02:27 603500 -- (-3387.778) [-3383.970] (-3405.389) (-3389.401) * (-3384.067) [-3388.383] (-3388.432) (-3389.698) -- 0:02:27 604000 -- [-3386.933] (-3389.813) (-3391.056) (-3385.626) * (-3384.827) [-3380.342] (-3385.715) (-3392.967) -- 0:02:27 604500 -- (-3384.950) [-3385.895] (-3392.130) (-3389.547) * (-3381.314) [-3389.665] (-3385.406) (-3398.161) -- 0:02:27 605000 -- (-3386.544) [-3387.217] (-3387.940) (-3381.349) * (-3384.093) (-3393.818) (-3396.471) [-3388.319] -- 0:02:26 Average standard deviation of split frequencies: 0.000778 605500 -- (-3390.176) (-3385.951) [-3391.105] (-3394.699) * (-3385.169) [-3383.093] (-3387.748) (-3387.037) -- 0:02:26 606000 -- (-3390.399) (-3390.782) [-3388.567] (-3388.697) * (-3391.008) (-3385.835) (-3385.173) [-3389.240] -- 0:02:26 606500 -- (-3386.911) [-3393.472] (-3390.205) (-3382.047) * (-3390.463) [-3398.557] (-3387.845) (-3388.351) -- 0:02:26 607000 -- (-3387.640) (-3387.380) (-3388.602) [-3384.355] * (-3390.489) (-3393.833) [-3382.453] (-3384.510) -- 0:02:26 607500 -- [-3384.405] (-3392.764) (-3388.746) (-3392.839) * [-3393.845] (-3393.390) (-3382.490) (-3386.416) -- 0:02:26 608000 -- (-3383.689) (-3390.385) (-3382.191) [-3390.176] * (-3390.674) (-3388.569) [-3386.038] (-3389.869) -- 0:02:25 608500 -- (-3382.562) (-3390.845) [-3382.487] (-3396.285) * (-3393.978) (-3391.648) [-3382.960] (-3385.619) -- 0:02:25 609000 -- [-3384.666] (-3394.743) (-3386.645) (-3399.442) * (-3384.633) (-3382.564) [-3393.311] (-3391.586) -- 0:02:25 609500 -- [-3386.722] (-3382.847) (-3392.968) (-3399.375) * (-3388.696) (-3385.121) [-3386.929] (-3395.922) -- 0:02:25 610000 -- (-3383.155) (-3389.445) (-3392.125) [-3388.571] * [-3383.454] (-3385.642) (-3386.832) (-3387.286) -- 0:02:25 Average standard deviation of split frequencies: 0.000772 610500 -- [-3392.876] (-3393.967) (-3382.851) (-3387.523) * (-3386.325) [-3384.948] (-3384.853) (-3384.738) -- 0:02:24 611000 -- [-3386.352] (-3401.502) (-3387.613) (-3395.608) * (-3394.203) (-3397.921) [-3381.350] (-3389.643) -- 0:02:24 611500 -- [-3386.061] (-3401.162) (-3388.767) (-3393.047) * (-3388.206) (-3394.708) [-3386.339] (-3393.393) -- 0:02:24 612000 -- (-3394.023) (-3397.555) [-3389.999] (-3391.189) * [-3385.801] (-3384.072) (-3390.987) (-3389.488) -- 0:02:24 612500 -- (-3386.280) (-3388.529) [-3381.793] (-3386.101) * (-3388.752) (-3384.874) [-3387.219] (-3388.900) -- 0:02:24 613000 -- [-3381.311] (-3385.708) (-3394.016) (-3382.203) * (-3403.067) [-3384.534] (-3387.495) (-3386.912) -- 0:02:23 613500 -- (-3384.934) (-3384.741) [-3388.764] (-3390.574) * [-3386.512] (-3398.133) (-3383.911) (-3386.936) -- 0:02:23 614000 -- (-3387.557) (-3383.471) [-3394.976] (-3387.656) * (-3390.641) [-3388.304] (-3389.505) (-3392.700) -- 0:02:23 614500 -- [-3382.735] (-3395.853) (-3386.841) (-3380.781) * (-3393.107) (-3388.411) [-3386.605] (-3388.277) -- 0:02:23 615000 -- (-3388.832) [-3386.814] (-3386.686) (-3388.375) * (-3389.699) [-3388.399] (-3391.769) (-3381.440) -- 0:02:23 Average standard deviation of split frequencies: 0.000765 615500 -- (-3385.344) (-3387.903) (-3398.127) [-3383.386] * (-3386.968) (-3389.625) (-3387.455) [-3391.466] -- 0:02:23 616000 -- (-3389.404) [-3384.715] (-3387.969) (-3392.922) * [-3392.847] (-3402.287) (-3385.150) (-3387.871) -- 0:02:22 616500 -- [-3388.485] (-3394.897) (-3395.311) (-3392.556) * (-3395.299) (-3393.281) [-3387.605] (-3385.274) -- 0:02:22 617000 -- [-3386.044] (-3388.054) (-3392.304) (-3399.436) * [-3392.126] (-3383.585) (-3384.626) (-3383.371) -- 0:02:22 617500 -- (-3387.344) [-3395.034] (-3384.831) (-3394.479) * [-3388.119] (-3386.142) (-3389.414) (-3386.693) -- 0:02:22 618000 -- (-3392.468) (-3392.315) [-3386.447] (-3387.770) * (-3395.540) [-3387.778] (-3387.404) (-3387.943) -- 0:02:22 618500 -- (-3389.600) (-3387.080) [-3387.838] (-3383.305) * (-3386.674) (-3387.610) (-3389.312) [-3384.252] -- 0:02:21 619000 -- (-3394.323) (-3382.746) [-3394.732] (-3383.772) * (-3388.393) (-3389.415) [-3384.077] (-3394.488) -- 0:02:21 619500 -- (-3383.637) (-3394.136) (-3386.413) [-3385.771] * [-3393.023] (-3389.350) (-3384.983) (-3394.061) -- 0:02:21 620000 -- (-3395.000) (-3391.051) (-3383.784) [-3383.425] * (-3385.300) (-3388.397) [-3388.374] (-3386.533) -- 0:02:21 Average standard deviation of split frequencies: 0.000760 620500 -- (-3393.517) [-3392.270] (-3385.829) (-3385.059) * (-3384.457) [-3386.671] (-3387.798) (-3388.122) -- 0:02:21 621000 -- (-3383.636) (-3384.793) (-3388.064) [-3387.943] * [-3388.571] (-3386.230) (-3391.793) (-3387.580) -- 0:02:20 621500 -- [-3384.338] (-3384.619) (-3382.366) (-3386.694) * (-3387.706) [-3385.551] (-3390.631) (-3392.180) -- 0:02:20 622000 -- (-3381.291) [-3382.422] (-3393.386) (-3385.632) * (-3392.690) (-3382.768) [-3388.275] (-3387.962) -- 0:02:20 622500 -- (-3388.761) [-3380.668] (-3391.370) (-3384.634) * (-3405.279) (-3387.858) [-3381.996] (-3389.047) -- 0:02:20 623000 -- (-3385.751) [-3385.683] (-3389.084) (-3393.340) * (-3395.784) (-3384.046) (-3384.001) [-3379.945] -- 0:02:20 623500 -- [-3388.333] (-3387.976) (-3385.810) (-3390.689) * (-3391.869) [-3382.385] (-3391.534) (-3389.704) -- 0:02:20 624000 -- (-3387.426) [-3382.469] (-3394.097) (-3386.972) * (-3390.135) [-3387.069] (-3384.319) (-3383.773) -- 0:02:19 624500 -- (-3388.600) [-3391.074] (-3393.997) (-3388.538) * (-3385.196) (-3387.468) [-3381.696] (-3385.970) -- 0:02:19 625000 -- (-3385.943) (-3384.344) (-3386.863) [-3383.994] * (-3388.548) (-3390.180) (-3385.955) [-3381.296] -- 0:02:19 Average standard deviation of split frequencies: 0.000565 625500 -- (-3391.494) (-3387.967) (-3397.171) [-3385.632] * (-3392.039) (-3388.798) [-3387.810] (-3399.408) -- 0:02:19 626000 -- (-3381.545) [-3397.277] (-3393.089) (-3390.052) * [-3390.691] (-3382.657) (-3382.971) (-3393.355) -- 0:02:19 626500 -- (-3391.886) (-3389.485) (-3392.287) [-3388.561] * (-3380.673) (-3382.815) (-3385.559) [-3383.725] -- 0:02:18 627000 -- (-3390.453) (-3388.445) [-3386.872] (-3393.214) * [-3379.876] (-3391.643) (-3405.624) (-3385.028) -- 0:02:18 627500 -- (-3383.395) (-3389.762) (-3394.928) [-3379.729] * (-3385.839) (-3383.817) (-3395.828) [-3384.525] -- 0:02:18 628000 -- (-3383.843) [-3387.393] (-3383.249) (-3381.831) * [-3382.760] (-3384.464) (-3393.839) (-3388.521) -- 0:02:18 628500 -- (-3383.648) (-3397.244) [-3387.644] (-3387.269) * (-3385.466) (-3382.306) [-3384.479] (-3390.068) -- 0:02:18 629000 -- (-3395.251) (-3387.970) [-3389.426] (-3387.952) * [-3381.144] (-3389.114) (-3384.429) (-3387.749) -- 0:02:18 629500 -- (-3391.865) (-3385.248) [-3389.408] (-3386.225) * (-3392.089) (-3389.348) (-3387.301) [-3387.921] -- 0:02:17 630000 -- [-3385.978] (-3383.500) (-3388.921) (-3390.608) * [-3387.732] (-3382.469) (-3390.254) (-3386.753) -- 0:02:17 Average standard deviation of split frequencies: 0.000561 630500 -- (-3387.318) [-3381.322] (-3384.978) (-3388.376) * (-3384.595) [-3385.862] (-3400.241) (-3394.285) -- 0:02:17 631000 -- (-3395.475) (-3383.820) (-3382.901) [-3387.111] * (-3381.168) (-3389.678) (-3389.050) [-3382.773] -- 0:02:17 631500 -- (-3395.453) (-3386.952) (-3385.660) [-3388.469] * (-3390.729) [-3386.498] (-3387.512) (-3387.638) -- 0:02:17 632000 -- (-3397.603) [-3388.024] (-3385.099) (-3382.756) * (-3387.379) (-3384.091) (-3391.095) [-3389.646] -- 0:02:16 632500 -- (-3391.211) [-3386.670] (-3390.830) (-3386.477) * [-3389.471] (-3384.592) (-3385.388) (-3384.855) -- 0:02:16 633000 -- (-3384.774) [-3384.786] (-3388.129) (-3385.927) * (-3387.041) (-3390.649) (-3381.302) [-3382.731] -- 0:02:16 633500 -- (-3390.048) (-3393.521) [-3388.592] (-3384.163) * (-3386.798) [-3387.362] (-3395.689) (-3388.640) -- 0:02:16 634000 -- (-3388.883) (-3393.032) (-3389.651) [-3382.069] * (-3390.196) (-3383.327) (-3396.870) [-3388.339] -- 0:02:16 634500 -- [-3383.162] (-3395.901) (-3381.854) (-3380.558) * (-3387.895) (-3383.720) [-3386.633] (-3387.198) -- 0:02:15 635000 -- [-3385.235] (-3394.565) (-3387.106) (-3389.190) * (-3387.874) [-3390.267] (-3384.596) (-3387.163) -- 0:02:15 Average standard deviation of split frequencies: 0.000556 635500 -- (-3382.559) (-3390.327) (-3389.281) [-3396.831] * (-3387.637) (-3394.191) [-3387.409] (-3385.740) -- 0:02:15 636000 -- [-3382.642] (-3388.939) (-3386.827) (-3385.663) * (-3389.976) (-3396.719) (-3389.104) [-3385.049] -- 0:02:15 636500 -- (-3385.946) (-3398.770) (-3385.155) [-3392.010] * (-3390.397) (-3392.013) [-3386.443] (-3385.766) -- 0:02:15 637000 -- (-3381.804) (-3386.814) (-3385.111) [-3388.478] * (-3382.796) [-3391.873] (-3389.938) (-3383.536) -- 0:02:15 637500 -- (-3388.603) [-3385.608] (-3388.772) (-3391.410) * (-3393.510) (-3385.938) (-3382.197) [-3383.266] -- 0:02:14 638000 -- (-3387.602) [-3388.839] (-3386.938) (-3396.914) * (-3384.394) (-3384.195) [-3388.219] (-3386.338) -- 0:02:14 638500 -- [-3395.361] (-3383.174) (-3386.256) (-3396.160) * (-3391.184) (-3386.792) (-3389.116) [-3391.009] -- 0:02:14 639000 -- (-3393.686) [-3387.240] (-3390.443) (-3387.187) * (-3391.245) (-3384.261) (-3387.258) [-3386.440] -- 0:02:14 639500 -- (-3394.795) [-3387.011] (-3394.241) (-3386.863) * (-3387.341) [-3382.659] (-3392.698) (-3390.890) -- 0:02:14 640000 -- (-3395.066) [-3389.012] (-3389.829) (-3387.116) * (-3391.767) (-3381.370) [-3394.975] (-3389.999) -- 0:02:13 Average standard deviation of split frequencies: 0.000552 640500 -- (-3385.442) (-3392.287) [-3384.800] (-3385.738) * (-3391.194) [-3381.442] (-3391.650) (-3401.291) -- 0:02:13 641000 -- (-3385.485) (-3388.500) (-3390.303) [-3392.378] * [-3380.901] (-3383.788) (-3391.383) (-3394.961) -- 0:02:13 641500 -- (-3391.986) (-3386.426) [-3384.890] (-3397.911) * (-3388.362) [-3388.440] (-3384.328) (-3402.489) -- 0:02:13 642000 -- (-3383.514) (-3393.119) (-3385.621) [-3390.439] * (-3389.983) (-3386.645) [-3389.366] (-3412.134) -- 0:02:13 642500 -- (-3384.288) [-3382.829] (-3381.493) (-3384.745) * [-3385.034] (-3390.416) (-3393.190) (-3392.643) -- 0:02:12 643000 -- [-3383.545] (-3390.131) (-3385.469) (-3384.043) * [-3384.674] (-3388.970) (-3387.997) (-3392.424) -- 0:02:12 643500 -- (-3389.392) (-3385.231) [-3389.146] (-3386.701) * [-3388.827] (-3393.341) (-3395.731) (-3390.401) -- 0:02:12 644000 -- (-3392.976) (-3392.697) (-3388.313) [-3385.311] * (-3384.494) (-3389.583) (-3389.186) [-3386.969] -- 0:02:12 644500 -- [-3383.840] (-3389.592) (-3384.080) (-3382.997) * (-3384.344) [-3386.041] (-3394.416) (-3387.706) -- 0:02:12 645000 -- [-3384.170] (-3383.737) (-3389.486) (-3383.892) * (-3388.798) (-3381.477) (-3385.187) [-3382.728] -- 0:02:12 Average standard deviation of split frequencies: 0.000547 645500 -- (-3393.189) (-3386.773) (-3397.049) [-3385.645] * [-3387.707] (-3385.233) (-3388.745) (-3386.747) -- 0:02:11 646000 -- (-3383.034) (-3383.362) [-3391.092] (-3396.472) * (-3391.245) (-3383.454) [-3394.014] (-3396.388) -- 0:02:11 646500 -- (-3386.983) [-3386.204] (-3397.746) (-3395.902) * (-3389.745) [-3382.793] (-3385.824) (-3389.741) -- 0:02:11 647000 -- (-3391.077) [-3383.745] (-3390.183) (-3385.823) * (-3382.325) (-3387.956) (-3393.349) [-3385.965] -- 0:02:11 647500 -- (-3393.292) (-3382.974) (-3386.913) [-3384.765] * [-3380.892] (-3396.458) (-3391.610) (-3389.620) -- 0:02:11 648000 -- (-3391.358) (-3389.604) (-3394.047) [-3380.801] * (-3389.117) (-3384.958) (-3394.227) [-3384.453] -- 0:02:10 648500 -- [-3385.310] (-3387.365) (-3388.634) (-3383.933) * (-3384.231) (-3387.317) (-3392.509) [-3391.936] -- 0:02:10 649000 -- (-3389.319) [-3393.383] (-3383.972) (-3391.799) * (-3389.919) [-3387.653] (-3393.014) (-3383.978) -- 0:02:10 649500 -- (-3384.973) [-3385.701] (-3385.968) (-3388.344) * (-3388.938) (-3390.520) [-3386.038] (-3387.191) -- 0:02:10 650000 -- (-3388.654) [-3383.447] (-3394.108) (-3382.602) * (-3399.752) [-3387.423] (-3396.321) (-3393.913) -- 0:02:10 Average standard deviation of split frequencies: 0.000543 650500 -- [-3400.424] (-3389.455) (-3385.984) (-3388.935) * (-3397.823) [-3386.865] (-3395.841) (-3392.072) -- 0:02:10 651000 -- (-3393.871) (-3389.148) [-3392.382] (-3396.788) * (-3390.759) (-3390.252) [-3394.514] (-3382.537) -- 0:02:09 651500 -- (-3392.381) (-3393.110) [-3381.681] (-3382.657) * (-3393.215) (-3390.797) (-3397.823) [-3396.735] -- 0:02:09 652000 -- (-3390.928) (-3393.182) (-3388.355) [-3384.481] * [-3385.130] (-3386.098) (-3390.291) (-3389.353) -- 0:02:09 652500 -- (-3385.851) (-3386.398) (-3385.779) [-3383.659] * (-3385.970) [-3382.415] (-3385.734) (-3390.444) -- 0:02:09 653000 -- (-3380.448) [-3384.939] (-3387.402) (-3386.630) * (-3390.802) [-3391.432] (-3383.056) (-3392.474) -- 0:02:09 653500 -- (-3391.662) [-3383.460] (-3395.874) (-3393.646) * [-3388.078] (-3387.766) (-3386.173) (-3394.719) -- 0:02:08 654000 -- [-3383.948] (-3384.353) (-3400.288) (-3389.362) * [-3385.039] (-3385.476) (-3386.199) (-3385.165) -- 0:02:08 654500 -- (-3397.135) (-3390.190) [-3390.453] (-3382.302) * (-3387.484) (-3387.372) [-3388.953] (-3393.047) -- 0:02:08 655000 -- [-3387.434] (-3388.330) (-3399.059) (-3385.695) * (-3385.698) (-3392.876) (-3386.495) [-3389.981] -- 0:02:08 Average standard deviation of split frequencies: 0.000539 655500 -- [-3384.080] (-3385.770) (-3392.887) (-3381.466) * (-3387.778) (-3390.566) (-3383.410) [-3386.864] -- 0:02:08 656000 -- (-3393.435) (-3385.765) (-3388.556) [-3390.872] * [-3383.279] (-3388.932) (-3384.179) (-3387.294) -- 0:02:07 656500 -- (-3384.697) (-3388.564) [-3387.500] (-3389.951) * [-3382.802] (-3384.499) (-3390.530) (-3387.264) -- 0:02:07 657000 -- (-3387.580) [-3383.358] (-3395.760) (-3385.698) * (-3389.446) (-3385.749) (-3386.639) [-3387.981] -- 0:02:07 657500 -- (-3390.871) (-3384.727) (-3387.568) [-3389.413] * (-3386.181) (-3397.561) (-3392.630) [-3386.397] -- 0:02:07 658000 -- (-3390.252) (-3389.605) (-3394.197) [-3384.477] * (-3385.341) (-3399.943) (-3391.078) [-3384.185] -- 0:02:07 658500 -- (-3388.258) (-3386.130) [-3386.743] (-3387.163) * (-3389.592) [-3390.244] (-3384.176) (-3384.688) -- 0:02:07 659000 -- (-3392.443) (-3380.815) [-3385.911] (-3389.221) * (-3401.720) (-3383.601) [-3391.637] (-3391.531) -- 0:02:06 659500 -- (-3389.338) (-3380.989) [-3388.505] (-3382.521) * (-3400.318) (-3389.740) (-3392.050) [-3385.525] -- 0:02:06 660000 -- [-3388.272] (-3392.831) (-3392.999) (-3394.944) * (-3402.721) (-3390.047) [-3388.880] (-3396.394) -- 0:02:06 Average standard deviation of split frequencies: 0.000535 660500 -- (-3388.868) (-3386.172) (-3388.672) [-3385.779] * (-3391.484) (-3386.010) [-3379.183] (-3390.947) -- 0:02:06 661000 -- (-3383.379) (-3393.231) (-3386.476) [-3387.534] * (-3394.701) (-3395.784) [-3391.944] (-3389.296) -- 0:02:06 661500 -- (-3393.951) (-3388.763) [-3391.320] (-3384.052) * (-3389.957) (-3387.328) [-3385.722] (-3388.204) -- 0:02:05 662000 -- [-3385.451] (-3381.933) (-3390.691) (-3391.108) * (-3395.695) (-3397.312) [-3387.000] (-3392.078) -- 0:02:05 662500 -- [-3380.837] (-3385.363) (-3394.626) (-3388.802) * (-3387.537) (-3392.062) (-3387.244) [-3385.868] -- 0:02:05 663000 -- (-3390.687) (-3384.711) (-3390.588) [-3389.020] * (-3387.284) (-3387.022) (-3389.506) [-3382.150] -- 0:02:05 663500 -- (-3383.571) [-3380.920] (-3388.400) (-3382.449) * (-3382.959) [-3384.329] (-3387.510) (-3395.652) -- 0:02:05 664000 -- (-3387.580) [-3386.436] (-3393.844) (-3389.200) * (-3387.796) (-3386.675) [-3383.617] (-3386.059) -- 0:02:04 664500 -- (-3391.014) (-3386.934) (-3388.333) [-3386.152] * (-3391.487) (-3382.930) (-3382.922) [-3384.310] -- 0:02:04 665000 -- (-3398.203) (-3395.197) (-3392.143) [-3385.228] * (-3389.846) (-3395.288) [-3388.627] (-3394.438) -- 0:02:04 Average standard deviation of split frequencies: 0.000531 665500 -- [-3397.460] (-3389.231) (-3391.758) (-3386.350) * (-3386.022) (-3388.295) [-3385.773] (-3382.681) -- 0:02:04 666000 -- [-3389.945] (-3389.887) (-3388.623) (-3391.834) * [-3388.124] (-3384.083) (-3391.549) (-3390.533) -- 0:02:04 666500 -- (-3388.364) (-3381.380) (-3390.105) [-3388.109] * [-3395.538] (-3409.465) (-3393.172) (-3389.066) -- 0:02:04 667000 -- (-3382.869) [-3391.291] (-3391.799) (-3390.765) * (-3393.612) (-3394.560) [-3384.991] (-3386.177) -- 0:02:03 667500 -- (-3384.665) (-3391.341) (-3397.764) [-3386.561] * [-3391.029] (-3383.326) (-3384.250) (-3398.263) -- 0:02:03 668000 -- (-3391.413) [-3391.737] (-3389.735) (-3384.965) * (-3389.355) (-3382.998) (-3382.614) [-3385.317] -- 0:02:03 668500 -- [-3379.537] (-3385.595) (-3392.134) (-3389.640) * (-3387.362) (-3393.385) (-3385.246) [-3385.426] -- 0:02:03 669000 -- (-3385.647) (-3383.844) [-3390.914] (-3384.598) * [-3386.515] (-3386.432) (-3387.759) (-3382.636) -- 0:02:03 669500 -- (-3395.355) [-3385.224] (-3395.274) (-3380.608) * [-3383.973] (-3381.112) (-3381.973) (-3380.636) -- 0:02:02 670000 -- (-3393.417) (-3385.613) (-3392.421) [-3382.804] * (-3393.088) [-3387.194] (-3390.275) (-3388.446) -- 0:02:02 Average standard deviation of split frequencies: 0.000527 670500 -- (-3401.097) (-3388.067) (-3391.064) [-3382.747] * (-3388.251) (-3392.576) (-3377.764) [-3388.145] -- 0:02:02 671000 -- (-3391.107) (-3393.518) (-3392.731) [-3386.529] * (-3383.987) (-3387.241) [-3386.626] (-3398.484) -- 0:02:02 671500 -- (-3388.597) [-3390.316] (-3396.281) (-3393.059) * (-3396.283) [-3391.277] (-3385.908) (-3386.528) -- 0:02:02 672000 -- [-3388.396] (-3384.558) (-3382.298) (-3387.028) * (-3385.621) (-3389.058) [-3389.077] (-3388.590) -- 0:02:02 672500 -- [-3385.454] (-3382.867) (-3399.776) (-3391.143) * (-3386.377) (-3387.331) [-3390.718] (-3387.608) -- 0:02:01 673000 -- [-3382.981] (-3394.926) (-3391.284) (-3385.110) * [-3384.197] (-3385.046) (-3384.670) (-3387.464) -- 0:02:01 673500 -- (-3390.359) [-3387.288] (-3385.612) (-3390.255) * [-3389.370] (-3381.645) (-3391.306) (-3397.510) -- 0:02:01 674000 -- (-3397.365) (-3393.468) (-3384.707) [-3385.240] * (-3379.544) (-3391.651) [-3388.882] (-3391.439) -- 0:02:01 674500 -- (-3384.216) (-3387.755) (-3390.019) [-3385.483] * (-3384.725) (-3383.304) (-3388.302) [-3387.061] -- 0:02:01 675000 -- [-3380.326] (-3386.764) (-3386.440) (-3389.097) * (-3386.377) (-3391.286) [-3382.977] (-3385.219) -- 0:02:00 Average standard deviation of split frequencies: 0.000523 675500 -- [-3389.294] (-3388.082) (-3385.286) (-3393.744) * (-3390.726) (-3385.968) (-3388.905) [-3383.837] -- 0:02:00 676000 -- [-3390.776] (-3397.390) (-3384.889) (-3388.937) * [-3386.997] (-3385.833) (-3385.589) (-3387.894) -- 0:02:00 676500 -- (-3385.023) (-3393.394) (-3389.064) [-3381.867] * [-3386.386] (-3386.030) (-3390.789) (-3382.845) -- 0:02:00 677000 -- (-3386.052) (-3386.509) [-3386.364] (-3384.102) * (-3383.657) (-3386.755) [-3382.632] (-3387.780) -- 0:02:00 677500 -- (-3399.212) (-3388.599) (-3387.553) [-3385.134] * (-3390.388) (-3388.668) (-3382.642) [-3386.220] -- 0:01:59 678000 -- (-3388.507) (-3383.899) [-3384.933] (-3383.981) * (-3381.280) (-3391.359) [-3384.658] (-3391.824) -- 0:01:59 678500 -- (-3391.701) (-3386.660) (-3389.309) [-3389.793] * (-3384.217) (-3388.285) [-3391.131] (-3385.300) -- 0:01:59 679000 -- [-3384.235] (-3384.873) (-3390.297) (-3390.618) * (-3387.594) [-3379.599] (-3400.063) (-3390.911) -- 0:01:59 679500 -- (-3390.094) [-3384.788] (-3393.132) (-3387.834) * (-3390.478) [-3386.186] (-3391.832) (-3384.069) -- 0:01:59 680000 -- [-3384.957] (-3391.116) (-3394.335) (-3389.506) * (-3389.660) [-3386.343] (-3392.755) (-3400.315) -- 0:01:59 Average standard deviation of split frequencies: 0.000519 680500 -- (-3391.575) (-3383.523) [-3387.223] (-3384.295) * (-3384.404) [-3388.521] (-3383.593) (-3393.308) -- 0:01:58 681000 -- (-3391.192) (-3387.895) (-3390.793) [-3383.709] * [-3393.423] (-3386.267) (-3395.412) (-3385.498) -- 0:01:58 681500 -- (-3392.242) [-3389.988] (-3383.970) (-3393.567) * (-3385.318) [-3389.423] (-3389.950) (-3384.926) -- 0:01:58 682000 -- (-3382.232) (-3392.946) (-3382.626) [-3389.343] * (-3391.693) (-3385.573) (-3394.536) [-3383.863] -- 0:01:58 682500 -- [-3382.986] (-3390.299) (-3389.057) (-3386.759) * (-3387.526) (-3385.956) [-3387.421] (-3384.154) -- 0:01:58 683000 -- (-3390.354) (-3384.368) [-3386.763] (-3384.978) * (-3384.401) [-3388.815] (-3393.621) (-3392.529) -- 0:01:57 683500 -- (-3391.255) [-3385.068] (-3385.363) (-3393.639) * [-3384.126] (-3385.227) (-3385.274) (-3380.916) -- 0:01:57 684000 -- (-3394.511) (-3388.528) (-3387.236) [-3387.831] * (-3389.084) (-3383.553) [-3380.695] (-3392.603) -- 0:01:57 684500 -- (-3393.408) [-3384.102] (-3385.107) (-3386.625) * (-3392.796) [-3391.925] (-3389.866) (-3381.888) -- 0:01:57 685000 -- (-3388.647) (-3391.106) (-3387.552) [-3388.126] * (-3388.283) [-3389.722] (-3392.210) (-3392.330) -- 0:01:57 Average standard deviation of split frequencies: 0.000515 685500 -- [-3390.090] (-3382.537) (-3388.437) (-3393.371) * (-3385.042) [-3384.480] (-3399.935) (-3387.929) -- 0:01:56 686000 -- (-3402.311) (-3390.097) [-3386.599] (-3387.928) * (-3388.441) (-3386.101) [-3384.754] (-3385.876) -- 0:01:56 686500 -- (-3383.344) (-3388.117) (-3384.630) [-3385.112] * [-3382.815] (-3391.440) (-3381.958) (-3399.390) -- 0:01:56 687000 -- (-3383.594) (-3387.312) (-3384.453) [-3385.125] * (-3386.401) [-3386.577] (-3390.908) (-3394.813) -- 0:01:56 687500 -- [-3386.946] (-3387.665) (-3387.287) (-3381.651) * [-3383.182] (-3389.670) (-3401.866) (-3382.660) -- 0:01:56 688000 -- (-3386.251) (-3385.702) [-3386.952] (-3380.559) * (-3381.192) (-3387.979) (-3388.327) [-3386.836] -- 0:01:56 688500 -- (-3403.853) (-3384.600) [-3383.834] (-3391.119) * (-3389.998) (-3388.536) (-3391.607) [-3385.129] -- 0:01:55 689000 -- (-3392.976) [-3384.445] (-3388.049) (-3385.884) * [-3383.025] (-3387.931) (-3387.143) (-3386.863) -- 0:01:55 689500 -- (-3391.925) (-3391.575) (-3385.667) [-3392.448] * (-3397.496) (-3385.996) [-3383.973] (-3393.018) -- 0:01:55 690000 -- (-3387.008) (-3388.458) [-3380.077] (-3387.437) * (-3392.488) [-3380.728] (-3390.548) (-3383.975) -- 0:01:55 Average standard deviation of split frequencies: 0.000512 690500 -- [-3382.343] (-3385.634) (-3381.876) (-3386.294) * [-3389.321] (-3394.575) (-3391.259) (-3386.431) -- 0:01:55 691000 -- (-3382.282) [-3384.737] (-3388.983) (-3383.375) * (-3388.511) (-3395.168) (-3390.194) [-3386.036] -- 0:01:54 691500 -- (-3391.982) [-3386.269] (-3392.853) (-3380.353) * (-3386.544) (-3393.258) (-3387.827) [-3384.188] -- 0:01:54 692000 -- [-3390.275] (-3385.257) (-3389.823) (-3386.467) * (-3390.169) [-3389.759] (-3391.425) (-3386.146) -- 0:01:54 692500 -- (-3382.528) (-3388.064) [-3382.876] (-3380.627) * (-3387.963) (-3391.583) [-3393.126] (-3385.710) -- 0:01:54 693000 -- [-3380.091] (-3387.287) (-3390.865) (-3386.087) * (-3393.137) (-3388.590) [-3387.297] (-3384.493) -- 0:01:54 693500 -- [-3387.629] (-3383.446) (-3384.177) (-3391.550) * (-3401.932) (-3393.266) (-3385.973) [-3384.606] -- 0:01:54 694000 -- (-3391.340) [-3385.345] (-3390.481) (-3387.373) * (-3396.838) (-3388.465) (-3387.512) [-3391.414] -- 0:01:53 694500 -- [-3384.084] (-3389.311) (-3384.644) (-3382.849) * [-3387.844] (-3400.354) (-3386.760) (-3392.455) -- 0:01:53 695000 -- (-3387.410) (-3389.818) (-3392.480) [-3386.845] * (-3402.111) [-3386.836] (-3383.229) (-3389.975) -- 0:01:53 Average standard deviation of split frequencies: 0.000508 695500 -- (-3389.208) (-3391.549) [-3385.098] (-3385.869) * (-3392.991) (-3388.910) (-3386.260) [-3394.488] -- 0:01:53 696000 -- (-3384.335) [-3386.987] (-3391.891) (-3386.422) * [-3385.658] (-3385.626) (-3386.648) (-3392.602) -- 0:01:53 696500 -- (-3393.152) [-3383.801] (-3389.147) (-3382.724) * (-3394.748) [-3389.002] (-3383.256) (-3397.708) -- 0:01:52 697000 -- (-3386.199) (-3384.395) [-3391.238] (-3382.407) * (-3385.410) (-3387.537) (-3390.043) [-3383.608] -- 0:01:52 697500 -- (-3389.234) (-3381.012) (-3381.325) [-3391.033] * [-3386.321] (-3382.910) (-3387.095) (-3387.593) -- 0:01:52 698000 -- [-3386.610] (-3384.182) (-3396.527) (-3391.429) * [-3383.573] (-3393.533) (-3388.212) (-3387.990) -- 0:01:52 698500 -- (-3391.307) [-3383.901] (-3385.762) (-3386.171) * (-3386.481) [-3386.149] (-3389.334) (-3382.669) -- 0:01:52 699000 -- (-3388.294) (-3389.431) (-3383.235) [-3388.710] * (-3381.575) (-3391.441) (-3389.229) [-3384.843] -- 0:01:51 699500 -- (-3391.722) [-3388.383] (-3393.915) (-3389.777) * (-3394.298) [-3391.105] (-3386.599) (-3387.489) -- 0:01:51 700000 -- (-3389.855) [-3388.862] (-3386.234) (-3392.246) * (-3388.268) [-3392.026] (-3388.201) (-3390.638) -- 0:01:51 Average standard deviation of split frequencies: 0.000505 700500 -- (-3393.543) (-3383.888) (-3387.715) [-3387.434] * (-3386.993) [-3387.493] (-3389.729) (-3392.490) -- 0:01:51 701000 -- (-3391.660) [-3388.164] (-3384.711) (-3392.283) * [-3385.060] (-3386.953) (-3384.585) (-3401.378) -- 0:01:51 701500 -- (-3390.312) (-3388.408) [-3390.479] (-3384.875) * (-3385.607) [-3389.298] (-3388.782) (-3392.276) -- 0:01:51 702000 -- (-3388.977) (-3384.607) [-3389.632] (-3392.727) * [-3383.934] (-3387.387) (-3384.129) (-3392.998) -- 0:01:50 702500 -- (-3396.438) (-3400.245) [-3387.593] (-3392.015) * [-3383.180] (-3392.111) (-3388.385) (-3389.601) -- 0:01:50 703000 -- [-3396.307] (-3401.935) (-3398.822) (-3381.655) * [-3379.113] (-3388.679) (-3387.050) (-3382.055) -- 0:01:50 703500 -- (-3391.347) (-3390.578) (-3386.877) [-3386.683] * (-3388.464) [-3385.778] (-3389.439) (-3385.215) -- 0:01:50 704000 -- (-3389.918) (-3389.447) (-3381.336) [-3389.017] * (-3390.903) (-3398.257) (-3395.523) [-3382.234] -- 0:01:50 704500 -- (-3387.421) [-3390.107] (-3396.126) (-3391.349) * (-3392.962) (-3382.829) [-3379.583] (-3384.250) -- 0:01:49 705000 -- (-3403.772) (-3385.389) [-3386.810] (-3386.188) * (-3391.083) (-3384.135) [-3385.886] (-3384.493) -- 0:01:49 Average standard deviation of split frequencies: 0.000501 705500 -- (-3391.168) (-3391.833) [-3386.692] (-3397.299) * (-3385.690) (-3391.448) (-3389.779) [-3386.632] -- 0:01:49 706000 -- (-3387.097) [-3388.647] (-3394.364) (-3394.779) * (-3389.844) (-3385.821) (-3386.831) [-3387.015] -- 0:01:49 706500 -- [-3390.177] (-3389.386) (-3385.003) (-3388.228) * (-3385.506) (-3388.498) (-3384.539) [-3385.635] -- 0:01:49 707000 -- [-3392.543] (-3386.367) (-3389.171) (-3392.957) * [-3384.448] (-3385.510) (-3385.602) (-3393.552) -- 0:01:48 707500 -- [-3388.140] (-3384.207) (-3383.905) (-3388.041) * (-3388.545) (-3387.772) [-3382.975] (-3387.448) -- 0:01:48 708000 -- (-3387.069) (-3389.191) [-3382.997] (-3386.416) * (-3384.220) (-3383.844) (-3385.270) [-3386.946] -- 0:01:48 708500 -- (-3390.904) (-3392.250) (-3383.449) [-3383.356] * (-3386.254) (-3384.100) [-3388.866] (-3387.823) -- 0:01:48 709000 -- (-3387.101) (-3393.867) [-3386.088] (-3389.820) * (-3390.287) (-3385.436) (-3390.670) [-3385.658] -- 0:01:48 709500 -- (-3386.560) [-3388.171] (-3387.819) (-3392.769) * (-3396.365) [-3379.347] (-3394.498) (-3385.234) -- 0:01:48 710000 -- (-3383.807) [-3382.316] (-3388.702) (-3384.358) * (-3390.473) [-3386.416] (-3387.035) (-3392.178) -- 0:01:47 Average standard deviation of split frequencies: 0.000497 710500 -- (-3385.210) [-3390.116] (-3386.137) (-3385.263) * (-3393.575) (-3382.262) [-3387.749] (-3389.011) -- 0:01:47 711000 -- (-3395.461) (-3392.263) [-3388.634] (-3386.719) * (-3392.186) (-3388.785) (-3384.246) [-3382.424] -- 0:01:47 711500 -- (-3395.139) (-3397.169) (-3385.008) [-3392.324] * (-3386.891) (-3383.624) [-3381.987] (-3383.099) -- 0:01:47 712000 -- [-3392.862] (-3398.296) (-3389.379) (-3387.808) * (-3385.324) (-3396.950) (-3385.756) [-3388.764] -- 0:01:47 712500 -- [-3388.100] (-3387.695) (-3386.539) (-3389.347) * [-3380.460] (-3392.858) (-3396.755) (-3393.522) -- 0:01:46 713000 -- [-3387.149] (-3395.845) (-3394.281) (-3392.483) * (-3390.798) (-3394.883) [-3387.665] (-3389.327) -- 0:01:46 713500 -- (-3388.682) (-3390.580) [-3382.778] (-3386.603) * (-3385.741) (-3394.903) [-3385.916] (-3386.177) -- 0:01:46 714000 -- (-3386.839) (-3395.746) [-3385.862] (-3388.980) * (-3388.528) (-3401.527) (-3391.072) [-3394.529] -- 0:01:46 714500 -- (-3387.143) (-3395.772) (-3389.141) [-3385.382] * [-3386.189] (-3392.556) (-3390.048) (-3387.268) -- 0:01:46 715000 -- [-3387.826] (-3388.482) (-3385.397) (-3393.304) * (-3383.548) (-3390.002) (-3384.602) [-3383.770] -- 0:01:46 Average standard deviation of split frequencies: 0.000494 715500 -- (-3392.626) (-3395.419) [-3386.893] (-3391.591) * (-3393.995) (-3392.575) (-3390.257) [-3383.502] -- 0:01:45 716000 -- (-3385.894) (-3386.762) (-3387.902) [-3392.854] * [-3385.342] (-3392.655) (-3385.398) (-3384.431) -- 0:01:45 716500 -- (-3388.832) (-3389.449) [-3390.605] (-3381.727) * [-3391.721] (-3388.104) (-3386.245) (-3393.656) -- 0:01:45 717000 -- [-3384.631] (-3386.828) (-3391.535) (-3393.690) * (-3385.490) (-3393.758) (-3383.012) [-3393.876] -- 0:01:45 717500 -- (-3385.766) [-3381.380] (-3392.066) (-3389.714) * (-3389.901) (-3391.125) [-3386.791] (-3388.622) -- 0:01:45 718000 -- (-3395.233) [-3381.185] (-3382.556) (-3389.759) * (-3382.876) (-3383.295) [-3383.567] (-3392.865) -- 0:01:44 718500 -- (-3383.518) (-3393.848) (-3390.543) [-3395.445] * (-3388.304) [-3383.489] (-3394.161) (-3386.621) -- 0:01:44 719000 -- [-3388.742] (-3391.128) (-3385.875) (-3402.104) * (-3390.381) [-3383.326] (-3395.128) (-3390.864) -- 0:01:44 719500 -- (-3389.348) (-3383.198) (-3396.206) [-3398.907] * [-3391.125] (-3386.438) (-3389.535) (-3385.883) -- 0:01:44 720000 -- (-3388.024) (-3383.619) [-3389.511] (-3384.824) * (-3385.651) (-3389.128) (-3392.101) [-3389.516] -- 0:01:44 Average standard deviation of split frequencies: 0.000491 720500 -- (-3384.656) [-3390.352] (-3397.413) (-3392.067) * (-3391.597) [-3388.923] (-3383.844) (-3385.733) -- 0:01:43 721000 -- [-3384.245] (-3385.247) (-3384.045) (-3384.075) * (-3386.460) [-3381.798] (-3387.765) (-3383.730) -- 0:01:43 721500 -- (-3392.222) (-3381.547) (-3391.151) [-3386.195] * [-3391.582] (-3386.001) (-3392.093) (-3393.014) -- 0:01:43 722000 -- [-3388.171] (-3384.798) (-3392.569) (-3389.218) * [-3393.882] (-3385.807) (-3382.460) (-3390.227) -- 0:01:43 722500 -- (-3389.363) (-3386.728) [-3388.258] (-3387.743) * (-3390.825) (-3387.242) (-3389.595) [-3387.531] -- 0:01:43 723000 -- (-3389.360) [-3395.361] (-3385.681) (-3392.853) * (-3388.191) [-3381.074] (-3385.097) (-3388.774) -- 0:01:43 723500 -- (-3386.140) (-3395.859) (-3382.718) [-3389.964] * (-3401.540) [-3385.748] (-3391.967) (-3384.050) -- 0:01:42 724000 -- (-3400.692) (-3393.120) [-3381.257] (-3388.620) * (-3391.870) (-3395.668) [-3386.559] (-3396.848) -- 0:01:42 724500 -- (-3392.321) [-3387.602] (-3399.505) (-3384.636) * (-3387.240) [-3391.468] (-3391.097) (-3390.284) -- 0:01:42 725000 -- (-3396.343) (-3389.669) [-3387.305] (-3393.400) * (-3390.772) (-3390.170) (-3383.171) [-3390.914] -- 0:01:42 Average standard deviation of split frequencies: 0.000487 725500 -- [-3390.095] (-3391.171) (-3389.632) (-3396.324) * (-3393.307) (-3389.039) [-3385.162] (-3383.862) -- 0:01:42 726000 -- (-3386.393) [-3386.331] (-3389.978) (-3391.609) * (-3382.984) [-3378.902] (-3385.760) (-3388.599) -- 0:01:41 726500 -- (-3381.775) [-3387.632] (-3392.478) (-3385.096) * (-3394.226) (-3380.768) (-3392.497) [-3388.459] -- 0:01:41 727000 -- (-3382.677) (-3381.698) (-3389.916) [-3388.674] * (-3388.055) [-3384.734] (-3391.604) (-3384.364) -- 0:01:41 727500 -- [-3389.098] (-3380.989) (-3393.249) (-3393.031) * (-3390.548) (-3386.668) (-3393.196) [-3388.310] -- 0:01:41 728000 -- [-3383.253] (-3385.926) (-3389.285) (-3399.870) * (-3386.398) (-3391.139) [-3393.984] (-3390.383) -- 0:01:41 728500 -- (-3387.646) (-3392.187) (-3387.602) [-3386.997] * [-3384.991] (-3391.252) (-3394.265) (-3381.578) -- 0:01:40 729000 -- (-3390.035) (-3384.707) [-3387.925] (-3393.698) * [-3381.789] (-3389.496) (-3393.015) (-3387.287) -- 0:01:40 729500 -- [-3385.714] (-3386.611) (-3388.182) (-3389.727) * (-3388.555) (-3394.949) (-3387.870) [-3391.869] -- 0:01:40 730000 -- [-3381.614] (-3384.548) (-3386.707) (-3391.283) * [-3390.805] (-3388.255) (-3393.820) (-3379.034) -- 0:01:40 Average standard deviation of split frequencies: 0.000484 730500 -- [-3383.925] (-3384.602) (-3388.620) (-3386.970) * (-3384.738) [-3383.192] (-3392.894) (-3390.298) -- 0:01:40 731000 -- [-3390.103] (-3391.271) (-3395.658) (-3399.225) * (-3381.250) [-3384.619] (-3385.809) (-3389.973) -- 0:01:40 731500 -- (-3388.873) [-3382.501] (-3391.118) (-3398.615) * (-3386.429) (-3391.930) (-3388.545) [-3390.281] -- 0:01:39 732000 -- [-3381.290] (-3389.514) (-3390.052) (-3390.272) * [-3383.359] (-3394.773) (-3383.121) (-3394.030) -- 0:01:39 732500 -- (-3397.788) (-3389.917) (-3379.707) [-3393.583] * (-3390.761) [-3392.597] (-3389.573) (-3386.566) -- 0:01:39 733000 -- (-3392.683) [-3384.969] (-3386.921) (-3395.298) * (-3393.087) (-3384.808) [-3389.706] (-3384.674) -- 0:01:39 733500 -- [-3390.491] (-3384.094) (-3392.238) (-3397.909) * (-3386.809) [-3383.987] (-3392.119) (-3385.374) -- 0:01:39 734000 -- (-3394.499) [-3392.487] (-3386.702) (-3393.039) * (-3387.487) [-3383.792] (-3395.384) (-3385.349) -- 0:01:38 734500 -- (-3388.577) [-3392.653] (-3383.011) (-3396.279) * [-3386.171] (-3384.010) (-3391.550) (-3386.241) -- 0:01:38 735000 -- (-3386.303) (-3382.359) [-3383.651] (-3392.800) * (-3391.942) (-3383.220) (-3391.925) [-3384.788] -- 0:01:38 Average standard deviation of split frequencies: 0.000480 735500 -- (-3395.458) [-3379.796] (-3384.514) (-3384.892) * (-3392.722) [-3388.763] (-3388.732) (-3381.274) -- 0:01:38 736000 -- (-3390.520) (-3389.852) (-3383.650) [-3391.692] * (-3396.086) (-3392.221) [-3389.256] (-3387.428) -- 0:01:38 736500 -- (-3395.548) [-3384.458] (-3386.197) (-3383.246) * (-3387.099) [-3390.829] (-3395.836) (-3389.354) -- 0:01:38 737000 -- (-3392.956) (-3388.650) (-3382.666) [-3386.313] * (-3387.103) [-3382.060] (-3387.421) (-3383.888) -- 0:01:37 737500 -- (-3390.352) (-3386.688) (-3386.408) [-3388.563] * [-3389.421] (-3385.572) (-3383.852) (-3385.565) -- 0:01:37 738000 -- (-3393.413) (-3394.933) (-3384.873) [-3386.367] * [-3387.359] (-3391.105) (-3386.339) (-3396.980) -- 0:01:37 738500 -- (-3383.214) [-3385.496] (-3392.527) (-3388.787) * (-3394.015) (-3384.244) [-3391.579] (-3389.826) -- 0:01:37 739000 -- (-3390.429) [-3382.392] (-3387.920) (-3383.674) * (-3386.092) (-3390.077) [-3383.477] (-3384.835) -- 0:01:37 739500 -- (-3387.287) [-3388.625] (-3384.862) (-3389.007) * (-3388.604) (-3384.132) (-3378.192) [-3394.058] -- 0:01:36 740000 -- (-3390.586) [-3388.667] (-3394.648) (-3386.832) * (-3388.185) (-3387.215) (-3383.542) [-3384.136] -- 0:01:36 Average standard deviation of split frequencies: 0.000477 740500 -- (-3388.945) (-3385.876) (-3387.566) [-3384.199] * [-3384.728] (-3385.045) (-3388.412) (-3388.028) -- 0:01:36 741000 -- [-3388.032] (-3392.323) (-3385.844) (-3389.984) * (-3384.111) [-3385.856] (-3397.644) (-3385.386) -- 0:01:36 741500 -- (-3387.996) (-3388.978) [-3382.261] (-3386.524) * (-3393.451) (-3390.429) (-3389.334) [-3388.163] -- 0:01:36 742000 -- (-3384.987) (-3387.686) (-3389.269) [-3384.455] * [-3384.668] (-3397.831) (-3382.565) (-3384.998) -- 0:01:35 742500 -- (-3388.102) [-3395.797] (-3396.480) (-3379.582) * [-3383.501] (-3389.251) (-3388.684) (-3386.401) -- 0:01:35 743000 -- (-3382.868) (-3394.368) [-3382.410] (-3397.563) * [-3390.340] (-3390.776) (-3399.769) (-3386.826) -- 0:01:35 743500 -- (-3391.143) [-3388.037] (-3389.524) (-3389.641) * (-3386.451) (-3394.412) (-3386.005) [-3384.138] -- 0:01:35 744000 -- (-3384.098) (-3394.361) [-3387.882] (-3394.810) * (-3392.592) (-3385.806) (-3391.974) [-3388.842] -- 0:01:35 744500 -- (-3379.636) (-3396.374) (-3389.477) [-3391.474] * (-3395.348) (-3389.587) (-3384.095) [-3386.627] -- 0:01:35 745000 -- (-3385.470) [-3386.482] (-3384.551) (-3398.785) * (-3384.591) (-3393.299) (-3394.951) [-3390.220] -- 0:01:34 Average standard deviation of split frequencies: 0.000474 745500 -- (-3389.946) (-3381.431) [-3392.021] (-3384.810) * (-3389.661) (-3391.919) (-3387.294) [-3388.255] -- 0:01:34 746000 -- (-3399.672) (-3389.490) [-3383.056] (-3386.826) * (-3400.412) (-3390.603) (-3391.218) [-3390.826] -- 0:01:34 746500 -- [-3383.984] (-3389.250) (-3390.210) (-3382.902) * (-3393.314) [-3391.262] (-3384.559) (-3390.618) -- 0:01:34 747000 -- [-3379.657] (-3393.081) (-3387.743) (-3391.517) * (-3391.005) (-3389.633) [-3390.206] (-3393.215) -- 0:01:34 747500 -- (-3391.070) (-3385.252) [-3384.538] (-3384.818) * (-3385.030) [-3383.656] (-3396.477) (-3393.176) -- 0:01:33 748000 -- (-3382.831) (-3389.275) [-3388.926] (-3386.906) * [-3387.350] (-3384.578) (-3385.029) (-3394.721) -- 0:01:33 748500 -- (-3390.054) (-3399.291) [-3386.777] (-3383.652) * (-3394.867) (-3387.679) [-3387.814] (-3389.858) -- 0:01:33 749000 -- (-3399.211) [-3382.614] (-3384.587) (-3384.007) * (-3388.655) [-3388.316] (-3387.544) (-3394.344) -- 0:01:33 749500 -- (-3382.505) (-3388.792) (-3384.665) [-3390.403] * (-3385.589) (-3384.391) (-3396.045) [-3388.329] -- 0:01:33 750000 -- (-3386.144) [-3382.433] (-3395.701) (-3387.038) * [-3388.848] (-3391.633) (-3391.481) (-3393.437) -- 0:01:33 Average standard deviation of split frequencies: 0.000471 750500 -- (-3387.198) [-3389.989] (-3386.229) (-3389.827) * (-3385.523) (-3391.138) [-3382.704] (-3402.823) -- 0:01:32 751000 -- [-3383.741] (-3390.500) (-3393.567) (-3387.105) * [-3385.213] (-3399.187) (-3390.954) (-3391.516) -- 0:01:32 751500 -- [-3391.402] (-3390.768) (-3387.746) (-3386.364) * (-3388.192) [-3389.483] (-3393.608) (-3389.215) -- 0:01:32 752000 -- (-3384.719) (-3386.171) [-3392.949] (-3386.282) * (-3393.337) [-3385.816] (-3392.017) (-3386.690) -- 0:01:32 752500 -- (-3386.994) (-3386.116) (-3388.582) [-3380.954] * (-3384.893) (-3388.980) [-3386.612] (-3387.809) -- 0:01:32 753000 -- [-3390.043] (-3387.700) (-3384.521) (-3395.057) * (-3388.534) (-3386.589) [-3390.977] (-3388.097) -- 0:01:31 753500 -- (-3386.034) (-3390.977) [-3378.465] (-3390.397) * (-3396.439) [-3389.649] (-3391.206) (-3389.360) -- 0:01:31 754000 -- (-3388.827) (-3392.147) [-3386.538] (-3395.573) * (-3383.589) (-3387.574) (-3393.224) [-3386.368] -- 0:01:31 754500 -- (-3387.908) (-3390.776) [-3386.379] (-3394.443) * [-3380.769] (-3392.685) (-3388.400) (-3383.173) -- 0:01:31 755000 -- (-3391.962) [-3384.499] (-3385.968) (-3388.702) * (-3393.905) (-3398.184) (-3385.279) [-3384.884] -- 0:01:31 Average standard deviation of split frequencies: 0.000468 755500 -- (-3384.522) (-3393.541) [-3389.711] (-3387.625) * [-3393.779] (-3388.629) (-3386.113) (-3397.270) -- 0:01:30 756000 -- (-3404.013) [-3386.308] (-3381.392) (-3383.391) * (-3385.202) (-3394.892) [-3386.083] (-3387.551) -- 0:01:30 756500 -- (-3389.899) (-3390.752) [-3392.603] (-3397.557) * (-3385.639) (-3386.320) [-3383.487] (-3387.125) -- 0:01:30 757000 -- (-3384.923) (-3380.817) [-3389.570] (-3390.398) * [-3392.721] (-3387.658) (-3391.411) (-3387.654) -- 0:01:30 757500 -- [-3391.818] (-3385.611) (-3396.686) (-3392.862) * (-3392.853) (-3383.035) [-3384.395] (-3389.540) -- 0:01:30 758000 -- (-3391.658) (-3392.387) (-3383.418) [-3389.723] * (-3389.814) [-3396.163] (-3389.351) (-3390.725) -- 0:01:30 758500 -- (-3392.516) (-3398.205) (-3383.256) [-3382.514] * (-3388.728) (-3387.291) (-3386.078) [-3381.850] -- 0:01:29 759000 -- (-3394.522) (-3394.521) (-3382.875) [-3389.601] * (-3390.750) (-3385.605) (-3388.798) [-3383.948] -- 0:01:29 759500 -- (-3382.490) [-3388.793] (-3394.439) (-3390.526) * (-3389.968) [-3379.122] (-3388.630) (-3389.823) -- 0:01:29 760000 -- (-3382.862) (-3383.138) [-3384.964] (-3391.408) * (-3383.495) (-3385.581) (-3392.843) [-3380.493] -- 0:01:29 Average standard deviation of split frequencies: 0.000465 760500 -- (-3386.271) [-3387.579] (-3394.240) (-3388.165) * (-3387.704) (-3382.618) (-3390.842) [-3385.599] -- 0:01:29 761000 -- [-3385.299] (-3385.849) (-3386.661) (-3380.576) * (-3383.676) (-3386.470) (-3396.346) [-3384.412] -- 0:01:28 761500 -- (-3388.871) [-3388.512] (-3385.662) (-3385.329) * (-3382.169) (-3386.710) [-3388.783] (-3384.359) -- 0:01:28 762000 -- (-3388.141) [-3386.284] (-3399.313) (-3402.797) * (-3382.639) (-3391.747) (-3388.609) [-3386.963] -- 0:01:28 762500 -- (-3387.085) [-3381.149] (-3387.979) (-3402.706) * (-3388.298) (-3384.385) (-3390.241) [-3390.832] -- 0:01:28 763000 -- (-3388.391) (-3389.665) (-3382.228) [-3389.453] * (-3392.487) (-3388.091) (-3390.600) [-3390.870] -- 0:01:28 763500 -- (-3389.350) [-3385.561] (-3384.654) (-3388.123) * (-3384.802) (-3380.953) (-3389.697) [-3391.751] -- 0:01:27 764000 -- (-3391.452) (-3388.893) (-3393.562) [-3396.758] * (-3391.069) (-3386.964) [-3394.592] (-3395.247) -- 0:01:27 764500 -- (-3386.888) [-3384.496] (-3392.766) (-3398.432) * (-3386.383) (-3385.631) [-3390.654] (-3387.449) -- 0:01:27 765000 -- (-3385.270) (-3390.984) (-3388.954) [-3382.012] * (-3389.979) [-3386.334] (-3388.549) (-3383.796) -- 0:01:27 Average standard deviation of split frequencies: 0.000462 765500 -- (-3385.076) [-3385.766] (-3386.186) (-3394.171) * (-3389.711) (-3396.113) (-3389.234) [-3387.572] -- 0:01:27 766000 -- (-3392.582) (-3385.613) [-3389.317] (-3393.771) * (-3383.534) [-3386.771] (-3387.756) (-3386.196) -- 0:01:27 766500 -- (-3396.785) (-3386.973) (-3392.905) [-3385.571] * (-3388.294) (-3389.974) (-3393.386) [-3385.490] -- 0:01:26 767000 -- (-3381.203) (-3391.099) (-3394.153) [-3386.203] * (-3383.339) (-3385.294) [-3388.767] (-3385.570) -- 0:01:26 767500 -- [-3382.329] (-3387.098) (-3390.885) (-3388.873) * (-3382.007) [-3392.327] (-3388.053) (-3392.124) -- 0:01:26 768000 -- (-3397.466) [-3396.725] (-3391.231) (-3391.011) * (-3388.696) (-3385.671) [-3390.125] (-3388.304) -- 0:01:26 768500 -- (-3390.228) (-3389.931) (-3389.928) [-3392.545] * (-3392.460) (-3387.201) [-3387.434] (-3389.583) -- 0:01:26 769000 -- [-3384.783] (-3393.799) (-3389.459) (-3392.012) * (-3391.467) (-3389.576) [-3386.840] (-3393.693) -- 0:01:25 769500 -- (-3386.583) [-3394.831] (-3389.350) (-3396.630) * (-3397.924) (-3389.542) (-3400.357) [-3393.132] -- 0:01:25 770000 -- (-3395.255) (-3392.367) [-3388.129] (-3392.633) * (-3394.992) (-3384.925) (-3380.975) [-3381.441] -- 0:01:25 Average standard deviation of split frequencies: 0.000459 770500 -- (-3391.468) [-3385.337] (-3379.041) (-3391.212) * [-3381.450] (-3390.081) (-3379.646) (-3382.422) -- 0:01:25 771000 -- [-3384.630] (-3392.030) (-3388.330) (-3394.391) * (-3386.418) (-3393.300) (-3384.714) [-3382.325] -- 0:01:25 771500 -- [-3392.379] (-3382.614) (-3384.116) (-3386.664) * (-3401.157) (-3384.542) (-3386.249) [-3384.009] -- 0:01:25 772000 -- (-3389.362) [-3390.379] (-3397.198) (-3393.747) * (-3388.471) (-3387.507) [-3385.425] (-3384.856) -- 0:01:24 772500 -- (-3388.429) [-3386.062] (-3383.688) (-3383.063) * (-3384.682) [-3384.772] (-3397.711) (-3392.300) -- 0:01:24 773000 -- (-3382.724) [-3390.348] (-3388.612) (-3398.234) * (-3380.181) (-3387.563) (-3395.324) [-3384.235] -- 0:01:24 773500 -- (-3393.337) (-3392.363) (-3392.822) [-3392.944] * [-3382.496] (-3390.425) (-3393.120) (-3380.591) -- 0:01:24 774000 -- (-3399.034) [-3386.867] (-3391.305) (-3388.775) * (-3390.564) (-3387.374) (-3391.075) [-3386.209] -- 0:01:24 774500 -- (-3396.463) (-3386.975) (-3387.503) [-3393.853] * (-3387.841) (-3395.308) (-3387.463) [-3380.591] -- 0:01:23 775000 -- (-3386.417) (-3396.264) [-3386.389] (-3390.721) * (-3388.843) [-3384.226] (-3380.288) (-3383.376) -- 0:01:23 Average standard deviation of split frequencies: 0.000456 775500 -- (-3390.440) (-3388.163) [-3387.009] (-3391.413) * (-3385.410) (-3391.432) [-3383.271] (-3386.934) -- 0:01:23 776000 -- [-3393.581] (-3385.747) (-3384.233) (-3383.848) * (-3384.654) (-3389.145) [-3384.193] (-3380.174) -- 0:01:23 776500 -- (-3387.592) (-3388.288) [-3387.198] (-3386.203) * (-3396.284) (-3393.577) [-3383.413] (-3384.693) -- 0:01:23 777000 -- (-3386.609) (-3384.938) [-3392.542] (-3387.813) * (-3389.116) (-3388.930) [-3384.894] (-3391.563) -- 0:01:22 777500 -- (-3383.855) (-3381.487) (-3398.367) [-3388.948] * [-3385.853] (-3388.692) (-3396.068) (-3384.900) -- 0:01:22 778000 -- [-3390.564] (-3391.613) (-3393.455) (-3390.332) * (-3390.970) [-3382.214] (-3389.543) (-3383.810) -- 0:01:22 778500 -- [-3393.381] (-3382.749) (-3388.970) (-3392.313) * (-3391.123) [-3387.252] (-3387.411) (-3382.246) -- 0:01:22 779000 -- (-3387.536) (-3386.386) (-3389.048) [-3389.944] * (-3390.995) [-3390.472] (-3393.775) (-3384.426) -- 0:01:22 779500 -- (-3391.545) (-3394.816) (-3391.643) [-3383.086] * [-3385.312] (-3395.479) (-3388.155) (-3386.048) -- 0:01:22 780000 -- (-3385.793) (-3392.345) (-3388.425) [-3384.026] * [-3388.517] (-3390.570) (-3392.045) (-3390.347) -- 0:01:21 Average standard deviation of split frequencies: 0.000453 780500 -- (-3385.203) [-3390.006] (-3389.273) (-3389.044) * (-3387.182) [-3386.033] (-3393.125) (-3390.632) -- 0:01:21 781000 -- (-3392.304) [-3393.953] (-3386.266) (-3386.802) * (-3386.497) (-3383.933) (-3394.224) [-3381.791] -- 0:01:21 781500 -- (-3390.986) (-3396.515) [-3389.970] (-3382.901) * (-3389.076) [-3392.316] (-3390.772) (-3386.546) -- 0:01:21 782000 -- (-3391.256) [-3385.537] (-3382.907) (-3391.989) * (-3386.440) [-3384.789] (-3397.080) (-3386.839) -- 0:01:21 782500 -- (-3388.481) (-3381.839) (-3385.666) [-3390.351] * (-3385.546) [-3383.802] (-3395.575) (-3386.474) -- 0:01:20 783000 -- (-3387.293) [-3383.802] (-3390.703) (-3388.042) * (-3380.209) (-3383.528) [-3392.627] (-3390.807) -- 0:01:20 783500 -- [-3381.465] (-3385.454) (-3384.135) (-3390.526) * (-3385.775) [-3390.194] (-3391.769) (-3390.871) -- 0:01:20 784000 -- (-3396.513) (-3387.027) [-3383.849] (-3383.557) * (-3390.190) (-3391.014) (-3394.756) [-3384.374] -- 0:01:20 784500 -- (-3383.973) (-3398.912) [-3388.142] (-3385.648) * (-3384.662) (-3380.939) [-3385.348] (-3384.181) -- 0:01:20 785000 -- (-3386.426) [-3385.762] (-3393.414) (-3390.134) * [-3386.815] (-3387.696) (-3390.560) (-3386.673) -- 0:01:19 Average standard deviation of split frequencies: 0.000450 785500 -- (-3383.232) (-3385.740) (-3389.885) [-3384.974] * (-3384.211) [-3385.537] (-3384.043) (-3393.429) -- 0:01:19 786000 -- (-3387.327) (-3385.690) (-3393.742) [-3389.330] * (-3388.986) (-3385.613) [-3385.632] (-3391.029) -- 0:01:19 786500 -- [-3387.530] (-3388.243) (-3387.226) (-3390.165) * (-3385.590) (-3396.983) (-3390.268) [-3388.754] -- 0:01:19 787000 -- (-3391.375) [-3383.646] (-3393.810) (-3392.610) * [-3385.566] (-3389.547) (-3395.247) (-3387.618) -- 0:01:19 787500 -- (-3390.374) (-3392.021) (-3387.016) [-3384.589] * (-3391.526) [-3383.859] (-3384.765) (-3386.473) -- 0:01:19 788000 -- (-3386.075) (-3389.108) (-3389.496) [-3389.969] * (-3388.414) [-3384.075] (-3387.136) (-3386.067) -- 0:01:18 788500 -- (-3389.375) [-3393.655] (-3381.460) (-3390.118) * (-3392.124) [-3384.951] (-3397.824) (-3382.410) -- 0:01:18 789000 -- (-3400.231) (-3391.745) (-3381.743) [-3386.840] * (-3383.622) (-3385.101) [-3388.242] (-3396.252) -- 0:01:18 789500 -- (-3405.841) (-3385.178) (-3382.232) [-3383.145] * [-3387.356] (-3398.708) (-3382.687) (-3389.992) -- 0:01:18 790000 -- (-3393.266) (-3386.902) [-3385.290] (-3391.121) * (-3387.080) (-3387.734) (-3395.411) [-3384.366] -- 0:01:18 Average standard deviation of split frequencies: 0.000447 790500 -- (-3401.077) [-3388.331] (-3385.462) (-3394.271) * [-3384.544] (-3389.371) (-3386.317) (-3393.693) -- 0:01:17 791000 -- (-3388.940) (-3393.636) [-3386.167] (-3382.972) * [-3388.834] (-3383.970) (-3385.042) (-3390.539) -- 0:01:17 791500 -- (-3389.998) [-3389.013] (-3387.987) (-3383.281) * (-3393.167) (-3401.089) [-3380.495] (-3393.741) -- 0:01:17 792000 -- [-3385.217] (-3383.328) (-3396.219) (-3384.991) * (-3388.338) (-3387.423) [-3385.452] (-3388.800) -- 0:01:17 792500 -- (-3388.818) [-3390.332] (-3385.425) (-3378.727) * [-3384.401] (-3389.291) (-3388.135) (-3390.035) -- 0:01:17 793000 -- (-3387.205) (-3381.335) (-3388.515) [-3385.955] * (-3390.284) [-3393.302] (-3387.175) (-3388.202) -- 0:01:17 793500 -- (-3387.584) (-3388.609) [-3386.569] (-3397.668) * (-3387.783) (-3389.940) [-3390.788] (-3388.368) -- 0:01:16 794000 -- (-3394.528) (-3389.666) (-3389.874) [-3387.162] * (-3385.844) (-3385.283) (-3388.336) [-3383.471] -- 0:01:16 794500 -- [-3390.980] (-3387.604) (-3394.346) (-3395.033) * (-3395.968) (-3387.308) [-3387.136] (-3394.106) -- 0:01:16 795000 -- [-3384.289] (-3394.956) (-3395.857) (-3388.847) * [-3386.308] (-3400.372) (-3385.209) (-3388.990) -- 0:01:16 Average standard deviation of split frequencies: 0.000444 795500 -- (-3384.993) [-3383.689] (-3399.046) (-3384.273) * [-3388.339] (-3388.362) (-3389.257) (-3390.446) -- 0:01:16 796000 -- (-3391.240) (-3383.895) [-3388.376] (-3388.735) * [-3388.878] (-3385.818) (-3387.903) (-3388.118) -- 0:01:15 796500 -- (-3383.270) [-3385.648] (-3385.577) (-3387.692) * [-3387.342] (-3387.516) (-3387.869) (-3388.480) -- 0:01:15 797000 -- (-3382.539) (-3389.417) (-3399.869) [-3385.175] * [-3388.000] (-3394.274) (-3393.107) (-3391.222) -- 0:01:15 797500 -- (-3382.216) [-3385.054] (-3384.676) (-3388.467) * [-3384.607] (-3390.430) (-3390.008) (-3386.945) -- 0:01:15 798000 -- (-3389.142) [-3386.849] (-3395.345) (-3390.755) * (-3386.998) (-3391.121) (-3385.512) [-3381.940] -- 0:01:15 798500 -- [-3388.446] (-3383.094) (-3384.897) (-3388.463) * (-3385.609) (-3391.093) (-3384.428) [-3391.837] -- 0:01:14 799000 -- (-3383.374) (-3384.358) [-3384.958] (-3387.766) * (-3396.383) [-3389.307] (-3388.041) (-3384.464) -- 0:01:14 799500 -- (-3394.143) (-3383.817) [-3387.684] (-3384.002) * [-3387.369] (-3387.049) (-3385.642) (-3386.989) -- 0:01:14 800000 -- (-3385.843) (-3395.372) (-3387.469) [-3392.812] * (-3390.249) [-3385.419] (-3389.770) (-3395.886) -- 0:01:14 Average standard deviation of split frequencies: 0.000442 800500 -- (-3389.900) (-3391.322) [-3382.738] (-3386.483) * [-3387.371] (-3394.095) (-3389.146) (-3388.985) -- 0:01:14 801000 -- (-3384.510) (-3381.766) [-3386.694] (-3390.013) * (-3385.694) (-3389.313) [-3388.752] (-3385.111) -- 0:01:14 801500 -- [-3392.747] (-3392.731) (-3385.508) (-3391.922) * (-3384.425) [-3388.828] (-3387.346) (-3392.868) -- 0:01:13 802000 -- [-3386.708] (-3391.048) (-3386.127) (-3398.691) * (-3396.197) (-3388.485) [-3381.901] (-3392.431) -- 0:01:13 802500 -- (-3389.922) [-3384.612] (-3388.713) (-3397.392) * [-3383.729] (-3389.781) (-3382.259) (-3391.623) -- 0:01:13 803000 -- (-3390.997) (-3383.495) (-3385.717) [-3399.427] * (-3387.079) (-3388.317) [-3386.721] (-3392.795) -- 0:01:13 803500 -- [-3389.593] (-3390.401) (-3385.817) (-3394.907) * (-3387.434) [-3385.887] (-3383.921) (-3389.360) -- 0:01:13 804000 -- [-3388.365] (-3385.945) (-3398.322) (-3390.879) * (-3385.506) (-3383.417) [-3384.616] (-3387.344) -- 0:01:12 804500 -- (-3382.454) (-3395.313) (-3395.088) [-3387.081] * (-3383.992) [-3385.549] (-3393.739) (-3382.149) -- 0:01:12 805000 -- (-3388.336) [-3382.937] (-3385.280) (-3394.443) * (-3382.577) (-3387.779) [-3384.860] (-3387.339) -- 0:01:12 Average standard deviation of split frequencies: 0.000439 805500 -- (-3385.037) (-3389.539) (-3386.679) [-3391.597] * (-3387.444) (-3386.786) (-3395.225) [-3389.028] -- 0:01:12 806000 -- (-3389.585) (-3386.748) [-3390.246] (-3399.959) * (-3391.937) (-3389.812) [-3380.833] (-3384.211) -- 0:01:12 806500 -- [-3389.528] (-3386.347) (-3389.586) (-3394.354) * (-3385.897) [-3387.722] (-3390.594) (-3380.811) -- 0:01:11 807000 -- (-3391.719) (-3385.460) [-3394.200] (-3393.189) * (-3383.850) (-3390.820) (-3383.244) [-3387.690] -- 0:01:11 807500 -- (-3388.684) (-3388.551) (-3394.545) [-3383.456] * (-3382.529) [-3391.868] (-3392.802) (-3390.231) -- 0:01:11 808000 -- [-3389.290] (-3386.517) (-3380.231) (-3402.893) * (-3382.312) (-3385.205) (-3385.322) [-3390.950] -- 0:01:11 808500 -- [-3380.621] (-3389.441) (-3386.849) (-3383.052) * (-3386.823) [-3383.237] (-3384.493) (-3399.617) -- 0:01:11 809000 -- (-3384.674) [-3389.390] (-3394.090) (-3388.787) * [-3382.254] (-3386.233) (-3383.593) (-3391.967) -- 0:01:11 809500 -- (-3392.813) (-3386.941) (-3404.149) [-3387.134] * [-3382.797] (-3389.369) (-3385.787) (-3387.950) -- 0:01:10 810000 -- [-3385.970] (-3383.750) (-3390.396) (-3385.125) * (-3387.450) [-3381.353] (-3391.662) (-3394.295) -- 0:01:10 Average standard deviation of split frequencies: 0.000436 810500 -- (-3387.685) (-3387.085) [-3386.087] (-3388.846) * [-3383.618] (-3389.889) (-3385.661) (-3384.333) -- 0:01:10 811000 -- (-3388.749) [-3390.679] (-3385.907) (-3390.212) * (-3391.940) (-3383.956) (-3389.090) [-3385.192] -- 0:01:10 811500 -- (-3386.920) (-3388.639) [-3391.392] (-3396.743) * (-3390.750) (-3389.997) (-3386.979) [-3391.089] -- 0:01:10 812000 -- (-3387.189) (-3386.100) [-3388.401] (-3388.081) * (-3390.889) (-3389.463) [-3381.801] (-3382.624) -- 0:01:09 812500 -- (-3383.801) [-3384.651] (-3399.299) (-3396.337) * (-3384.830) (-3384.730) (-3386.222) [-3388.915] -- 0:01:09 813000 -- [-3385.320] (-3387.845) (-3388.678) (-3391.250) * (-3389.284) [-3388.167] (-3391.686) (-3383.629) -- 0:01:09 813500 -- (-3390.608) (-3386.645) [-3386.657] (-3389.102) * (-3393.809) (-3389.211) [-3387.660] (-3385.035) -- 0:01:09 814000 -- [-3389.354] (-3392.726) (-3393.962) (-3389.582) * (-3387.228) (-3390.612) [-3386.718] (-3397.749) -- 0:01:09 814500 -- [-3382.418] (-3389.145) (-3381.987) (-3378.061) * [-3382.684] (-3390.124) (-3387.755) (-3400.353) -- 0:01:09 815000 -- (-3387.646) [-3381.553] (-3388.407) (-3396.741) * (-3387.089) (-3382.164) [-3386.332] (-3381.069) -- 0:01:08 Average standard deviation of split frequencies: 0.000433 815500 -- (-3387.927) (-3388.306) (-3391.155) [-3389.539] * (-3393.984) (-3384.510) (-3390.349) [-3387.987] -- 0:01:08 816000 -- (-3387.551) [-3384.450] (-3395.936) (-3388.938) * [-3382.988] (-3390.862) (-3390.746) (-3388.408) -- 0:01:08 816500 -- (-3387.447) (-3389.047) (-3395.773) [-3380.393] * [-3387.530] (-3387.689) (-3387.338) (-3392.725) -- 0:01:08 817000 -- [-3386.271] (-3397.498) (-3389.497) (-3384.343) * (-3393.524) (-3381.565) (-3390.310) [-3387.771] -- 0:01:08 817500 -- (-3394.673) (-3398.346) [-3391.233] (-3388.897) * (-3389.116) [-3382.202] (-3387.538) (-3385.217) -- 0:01:07 818000 -- (-3401.379) (-3390.617) (-3382.995) [-3380.760] * (-3394.115) (-3388.351) (-3391.978) [-3383.050] -- 0:01:07 818500 -- [-3388.924] (-3398.140) (-3386.583) (-3400.567) * (-3384.860) (-3382.432) [-3386.292] (-3391.144) -- 0:01:07 819000 -- (-3391.785) (-3381.495) [-3381.813] (-3387.285) * (-3397.531) [-3384.616] (-3392.413) (-3391.330) -- 0:01:07 819500 -- (-3385.988) [-3387.778] (-3394.168) (-3388.124) * (-3395.958) (-3383.148) (-3388.012) [-3386.571] -- 0:01:07 820000 -- (-3390.457) (-3393.411) [-3386.986] (-3386.657) * [-3385.458] (-3387.415) (-3389.412) (-3388.280) -- 0:01:06 Average standard deviation of split frequencies: 0.000431 820500 -- (-3387.466) (-3387.843) [-3382.668] (-3383.762) * (-3392.050) (-3387.104) [-3380.005] (-3389.028) -- 0:01:06 821000 -- [-3380.390] (-3390.429) (-3388.205) (-3396.530) * (-3387.746) (-3395.720) [-3393.668] (-3396.821) -- 0:01:06 821500 -- (-3391.998) (-3386.183) (-3395.264) [-3387.187] * (-3393.096) (-3382.927) (-3388.244) [-3387.394] -- 0:01:06 822000 -- (-3389.353) (-3386.024) (-3389.934) [-3386.506] * (-3392.945) (-3382.524) (-3386.711) [-3389.295] -- 0:01:06 822500 -- (-3395.199) (-3384.450) (-3387.634) [-3385.262] * (-3391.568) (-3386.767) (-3393.403) [-3386.537] -- 0:01:06 823000 -- (-3391.466) [-3389.246] (-3382.609) (-3391.885) * (-3390.357) (-3379.979) (-3389.075) [-3390.636] -- 0:01:05 823500 -- (-3396.883) (-3391.582) (-3382.824) [-3381.800] * [-3384.188] (-3387.221) (-3397.917) (-3383.990) -- 0:01:05 824000 -- (-3386.506) (-3387.820) [-3389.910] (-3385.566) * (-3384.528) [-3388.678] (-3385.168) (-3384.473) -- 0:01:05 824500 -- [-3382.137] (-3389.361) (-3378.657) (-3390.770) * (-3394.127) (-3390.138) [-3393.611] (-3388.525) -- 0:01:05 825000 -- (-3387.882) (-3390.949) (-3387.037) [-3387.783] * [-3395.001] (-3384.138) (-3391.027) (-3390.083) -- 0:01:05 Average standard deviation of split frequencies: 0.000428 825500 -- (-3391.399) [-3392.983] (-3385.545) (-3388.904) * (-3397.028) [-3386.829] (-3379.571) (-3385.919) -- 0:01:04 826000 -- (-3390.711) [-3385.824] (-3381.520) (-3387.969) * (-3385.430) (-3387.224) [-3386.162] (-3390.158) -- 0:01:04 826500 -- (-3383.313) (-3390.149) (-3380.540) [-3390.000] * [-3380.191] (-3390.663) (-3393.596) (-3384.062) -- 0:01:04 827000 -- [-3387.144] (-3391.606) (-3391.807) (-3391.243) * (-3388.165) (-3403.189) (-3382.211) [-3384.564] -- 0:01:04 827500 -- (-3381.681) (-3392.889) [-3390.968] (-3390.410) * (-3391.805) [-3390.434] (-3382.347) (-3389.785) -- 0:01:04 828000 -- (-3390.075) [-3388.270] (-3393.204) (-3387.403) * (-3386.936) (-3391.457) (-3384.916) [-3394.272] -- 0:01:03 828500 -- (-3393.821) (-3388.091) (-3386.407) [-3384.086] * (-3388.518) (-3385.600) (-3389.012) [-3381.283] -- 0:01:03 829000 -- (-3390.262) (-3396.404) [-3384.136] (-3384.704) * [-3385.871] (-3392.721) (-3397.690) (-3389.669) -- 0:01:03 829500 -- (-3390.898) (-3398.122) (-3388.672) [-3391.137] * (-3385.043) [-3384.433] (-3388.473) (-3391.388) -- 0:01:03 830000 -- [-3388.393] (-3392.337) (-3394.013) (-3383.303) * (-3379.997) (-3391.712) (-3394.213) [-3388.094] -- 0:01:03 Average standard deviation of split frequencies: 0.000426 830500 -- (-3393.587) (-3394.294) (-3383.047) [-3384.614] * (-3392.358) (-3387.787) [-3385.867] (-3395.894) -- 0:01:03 831000 -- (-3391.232) (-3391.527) [-3389.353] (-3389.660) * (-3389.951) [-3387.172] (-3391.730) (-3386.397) -- 0:01:02 831500 -- (-3392.270) [-3392.136] (-3386.223) (-3385.309) * [-3392.110] (-3396.212) (-3384.671) (-3385.545) -- 0:01:02 832000 -- (-3400.413) (-3389.989) [-3379.567] (-3394.753) * [-3387.766] (-3388.677) (-3398.437) (-3387.111) -- 0:01:02 832500 -- [-3381.221] (-3395.266) (-3384.643) (-3391.308) * (-3388.104) (-3388.306) [-3383.532] (-3390.381) -- 0:01:02 833000 -- (-3389.117) (-3389.099) [-3383.856] (-3385.006) * [-3392.284] (-3387.221) (-3388.681) (-3387.610) -- 0:01:02 833500 -- (-3386.506) (-3404.207) (-3387.229) [-3382.593] * (-3387.028) (-3381.459) [-3392.606] (-3386.338) -- 0:01:01 834000 -- (-3396.344) [-3387.802] (-3390.440) (-3380.346) * (-3389.895) [-3383.345] (-3387.313) (-3384.929) -- 0:01:01 834500 -- [-3386.392] (-3390.200) (-3397.530) (-3392.407) * (-3387.372) [-3384.167] (-3387.710) (-3400.073) -- 0:01:01 835000 -- (-3386.200) [-3387.757] (-3391.418) (-3386.069) * (-3385.083) (-3387.033) [-3382.579] (-3399.424) -- 0:01:01 Average standard deviation of split frequencies: 0.000423 835500 -- [-3388.962] (-3380.938) (-3387.756) (-3389.702) * (-3389.736) [-3386.851] (-3385.957) (-3388.616) -- 0:01:01 836000 -- (-3383.853) (-3393.190) [-3390.429] (-3391.144) * [-3391.090] (-3388.180) (-3395.267) (-3398.150) -- 0:01:01 836500 -- [-3390.950] (-3389.938) (-3399.609) (-3388.044) * (-3394.180) (-3395.062) [-3385.330] (-3394.354) -- 0:01:00 837000 -- (-3396.211) (-3390.572) (-3399.377) [-3392.997] * [-3391.272] (-3387.426) (-3388.504) (-3389.361) -- 0:01:00 837500 -- (-3386.279) (-3385.866) (-3394.482) [-3391.079] * (-3389.185) (-3389.051) [-3384.401] (-3385.151) -- 0:01:00 838000 -- (-3386.690) [-3386.497] (-3386.425) (-3392.725) * (-3386.858) (-3384.500) (-3390.708) [-3386.793] -- 0:01:00 838500 -- (-3388.066) (-3390.026) [-3383.853] (-3389.711) * (-3391.259) (-3384.142) (-3390.005) [-3386.606] -- 0:01:00 839000 -- (-3389.018) [-3381.117] (-3394.075) (-3387.140) * [-3386.944] (-3383.500) (-3391.740) (-3393.792) -- 0:00:59 839500 -- (-3392.438) (-3385.156) [-3380.995] (-3390.921) * (-3391.128) (-3384.746) [-3384.897] (-3383.606) -- 0:00:59 840000 -- [-3385.320] (-3387.796) (-3391.763) (-3388.280) * (-3385.927) (-3385.617) (-3388.098) [-3389.964] -- 0:00:59 Average standard deviation of split frequencies: 0.000421 840500 -- (-3397.012) (-3387.405) [-3385.928] (-3384.555) * (-3388.189) (-3383.375) [-3388.197] (-3401.083) -- 0:00:59 841000 -- [-3383.501] (-3389.016) (-3384.888) (-3388.348) * [-3384.405] (-3385.181) (-3389.780) (-3382.141) -- 0:00:59 841500 -- (-3387.627) [-3382.319] (-3388.589) (-3384.831) * (-3397.257) (-3393.173) (-3391.725) [-3387.854] -- 0:00:58 842000 -- [-3382.989] (-3382.868) (-3395.531) (-3390.925) * (-3387.635) (-3391.428) [-3379.463] (-3385.522) -- 0:00:58 842500 -- (-3392.596) (-3391.884) (-3396.330) [-3392.727] * (-3391.628) [-3385.578] (-3386.076) (-3383.096) -- 0:00:58 843000 -- [-3383.414] (-3384.787) (-3388.621) (-3395.919) * (-3386.274) (-3392.023) [-3385.884] (-3388.267) -- 0:00:58 843500 -- (-3389.306) (-3386.315) [-3388.132] (-3395.884) * (-3386.236) (-3381.769) (-3389.378) [-3383.602] -- 0:00:58 844000 -- (-3386.023) (-3393.311) (-3394.656) [-3390.663] * (-3394.911) [-3385.495] (-3384.398) (-3385.589) -- 0:00:58 844500 -- (-3392.781) [-3382.317] (-3384.094) (-3390.439) * (-3383.157) [-3389.692] (-3388.250) (-3388.857) -- 0:00:57 845000 -- (-3388.075) (-3384.294) [-3386.825] (-3387.964) * [-3386.844] (-3389.420) (-3389.837) (-3393.173) -- 0:00:57 Average standard deviation of split frequencies: 0.000418 845500 -- (-3402.675) (-3386.877) (-3394.062) [-3389.456] * [-3386.768] (-3391.557) (-3391.443) (-3389.940) -- 0:00:57 846000 -- (-3386.762) [-3385.608] (-3386.182) (-3389.421) * (-3385.935) (-3392.012) [-3384.985] (-3386.340) -- 0:00:57 846500 -- [-3385.352] (-3385.995) (-3395.113) (-3390.022) * [-3385.315] (-3383.444) (-3388.411) (-3390.669) -- 0:00:57 847000 -- (-3388.392) (-3389.848) (-3385.954) [-3389.374] * (-3383.034) [-3384.253] (-3387.984) (-3381.661) -- 0:00:56 847500 -- [-3383.191] (-3388.486) (-3392.886) (-3385.997) * (-3386.677) [-3387.390] (-3385.139) (-3397.763) -- 0:00:56 848000 -- (-3393.155) (-3387.646) (-3390.238) [-3381.311] * (-3386.217) (-3393.217) [-3388.147] (-3397.257) -- 0:00:56 848500 -- (-3383.155) (-3387.448) (-3388.866) [-3388.798] * (-3392.128) [-3385.205] (-3390.424) (-3394.256) -- 0:00:56 849000 -- (-3386.948) [-3386.889] (-3395.845) (-3389.696) * [-3385.370] (-3390.336) (-3387.936) (-3387.866) -- 0:00:56 849500 -- [-3385.819] (-3393.627) (-3389.549) (-3391.353) * (-3384.066) (-3393.515) [-3384.627] (-3393.687) -- 0:00:55 850000 -- [-3385.212] (-3389.789) (-3384.954) (-3389.085) * [-3388.793] (-3390.547) (-3394.723) (-3388.012) -- 0:00:55 Average standard deviation of split frequencies: 0.000416 850500 -- (-3383.634) (-3391.036) (-3392.940) [-3384.118] * [-3386.967] (-3385.509) (-3397.617) (-3386.168) -- 0:00:55 851000 -- (-3392.027) (-3391.349) [-3389.847] (-3380.667) * [-3390.852] (-3386.424) (-3394.320) (-3383.975) -- 0:00:55 851500 -- [-3396.773] (-3387.900) (-3393.140) (-3388.531) * (-3386.675) (-3386.429) [-3390.178] (-3381.554) -- 0:00:55 852000 -- [-3389.045] (-3385.468) (-3398.253) (-3380.376) * (-3385.677) [-3382.108] (-3387.339) (-3385.806) -- 0:00:55 852500 -- [-3391.069] (-3385.231) (-3390.150) (-3385.922) * [-3383.655] (-3393.978) (-3391.292) (-3385.348) -- 0:00:54 853000 -- (-3386.740) (-3387.150) (-3393.816) [-3386.238] * [-3386.920] (-3399.130) (-3395.834) (-3383.989) -- 0:00:54 853500 -- (-3389.376) (-3382.323) [-3381.480] (-3388.995) * (-3387.568) (-3390.852) (-3390.821) [-3382.699] -- 0:00:54 854000 -- (-3387.492) (-3385.061) [-3389.586] (-3397.680) * [-3385.212] (-3386.039) (-3390.599) (-3386.674) -- 0:00:54 854500 -- (-3387.188) [-3385.443] (-3398.429) (-3384.667) * (-3385.028) (-3382.611) [-3392.494] (-3389.964) -- 0:00:54 855000 -- [-3384.451] (-3389.019) (-3385.528) (-3385.954) * (-3400.595) (-3385.802) (-3391.767) [-3387.830] -- 0:00:53 Average standard deviation of split frequencies: 0.000413 855500 -- (-3386.998) (-3391.396) [-3391.061] (-3388.184) * (-3387.840) (-3385.445) [-3391.667] (-3393.361) -- 0:00:53 856000 -- (-3385.431) (-3387.477) [-3389.650] (-3390.290) * (-3388.928) (-3385.611) [-3384.998] (-3395.673) -- 0:00:53 856500 -- (-3381.170) (-3387.771) (-3385.896) [-3385.914] * (-3389.518) (-3386.778) [-3387.265] (-3398.573) -- 0:00:53 857000 -- [-3384.668] (-3387.601) (-3391.043) (-3386.725) * (-3387.209) (-3389.454) (-3391.665) [-3385.408] -- 0:00:53 857500 -- (-3385.583) (-3401.867) [-3384.634] (-3385.557) * (-3391.807) (-3389.737) [-3383.289] (-3397.631) -- 0:00:53 858000 -- (-3393.052) (-3404.349) (-3389.848) [-3384.742] * [-3390.345] (-3391.282) (-3391.238) (-3383.421) -- 0:00:52 858500 -- (-3383.531) (-3389.119) (-3396.682) [-3391.482] * (-3383.234) [-3383.091] (-3380.397) (-3386.383) -- 0:00:52 859000 -- (-3391.236) [-3387.910] (-3390.330) (-3397.794) * (-3385.142) (-3391.222) (-3380.554) [-3384.026] -- 0:00:52 859500 -- (-3391.024) (-3389.352) [-3385.514] (-3385.509) * (-3389.480) (-3388.809) (-3395.362) [-3382.304] -- 0:00:52 860000 -- (-3388.390) (-3389.994) (-3390.574) [-3385.182] * (-3381.389) (-3392.536) [-3387.138] (-3392.218) -- 0:00:52 Average standard deviation of split frequencies: 0.000411 860500 -- [-3391.091] (-3386.578) (-3387.505) (-3384.528) * (-3388.733) (-3385.147) (-3391.798) [-3383.236] -- 0:00:51 861000 -- (-3384.118) (-3388.182) [-3388.634] (-3383.418) * (-3387.136) (-3389.746) (-3392.872) [-3388.038] -- 0:00:51 861500 -- [-3386.369] (-3391.974) (-3389.887) (-3388.281) * (-3389.925) (-3389.990) (-3388.242) [-3389.054] -- 0:00:51 862000 -- [-3385.422] (-3379.730) (-3390.984) (-3393.569) * (-3389.070) [-3395.916] (-3390.040) (-3390.564) -- 0:00:51 862500 -- (-3387.090) [-3387.043] (-3392.367) (-3395.107) * [-3384.957] (-3384.062) (-3389.287) (-3389.271) -- 0:00:51 863000 -- (-3382.376) [-3384.252] (-3400.871) (-3385.664) * (-3392.569) (-3391.794) (-3389.029) [-3394.596] -- 0:00:50 863500 -- (-3389.731) (-3389.386) (-3388.958) [-3384.258] * (-3390.019) (-3395.831) (-3388.845) [-3390.344] -- 0:00:50 864000 -- [-3386.648] (-3389.797) (-3380.197) (-3385.531) * (-3399.318) (-3393.139) (-3393.316) [-3382.216] -- 0:00:50 864500 -- (-3385.991) (-3394.892) [-3384.729] (-3385.622) * (-3385.121) (-3383.405) (-3388.847) [-3385.544] -- 0:00:50 865000 -- [-3388.112] (-3391.209) (-3404.391) (-3386.603) * (-3387.279) (-3384.702) [-3395.816] (-3397.487) -- 0:00:50 Average standard deviation of split frequencies: 0.000408 865500 -- (-3387.382) (-3392.279) (-3386.125) [-3383.935] * (-3389.787) (-3389.740) [-3389.237] (-3394.607) -- 0:00:50 866000 -- (-3380.034) [-3383.431] (-3385.475) (-3383.492) * [-3383.800] (-3383.555) (-3388.641) (-3392.084) -- 0:00:49 866500 -- (-3386.473) [-3386.480] (-3385.549) (-3388.487) * (-3392.399) [-3385.507] (-3385.730) (-3399.000) -- 0:00:49 867000 -- (-3393.037) (-3386.483) (-3394.606) [-3391.656] * (-3386.525) (-3389.385) (-3386.520) [-3382.613] -- 0:00:49 867500 -- (-3385.394) (-3392.158) [-3386.303] (-3381.403) * [-3383.232] (-3397.354) (-3393.922) (-3387.808) -- 0:00:49 868000 -- [-3387.206] (-3382.919) (-3386.654) (-3390.056) * (-3384.025) (-3395.880) (-3395.269) [-3387.212] -- 0:00:49 868500 -- (-3391.460) [-3382.906] (-3386.987) (-3396.760) * (-3396.043) [-3385.847] (-3388.720) (-3389.728) -- 0:00:48 869000 -- (-3397.783) (-3381.590) [-3384.272] (-3385.069) * (-3385.438) [-3387.120] (-3385.683) (-3385.619) -- 0:00:48 869500 -- [-3385.645] (-3389.497) (-3385.739) (-3398.584) * (-3394.558) (-3387.155) (-3388.151) [-3388.126] -- 0:00:48 870000 -- (-3387.035) (-3387.784) (-3386.636) [-3384.735] * [-3393.515] (-3389.198) (-3399.319) (-3388.245) -- 0:00:48 Average standard deviation of split frequencies: 0.000406 870500 -- [-3385.888] (-3384.875) (-3383.425) (-3391.224) * [-3388.860] (-3388.070) (-3390.957) (-3387.267) -- 0:00:48 871000 -- (-3390.630) (-3389.443) (-3386.764) [-3390.927] * (-3398.980) (-3390.230) (-3393.184) [-3391.958] -- 0:00:47 871500 -- [-3390.021] (-3388.378) (-3385.490) (-3389.669) * (-3389.676) (-3384.602) [-3385.525] (-3386.504) -- 0:00:47 872000 -- (-3392.035) [-3386.925] (-3388.354) (-3383.256) * (-3389.485) (-3388.015) [-3386.746] (-3389.094) -- 0:00:47 872500 -- [-3385.703] (-3384.652) (-3383.038) (-3384.989) * (-3393.573) (-3390.735) (-3388.302) [-3381.622] -- 0:00:47 873000 -- [-3381.352] (-3388.672) (-3386.737) (-3388.316) * (-3387.815) (-3387.161) (-3391.860) [-3389.376] -- 0:00:47 873500 -- (-3386.939) (-3388.520) (-3386.025) [-3389.738] * (-3389.996) (-3382.594) [-3385.050] (-3393.909) -- 0:00:47 874000 -- (-3392.024) (-3388.863) (-3392.650) [-3385.392] * (-3387.746) (-3383.749) [-3388.744] (-3389.328) -- 0:00:46 874500 -- (-3387.757) (-3384.737) (-3390.766) [-3384.209] * (-3401.183) (-3395.852) [-3386.365] (-3388.653) -- 0:00:46 875000 -- (-3401.399) [-3389.014] (-3384.329) (-3387.263) * [-3388.609] (-3390.355) (-3395.446) (-3384.827) -- 0:00:46 Average standard deviation of split frequencies: 0.000404 875500 -- (-3394.905) (-3397.108) (-3384.287) [-3386.107] * (-3385.473) (-3393.278) [-3381.967] (-3389.902) -- 0:00:46 876000 -- (-3383.679) [-3387.715] (-3389.209) (-3394.161) * [-3382.675] (-3396.877) (-3384.948) (-3392.157) -- 0:00:46 876500 -- (-3383.130) (-3395.900) (-3389.564) [-3386.042] * (-3384.906) (-3394.767) (-3390.261) [-3391.782] -- 0:00:45 877000 -- (-3397.674) (-3389.344) [-3386.962] (-3387.438) * (-3387.399) (-3387.650) (-3397.852) [-3389.511] -- 0:00:45 877500 -- (-3387.539) (-3383.130) [-3384.237] (-3387.696) * [-3385.354] (-3381.901) (-3402.205) (-3386.391) -- 0:00:45 878000 -- (-3393.689) (-3390.672) [-3388.483] (-3391.262) * [-3393.088] (-3383.819) (-3401.762) (-3393.535) -- 0:00:45 878500 -- (-3388.367) [-3383.817] (-3384.952) (-3398.833) * (-3386.464) [-3378.902] (-3395.147) (-3391.981) -- 0:00:45 879000 -- (-3389.536) [-3389.852] (-3389.830) (-3390.397) * [-3384.901] (-3398.221) (-3382.459) (-3391.930) -- 0:00:45 879500 -- [-3402.897] (-3391.962) (-3394.830) (-3384.097) * (-3395.232) [-3387.516] (-3392.957) (-3399.562) -- 0:00:44 880000 -- (-3394.273) (-3386.311) [-3389.258] (-3380.834) * (-3392.404) [-3393.631] (-3388.733) (-3386.136) -- 0:00:44 Average standard deviation of split frequencies: 0.000401 880500 -- (-3410.406) (-3389.203) [-3386.088] (-3384.725) * (-3387.773) (-3386.465) [-3384.261] (-3389.520) -- 0:00:44 881000 -- (-3390.647) (-3391.706) [-3383.005] (-3404.248) * [-3387.347] (-3385.191) (-3391.377) (-3391.006) -- 0:00:44 881500 -- (-3391.747) [-3385.503] (-3383.510) (-3386.559) * (-3385.427) [-3392.029] (-3388.870) (-3388.177) -- 0:00:43 882000 -- (-3383.835) (-3386.939) [-3390.377] (-3388.580) * (-3387.839) (-3382.343) (-3389.615) [-3384.853] -- 0:00:43 882500 -- (-3388.469) (-3384.335) (-3385.408) [-3395.330] * [-3389.244] (-3388.283) (-3384.907) (-3389.268) -- 0:00:43 883000 -- (-3391.509) [-3396.225] (-3391.375) (-3390.547) * [-3386.772] (-3392.792) (-3391.396) (-3390.471) -- 0:00:43 883500 -- (-3388.677) (-3384.735) [-3385.018] (-3384.851) * (-3382.241) [-3385.811] (-3388.619) (-3395.128) -- 0:00:43 884000 -- (-3388.282) (-3387.007) [-3383.119] (-3384.736) * (-3384.585) (-3394.455) [-3386.513] (-3384.764) -- 0:00:43 884500 -- (-3382.675) [-3383.488] (-3383.162) (-3384.437) * [-3383.101] (-3383.283) (-3384.385) (-3396.642) -- 0:00:42 885000 -- (-3388.896) (-3389.072) [-3385.239] (-3389.135) * (-3386.673) (-3386.187) [-3385.306] (-3386.966) -- 0:00:42 Average standard deviation of split frequencies: 0.000399 885500 -- (-3392.080) [-3390.240] (-3387.623) (-3387.896) * (-3388.738) [-3397.046] (-3389.514) (-3384.148) -- 0:00:42 886000 -- [-3386.492] (-3391.693) (-3388.190) (-3386.698) * [-3389.811] (-3391.840) (-3382.706) (-3395.136) -- 0:00:42 886500 -- [-3380.027] (-3383.263) (-3401.657) (-3390.627) * (-3388.993) (-3386.243) [-3387.014] (-3391.798) -- 0:00:42 887000 -- (-3389.385) (-3388.051) (-3394.673) [-3388.827] * [-3390.065] (-3385.672) (-3390.036) (-3393.276) -- 0:00:41 887500 -- (-3393.069) (-3390.548) (-3390.249) [-3387.943] * (-3397.967) [-3387.619] (-3388.433) (-3380.328) -- 0:00:41 888000 -- [-3384.345] (-3390.912) (-3390.460) (-3384.447) * (-3394.789) [-3388.306] (-3389.585) (-3383.246) -- 0:00:41 888500 -- (-3389.917) (-3389.402) (-3388.161) [-3385.303] * [-3390.925] (-3387.522) (-3386.491) (-3391.951) -- 0:00:41 889000 -- [-3388.144] (-3392.135) (-3397.389) (-3383.390) * [-3385.700] (-3386.338) (-3393.950) (-3394.511) -- 0:00:41 889500 -- (-3392.873) [-3386.421] (-3388.990) (-3390.887) * (-3389.516) (-3385.289) (-3384.684) [-3388.606] -- 0:00:40 890000 -- (-3389.767) (-3389.898) (-3387.377) [-3384.554] * [-3388.969] (-3383.194) (-3384.538) (-3392.204) -- 0:00:40 Average standard deviation of split frequencies: 0.000397 890500 -- (-3401.474) [-3384.025] (-3395.171) (-3388.690) * (-3393.001) (-3384.289) [-3384.196] (-3386.032) -- 0:00:40 891000 -- (-3388.941) (-3389.018) [-3389.948] (-3389.289) * (-3384.658) [-3391.163] (-3394.144) (-3389.791) -- 0:00:40 891500 -- (-3387.210) (-3392.167) (-3389.663) [-3390.189] * (-3386.047) (-3388.201) (-3386.274) [-3381.032] -- 0:00:40 892000 -- (-3397.541) (-3383.695) [-3388.684] (-3389.957) * (-3392.419) (-3392.311) (-3394.496) [-3387.969] -- 0:00:40 892500 -- (-3391.068) (-3383.713) (-3391.326) [-3386.397] * (-3391.909) (-3388.308) (-3383.583) [-3390.890] -- 0:00:39 893000 -- (-3384.278) (-3384.816) (-3388.198) [-3386.396] * (-3385.773) (-3386.643) (-3398.210) [-3390.068] -- 0:00:39 893500 -- (-3382.466) (-3386.510) [-3384.301] (-3382.535) * (-3386.327) (-3389.581) [-3386.604] (-3385.267) -- 0:00:39 894000 -- (-3386.566) (-3389.575) [-3383.806] (-3390.086) * (-3389.159) (-3391.785) [-3381.633] (-3400.778) -- 0:00:39 894500 -- (-3390.540) (-3389.561) (-3397.865) [-3389.989] * [-3381.383] (-3389.870) (-3385.772) (-3393.009) -- 0:00:39 895000 -- [-3399.134] (-3394.490) (-3388.075) (-3388.228) * [-3384.999] (-3389.444) (-3385.507) (-3389.073) -- 0:00:38 Average standard deviation of split frequencies: 0.000395 895500 -- (-3388.432) (-3391.763) (-3396.645) [-3388.614] * (-3381.305) [-3391.320] (-3393.409) (-3388.932) -- 0:00:38 896000 -- (-3391.000) (-3386.286) [-3385.428] (-3382.677) * (-3388.263) (-3386.583) [-3385.053] (-3391.850) -- 0:00:38 896500 -- (-3389.571) [-3387.157] (-3391.833) (-3385.527) * (-3385.137) [-3387.092] (-3384.826) (-3388.344) -- 0:00:38 897000 -- (-3391.808) [-3391.641] (-3387.671) (-3386.627) * (-3385.044) [-3385.341] (-3391.434) (-3385.726) -- 0:00:38 897500 -- [-3385.364] (-3394.623) (-3392.720) (-3386.581) * (-3389.282) (-3383.318) (-3386.040) [-3383.154] -- 0:00:38 898000 -- (-3386.239) (-3392.082) [-3393.253] (-3385.649) * [-3388.899] (-3386.200) (-3379.538) (-3392.146) -- 0:00:37 898500 -- (-3385.373) (-3393.978) [-3385.772] (-3381.996) * [-3388.935] (-3395.731) (-3390.408) (-3399.463) -- 0:00:37 899000 -- [-3388.832] (-3389.103) (-3388.241) (-3386.686) * (-3386.452) (-3388.119) (-3387.252) [-3390.748] -- 0:00:37 899500 -- [-3386.966] (-3384.708) (-3382.273) (-3385.198) * (-3384.300) (-3388.140) [-3386.739] (-3389.190) -- 0:00:37 900000 -- [-3387.350] (-3391.593) (-3384.759) (-3390.200) * (-3387.364) (-3385.829) (-3386.431) [-3391.115] -- 0:00:37 Average standard deviation of split frequencies: 0.000393 900500 -- (-3384.313) (-3386.959) (-3401.476) [-3387.716] * [-3389.866] (-3380.376) (-3388.407) (-3391.584) -- 0:00:36 901000 -- (-3390.915) (-3385.404) (-3390.542) [-3383.072] * (-3394.285) (-3387.696) (-3390.323) [-3389.082] -- 0:00:36 901500 -- (-3394.542) (-3387.290) (-3385.357) [-3387.706] * (-3391.797) [-3389.217] (-3392.133) (-3389.743) -- 0:00:36 902000 -- [-3387.026] (-3391.337) (-3386.625) (-3387.205) * (-3390.966) (-3397.972) [-3384.215] (-3382.550) -- 0:00:36 902500 -- [-3388.776] (-3385.664) (-3385.823) (-3400.445) * [-3382.804] (-3385.317) (-3393.045) (-3385.394) -- 0:00:36 903000 -- (-3390.930) (-3393.677) (-3383.266) [-3390.003] * [-3387.496] (-3387.271) (-3394.913) (-3396.565) -- 0:00:35 903500 -- [-3390.799] (-3389.650) (-3389.086) (-3387.118) * (-3385.156) (-3384.850) (-3391.028) [-3382.514] -- 0:00:35 904000 -- [-3391.035] (-3395.863) (-3382.176) (-3386.809) * [-3382.913] (-3393.158) (-3396.081) (-3387.422) -- 0:00:35 904500 -- (-3397.612) (-3385.139) [-3387.914] (-3381.273) * [-3380.734] (-3380.706) (-3386.844) (-3395.393) -- 0:00:35 905000 -- (-3388.015) [-3382.559] (-3392.935) (-3390.691) * [-3387.452] (-3386.180) (-3390.195) (-3385.047) -- 0:00:35 Average standard deviation of split frequencies: 0.000390 905500 -- (-3388.228) [-3385.478] (-3386.584) (-3392.254) * (-3389.624) (-3390.571) [-3381.973] (-3386.340) -- 0:00:35 906000 -- [-3391.679] (-3397.922) (-3391.683) (-3384.983) * (-3391.076) (-3408.194) (-3390.755) [-3393.357] -- 0:00:34 906500 -- (-3384.300) [-3386.216] (-3387.121) (-3386.999) * (-3391.640) (-3391.203) (-3391.807) [-3385.869] -- 0:00:34 907000 -- [-3387.468] (-3385.561) (-3391.913) (-3389.492) * (-3386.952) (-3389.113) [-3386.374] (-3388.080) -- 0:00:34 907500 -- (-3389.930) [-3381.020] (-3394.681) (-3392.711) * (-3391.265) [-3393.744] (-3389.353) (-3393.724) -- 0:00:34 908000 -- (-3387.507) [-3380.826] (-3395.186) (-3389.691) * (-3390.056) (-3390.203) [-3383.945] (-3385.715) -- 0:00:34 908500 -- [-3390.442] (-3379.514) (-3397.240) (-3401.513) * (-3384.951) (-3381.455) (-3388.130) [-3385.479] -- 0:00:33 909000 -- [-3382.609] (-3396.414) (-3391.353) (-3397.350) * (-3385.641) (-3382.714) [-3392.067] (-3383.641) -- 0:00:33 909500 -- (-3395.128) (-3383.962) [-3386.273] (-3389.415) * (-3398.652) (-3387.216) (-3390.803) [-3388.910] -- 0:00:33 910000 -- (-3392.050) (-3384.957) [-3386.320] (-3391.606) * [-3392.080] (-3385.041) (-3395.112) (-3386.063) -- 0:00:33 Average standard deviation of split frequencies: 0.000388 910500 -- (-3389.096) (-3389.253) (-3393.691) [-3384.883] * [-3383.159] (-3383.507) (-3393.049) (-3390.756) -- 0:00:33 911000 -- (-3388.089) (-3389.037) (-3392.039) [-3393.218] * (-3384.961) (-3389.392) (-3384.433) [-3389.858] -- 0:00:33 911500 -- (-3385.089) [-3390.369] (-3387.702) (-3387.196) * (-3390.462) (-3383.509) [-3391.858] (-3381.817) -- 0:00:32 912000 -- [-3382.665] (-3386.615) (-3391.000) (-3386.534) * (-3399.050) (-3388.959) (-3391.074) [-3387.948] -- 0:00:32 912500 -- (-3388.924) [-3384.964] (-3392.157) (-3387.303) * (-3397.924) [-3385.360] (-3387.324) (-3386.759) -- 0:00:32 913000 -- [-3389.280] (-3385.487) (-3390.467) (-3390.677) * (-3400.478) (-3388.553) [-3385.025] (-3387.452) -- 0:00:32 913500 -- (-3387.562) (-3382.978) (-3390.459) [-3387.266] * (-3397.725) [-3386.295] (-3390.928) (-3390.827) -- 0:00:32 914000 -- [-3387.073] (-3385.609) (-3385.335) (-3396.103) * (-3395.596) (-3386.605) [-3389.084] (-3392.520) -- 0:00:31 914500 -- [-3388.174] (-3388.143) (-3391.578) (-3391.807) * [-3387.250] (-3391.128) (-3387.676) (-3393.356) -- 0:00:31 915000 -- (-3385.664) (-3384.180) [-3384.958] (-3393.769) * (-3385.633) (-3385.128) [-3381.594] (-3388.594) -- 0:00:31 Average standard deviation of split frequencies: 0.000386 915500 -- (-3390.488) [-3379.585] (-3381.363) (-3390.506) * (-3397.558) (-3384.758) (-3380.730) [-3392.228] -- 0:00:31 916000 -- (-3386.198) (-3384.803) (-3388.092) [-3385.430] * [-3395.901] (-3388.659) (-3390.077) (-3390.972) -- 0:00:31 916500 -- (-3385.017) (-3388.829) [-3386.770] (-3393.230) * (-3383.833) (-3383.402) [-3385.088] (-3385.365) -- 0:00:30 917000 -- [-3384.323] (-3391.237) (-3385.025) (-3383.986) * (-3390.046) [-3389.484] (-3386.018) (-3390.396) -- 0:00:30 917500 -- (-3384.073) [-3389.232] (-3384.671) (-3403.482) * (-3389.098) [-3385.192] (-3384.722) (-3387.843) -- 0:00:30 918000 -- (-3392.828) (-3390.576) (-3385.910) [-3384.641] * (-3384.224) (-3389.760) [-3384.411] (-3391.272) -- 0:00:30 918500 -- [-3388.555] (-3389.869) (-3386.609) (-3390.557) * (-3381.245) [-3391.611] (-3395.220) (-3386.073) -- 0:00:30 919000 -- [-3383.440] (-3392.154) (-3386.101) (-3387.401) * (-3383.029) [-3379.814] (-3390.009) (-3381.487) -- 0:00:30 919500 -- (-3381.352) [-3389.992] (-3383.463) (-3393.144) * (-3386.743) (-3384.861) (-3383.711) [-3392.249] -- 0:00:29 920000 -- (-3385.405) [-3389.165] (-3382.497) (-3382.507) * (-3395.318) (-3391.330) (-3383.074) [-3384.352] -- 0:00:29 Average standard deviation of split frequencies: 0.000384 920500 -- (-3390.260) [-3382.015] (-3392.736) (-3399.456) * [-3383.706] (-3387.476) (-3384.241) (-3384.156) -- 0:00:29 921000 -- [-3390.412] (-3394.072) (-3396.379) (-3392.572) * [-3389.872] (-3387.990) (-3386.326) (-3390.713) -- 0:00:29 921500 -- (-3385.384) (-3388.944) (-3395.935) [-3386.781] * (-3389.299) (-3391.660) (-3386.323) [-3386.495] -- 0:00:29 922000 -- [-3387.277] (-3399.156) (-3398.714) (-3395.514) * (-3383.854) (-3388.657) (-3386.994) [-3384.887] -- 0:00:28 922500 -- (-3388.710) [-3388.923] (-3394.158) (-3383.874) * (-3382.010) [-3382.392] (-3390.276) (-3385.985) -- 0:00:28 923000 -- (-3382.060) [-3386.920] (-3385.099) (-3390.148) * [-3391.435] (-3380.737) (-3391.671) (-3390.609) -- 0:00:28 923500 -- (-3390.477) (-3388.360) (-3398.751) [-3388.356] * (-3382.422) (-3387.654) [-3397.604] (-3386.052) -- 0:00:28 924000 -- (-3386.743) [-3390.487] (-3384.833) (-3390.937) * (-3384.332) (-3392.442) [-3393.739] (-3383.543) -- 0:00:28 924500 -- [-3385.435] (-3391.626) (-3401.451) (-3387.989) * (-3392.724) (-3393.610) (-3392.162) [-3392.473] -- 0:00:28 925000 -- (-3392.168) [-3390.123] (-3391.016) (-3388.456) * (-3393.750) (-3389.472) (-3388.290) [-3389.443] -- 0:00:27 Average standard deviation of split frequencies: 0.000382 925500 -- [-3383.485] (-3389.083) (-3385.583) (-3389.107) * (-3399.687) [-3382.593] (-3382.927) (-3388.733) -- 0:00:27 926000 -- (-3383.193) [-3382.110] (-3394.645) (-3394.399) * (-3389.368) (-3388.765) (-3386.981) [-3397.876] -- 0:00:27 926500 -- (-3390.826) (-3386.204) [-3383.392] (-3386.207) * (-3397.904) (-3384.836) [-3388.301] (-3398.061) -- 0:00:27 927000 -- (-3391.291) [-3382.263] (-3389.944) (-3400.454) * (-3399.147) (-3388.391) (-3391.789) [-3384.925] -- 0:00:27 927500 -- (-3381.192) [-3383.561] (-3392.383) (-3393.892) * (-3386.845) (-3392.136) (-3384.701) [-3384.115] -- 0:00:26 928000 -- [-3387.286] (-3386.712) (-3382.109) (-3389.762) * (-3389.931) (-3383.739) (-3387.675) [-3388.435] -- 0:00:26 928500 -- (-3389.037) (-3396.199) (-3394.075) [-3381.188] * (-3384.978) (-3382.874) [-3391.636] (-3391.291) -- 0:00:26 929000 -- (-3382.101) [-3389.180] (-3390.549) (-3389.977) * (-3385.765) [-3385.764] (-3397.330) (-3387.298) -- 0:00:26 929500 -- [-3385.532] (-3390.711) (-3389.292) (-3389.880) * (-3382.679) (-3385.999) [-3391.635] (-3389.854) -- 0:00:26 930000 -- (-3385.354) (-3399.000) (-3381.433) [-3385.804] * (-3387.183) [-3387.995] (-3392.124) (-3387.910) -- 0:00:25 Average standard deviation of split frequencies: 0.000380 930500 -- (-3394.721) [-3388.850] (-3389.512) (-3391.067) * (-3386.000) (-3389.564) (-3386.450) [-3388.233] -- 0:00:25 931000 -- (-3393.329) (-3381.724) (-3384.448) [-3384.638] * [-3385.239] (-3388.866) (-3384.578) (-3392.552) -- 0:00:25 931500 -- (-3393.534) (-3390.815) (-3390.614) [-3387.813] * [-3382.085] (-3390.039) (-3393.495) (-3396.953) -- 0:00:25 932000 -- (-3384.691) [-3381.019] (-3381.826) (-3386.447) * [-3386.483] (-3391.452) (-3390.813) (-3382.468) -- 0:00:25 932500 -- (-3383.841) (-3391.108) [-3384.163] (-3388.085) * (-3390.944) (-3391.305) [-3392.632] (-3388.339) -- 0:00:25 933000 -- (-3388.188) (-3386.780) (-3388.371) [-3382.435] * (-3389.714) [-3389.614] (-3381.477) (-3382.081) -- 0:00:24 933500 -- (-3384.655) [-3381.201] (-3396.016) (-3390.627) * (-3388.892) (-3389.959) [-3379.272] (-3390.664) -- 0:00:24 934000 -- [-3390.644] (-3391.689) (-3390.551) (-3382.935) * (-3384.026) (-3389.428) (-3385.976) [-3385.243] -- 0:00:24 934500 -- (-3391.204) (-3389.712) (-3387.580) [-3386.469] * (-3391.649) (-3395.363) (-3391.200) [-3382.281] -- 0:00:24 935000 -- (-3393.446) (-3385.875) (-3389.797) [-3385.240] * (-3396.901) (-3388.691) (-3387.203) [-3390.910] -- 0:00:24 Average standard deviation of split frequencies: 0.000378 935500 -- (-3395.421) (-3383.607) (-3394.382) [-3385.976] * (-3396.241) [-3389.882] (-3383.807) (-3391.562) -- 0:00:23 936000 -- (-3387.049) [-3385.206] (-3389.676) (-3386.070) * (-3390.354) (-3393.952) (-3393.667) [-3390.999] -- 0:00:23 936500 -- (-3381.685) (-3398.780) [-3387.138] (-3385.892) * [-3385.875] (-3389.253) (-3380.210) (-3389.002) -- 0:00:23 937000 -- (-3385.732) (-3391.080) [-3382.297] (-3393.363) * (-3389.315) [-3384.824] (-3386.712) (-3389.476) -- 0:00:23 937500 -- [-3386.934] (-3386.351) (-3385.197) (-3387.124) * (-3385.224) (-3385.311) (-3391.650) [-3391.065] -- 0:00:23 938000 -- (-3389.186) (-3392.698) (-3389.959) [-3388.871] * (-3390.798) (-3394.781) [-3385.180] (-3386.790) -- 0:00:23 938500 -- (-3385.937) [-3391.372] (-3388.512) (-3389.105) * (-3383.912) (-3389.917) [-3384.514] (-3380.923) -- 0:00:22 939000 -- (-3400.641) [-3389.056] (-3393.170) (-3388.250) * [-3387.018] (-3388.859) (-3390.698) (-3391.680) -- 0:00:22 939500 -- [-3389.802] (-3387.963) (-3386.787) (-3389.141) * (-3390.614) (-3385.103) [-3383.750] (-3392.237) -- 0:00:22 940000 -- [-3385.434] (-3387.646) (-3379.952) (-3391.461) * (-3386.665) (-3387.911) [-3383.424] (-3389.551) -- 0:00:22 Average standard deviation of split frequencies: 0.000376 940500 -- [-3383.316] (-3401.797) (-3395.400) (-3402.002) * (-3389.753) [-3385.308] (-3385.352) (-3385.283) -- 0:00:22 941000 -- (-3395.619) (-3387.761) (-3382.824) [-3385.198] * (-3386.420) (-3385.912) [-3389.242] (-3399.717) -- 0:00:21 941500 -- (-3387.249) (-3396.250) [-3387.479] (-3391.321) * [-3383.774] (-3391.368) (-3393.961) (-3394.411) -- 0:00:21 942000 -- (-3395.132) (-3386.085) [-3389.320] (-3391.997) * (-3384.151) (-3389.842) [-3384.731] (-3389.532) -- 0:00:21 942500 -- (-3390.412) (-3401.769) (-3393.598) [-3390.510] * (-3389.952) (-3395.725) [-3389.228] (-3388.518) -- 0:00:21 943000 -- (-3387.673) (-3390.533) (-3391.142) [-3386.747] * (-3383.601) [-3390.050] (-3392.860) (-3382.057) -- 0:00:21 943500 -- [-3392.544] (-3383.904) (-3389.042) (-3387.855) * (-3386.348) [-3381.882] (-3386.114) (-3387.217) -- 0:00:20 944000 -- (-3390.187) [-3386.472] (-3385.024) (-3385.089) * (-3390.154) (-3384.369) [-3389.812] (-3396.969) -- 0:00:20 944500 -- (-3386.005) [-3394.154] (-3384.129) (-3388.453) * [-3384.805] (-3383.778) (-3389.390) (-3388.637) -- 0:00:20 945000 -- (-3378.711) [-3387.757] (-3385.754) (-3397.989) * (-3386.453) [-3387.249] (-3392.874) (-3391.236) -- 0:00:20 Average standard deviation of split frequencies: 0.000374 945500 -- (-3384.355) [-3386.745] (-3389.540) (-3387.831) * (-3391.195) (-3386.162) [-3386.941] (-3387.082) -- 0:00:20 946000 -- [-3387.799] (-3386.357) (-3390.305) (-3400.505) * [-3384.198] (-3386.149) (-3396.449) (-3390.146) -- 0:00:20 946500 -- (-3387.151) (-3384.603) (-3388.982) [-3383.163] * [-3383.024] (-3384.656) (-3384.237) (-3388.994) -- 0:00:19 947000 -- [-3388.063] (-3378.306) (-3387.989) (-3386.314) * (-3392.243) [-3383.454] (-3386.710) (-3395.044) -- 0:00:19 947500 -- (-3389.590) (-3391.143) (-3384.672) [-3384.983] * (-3389.999) (-3394.688) [-3385.448] (-3396.840) -- 0:00:19 948000 -- (-3390.006) [-3389.233] (-3389.514) (-3387.184) * (-3399.132) (-3395.482) (-3380.092) [-3390.261] -- 0:00:19 948500 -- (-3386.889) (-3391.954) [-3389.531] (-3390.939) * (-3380.024) (-3389.468) (-3384.832) [-3385.107] -- 0:00:19 949000 -- [-3384.100] (-3388.787) (-3392.961) (-3389.807) * (-3385.317) (-3390.459) (-3392.668) [-3379.726] -- 0:00:18 949500 -- (-3393.266) (-3389.081) [-3388.769] (-3390.365) * (-3383.991) (-3388.479) (-3384.380) [-3385.044] -- 0:00:18 950000 -- [-3385.084] (-3388.461) (-3387.838) (-3397.642) * (-3387.613) (-3380.316) (-3390.448) [-3393.664] -- 0:00:18 Average standard deviation of split frequencies: 0.000372 950500 -- [-3392.071] (-3389.432) (-3397.150) (-3395.066) * (-3395.652) (-3388.010) (-3397.174) [-3392.191] -- 0:00:18 951000 -- (-3390.659) (-3388.979) [-3392.569] (-3395.828) * [-3385.673] (-3392.515) (-3391.960) (-3395.259) -- 0:00:18 951500 -- (-3391.996) [-3383.184] (-3388.519) (-3388.107) * (-3387.194) [-3388.147] (-3392.963) (-3391.856) -- 0:00:17 952000 -- (-3387.443) (-3387.911) [-3385.104] (-3385.759) * (-3387.485) (-3384.336) [-3382.108] (-3382.167) -- 0:00:17 952500 -- (-3385.058) [-3381.668] (-3384.337) (-3389.850) * (-3389.535) (-3391.813) [-3382.887] (-3386.261) -- 0:00:17 953000 -- (-3394.003) [-3383.382] (-3388.733) (-3388.887) * (-3387.133) [-3388.104] (-3390.402) (-3384.803) -- 0:00:17 953500 -- [-3385.318] (-3385.812) (-3392.896) (-3390.268) * (-3385.418) [-3388.880] (-3387.732) (-3392.907) -- 0:00:17 954000 -- (-3386.119) (-3386.836) [-3384.902] (-3389.257) * [-3382.503] (-3381.259) (-3383.171) (-3385.795) -- 0:00:17 954500 -- [-3379.867] (-3402.304) (-3392.507) (-3385.769) * (-3381.497) [-3384.277] (-3391.376) (-3381.345) -- 0:00:16 955000 -- (-3386.916) (-3389.415) [-3388.428] (-3396.458) * [-3392.566] (-3386.697) (-3393.688) (-3393.879) -- 0:00:16 Average standard deviation of split frequencies: 0.000370 955500 -- (-3393.548) (-3396.487) (-3388.458) [-3387.157] * (-3389.418) (-3385.539) (-3389.928) [-3384.267] -- 0:00:16 956000 -- (-3384.912) (-3386.570) [-3386.960] (-3385.788) * (-3393.980) (-3391.775) [-3393.121] (-3389.087) -- 0:00:16 956500 -- [-3392.602] (-3385.785) (-3390.145) (-3385.547) * (-3388.394) (-3399.328) [-3396.505] (-3387.192) -- 0:00:16 957000 -- [-3385.911] (-3390.603) (-3381.273) (-3389.125) * (-3389.380) (-3396.910) [-3391.876] (-3385.486) -- 0:00:15 957500 -- [-3388.519] (-3391.133) (-3384.020) (-3389.672) * (-3390.607) [-3384.175] (-3387.865) (-3386.239) -- 0:00:15 958000 -- (-3387.711) (-3390.436) (-3386.087) [-3389.022] * (-3383.200) (-3391.155) (-3390.356) [-3387.604] -- 0:00:15 958500 -- [-3396.193] (-3383.702) (-3384.923) (-3393.012) * [-3391.163] (-3391.750) (-3390.572) (-3391.459) -- 0:00:15 959000 -- (-3383.778) (-3384.905) (-3385.196) [-3387.931] * (-3387.175) (-3386.287) (-3389.019) [-3391.772] -- 0:00:15 959500 -- (-3389.917) (-3390.710) [-3382.652] (-3385.812) * [-3387.326] (-3388.174) (-3388.862) (-3384.773) -- 0:00:15 960000 -- (-3385.638) [-3387.712] (-3390.563) (-3391.544) * (-3387.174) (-3388.411) [-3382.733] (-3383.358) -- 0:00:14 Average standard deviation of split frequencies: 0.000368 960500 -- (-3387.552) [-3393.785] (-3391.525) (-3391.118) * [-3387.967] (-3395.474) (-3383.489) (-3385.805) -- 0:00:14 961000 -- [-3386.850] (-3387.801) (-3394.304) (-3388.588) * [-3378.963] (-3383.768) (-3385.760) (-3390.616) -- 0:00:14 961500 -- [-3386.493] (-3387.878) (-3387.969) (-3392.098) * (-3391.244) (-3388.678) (-3391.599) [-3385.951] -- 0:00:14 962000 -- (-3387.743) (-3387.576) [-3385.929] (-3400.382) * (-3393.297) [-3384.031] (-3386.853) (-3384.029) -- 0:00:14 962500 -- (-3385.993) (-3388.908) (-3389.294) [-3387.444] * (-3391.435) (-3389.480) (-3389.810) [-3384.229] -- 0:00:13 963000 -- (-3388.138) [-3384.746] (-3387.947) (-3391.482) * (-3385.842) (-3386.834) (-3390.163) [-3390.004] -- 0:00:13 963500 -- (-3384.418) (-3384.569) (-3384.102) [-3380.892] * (-3381.348) (-3383.746) [-3390.902] (-3386.895) -- 0:00:13 964000 -- (-3388.657) [-3391.745] (-3396.011) (-3389.001) * [-3391.202] (-3389.364) (-3391.733) (-3389.041) -- 0:00:13 964500 -- (-3386.594) (-3383.944) (-3395.466) [-3381.226] * (-3385.710) (-3388.912) (-3390.502) [-3387.834] -- 0:00:13 965000 -- (-3386.427) (-3390.306) [-3399.252] (-3390.346) * (-3389.926) (-3382.846) (-3392.052) [-3383.918] -- 0:00:12 Average standard deviation of split frequencies: 0.000366 965500 -- (-3384.139) (-3387.071) (-3393.340) [-3381.796] * (-3386.834) [-3383.224] (-3386.474) (-3396.771) -- 0:00:12 966000 -- (-3391.535) (-3383.204) [-3392.729] (-3392.526) * (-3385.868) (-3387.404) (-3391.812) [-3386.609] -- 0:00:12 966500 -- (-3385.023) (-3382.755) (-3392.318) [-3386.531] * (-3386.142) (-3385.954) (-3394.296) [-3386.048] -- 0:00:12 967000 -- (-3388.370) (-3385.775) [-3383.793] (-3390.356) * [-3390.844] (-3390.812) (-3393.872) (-3386.693) -- 0:00:12 967500 -- (-3394.207) (-3381.812) (-3388.011) [-3385.777] * (-3387.989) [-3388.110] (-3395.383) (-3389.949) -- 0:00:12 968000 -- (-3388.628) (-3396.654) (-3384.836) [-3384.527] * [-3383.553] (-3395.879) (-3384.692) (-3390.202) -- 0:00:11 968500 -- (-3400.176) (-3387.597) (-3391.068) [-3382.757] * (-3380.497) (-3386.895) (-3384.919) [-3386.439] -- 0:00:11 969000 -- [-3394.352] (-3396.841) (-3390.671) (-3389.344) * (-3389.493) (-3384.608) [-3383.646] (-3392.706) -- 0:00:11 969500 -- (-3384.032) [-3381.042] (-3378.295) (-3393.362) * (-3383.174) (-3385.577) [-3390.067] (-3391.695) -- 0:00:11 970000 -- [-3382.519] (-3388.025) (-3390.265) (-3388.432) * [-3393.047] (-3386.782) (-3384.463) (-3392.266) -- 0:00:11 Average standard deviation of split frequencies: 0.000364 970500 -- [-3385.055] (-3384.090) (-3393.831) (-3389.848) * (-3390.337) [-3383.532] (-3398.209) (-3396.541) -- 0:00:10 971000 -- (-3389.639) (-3386.771) [-3383.873] (-3393.521) * (-3392.899) (-3385.446) [-3392.692] (-3396.411) -- 0:00:10 971500 -- (-3386.498) (-3388.697) [-3385.873] (-3390.195) * (-3382.529) (-3381.921) (-3390.955) [-3381.564] -- 0:00:10 972000 -- (-3397.035) (-3391.151) (-3391.807) [-3387.791] * [-3386.980] (-3385.475) (-3390.133) (-3388.353) -- 0:00:10 972500 -- [-3381.886] (-3388.361) (-3387.730) (-3392.181) * (-3394.608) [-3391.212] (-3387.105) (-3383.086) -- 0:00:10 973000 -- [-3383.496] (-3384.502) (-3387.482) (-3387.096) * (-3393.158) [-3386.412] (-3386.706) (-3386.011) -- 0:00:10 973500 -- (-3395.320) (-3385.555) (-3389.550) [-3387.974] * (-3391.458) (-3384.528) (-3392.830) [-3390.603] -- 0:00:09 974000 -- (-3386.242) [-3382.904] (-3398.274) (-3400.818) * (-3388.658) (-3388.410) [-3385.788] (-3390.830) -- 0:00:09 974500 -- (-3391.918) [-3393.342] (-3391.177) (-3389.011) * (-3388.340) [-3384.568] (-3393.233) (-3381.599) -- 0:00:09 975000 -- (-3392.064) [-3387.102] (-3390.825) (-3393.252) * (-3393.081) (-3386.896) [-3387.817] (-3386.247) -- 0:00:09 Average standard deviation of split frequencies: 0.000362 975500 -- [-3385.715] (-3386.513) (-3385.994) (-3395.840) * (-3386.700) (-3388.851) (-3383.981) [-3382.739] -- 0:00:09 976000 -- (-3388.388) (-3385.309) (-3391.878) [-3382.822] * (-3386.614) [-3385.135] (-3380.279) (-3389.106) -- 0:00:08 976500 -- (-3384.537) (-3388.514) [-3387.033] (-3400.316) * (-3386.605) (-3390.606) [-3382.612] (-3388.740) -- 0:00:08 977000 -- [-3388.111] (-3394.936) (-3382.822) (-3398.071) * [-3389.936] (-3382.680) (-3387.080) (-3399.600) -- 0:00:08 977500 -- (-3397.856) (-3386.762) (-3385.953) [-3383.551] * (-3382.626) (-3386.943) [-3392.652] (-3391.933) -- 0:00:08 978000 -- (-3386.588) (-3398.127) (-3389.164) [-3386.156] * [-3389.145] (-3394.550) (-3391.256) (-3391.316) -- 0:00:08 978500 -- [-3382.901] (-3397.302) (-3384.662) (-3388.003) * (-3385.759) (-3384.481) [-3387.821] (-3393.747) -- 0:00:07 979000 -- (-3386.103) (-3390.217) [-3385.278] (-3391.011) * (-3384.405) (-3382.584) [-3382.440] (-3385.777) -- 0:00:07 979500 -- [-3380.063] (-3387.216) (-3388.089) (-3391.504) * (-3384.669) (-3383.628) [-3383.170] (-3393.531) -- 0:00:07 980000 -- (-3390.219) [-3387.653] (-3388.362) (-3394.230) * (-3391.416) (-3382.890) [-3389.952] (-3382.411) -- 0:00:07 Average standard deviation of split frequencies: 0.000361 980500 -- [-3388.412] (-3388.373) (-3389.905) (-3386.434) * (-3391.131) (-3387.325) [-3387.421] (-3388.485) -- 0:00:07 981000 -- [-3383.675] (-3390.860) (-3387.930) (-3389.982) * (-3384.759) [-3384.827] (-3388.999) (-3386.109) -- 0:00:07 981500 -- (-3390.842) [-3383.019] (-3389.135) (-3392.762) * [-3385.704] (-3386.766) (-3387.750) (-3383.202) -- 0:00:06 982000 -- (-3388.897) (-3390.863) [-3390.200] (-3392.195) * (-3383.509) [-3396.435] (-3398.646) (-3389.761) -- 0:00:06 982500 -- (-3385.887) [-3385.020] (-3392.314) (-3385.795) * (-3389.427) [-3383.801] (-3386.477) (-3392.457) -- 0:00:06 983000 -- [-3387.338] (-3392.348) (-3389.026) (-3388.735) * [-3382.545] (-3390.307) (-3389.440) (-3392.515) -- 0:00:06 983500 -- [-3387.730] (-3385.174) (-3386.853) (-3386.531) * (-3393.464) (-3387.499) (-3389.481) [-3386.193] -- 0:00:06 984000 -- (-3387.621) [-3381.555] (-3391.748) (-3386.784) * [-3385.679] (-3389.095) (-3385.977) (-3384.996) -- 0:00:05 984500 -- (-3393.207) (-3381.379) (-3395.631) [-3389.590] * (-3394.831) (-3395.788) [-3384.672] (-3392.647) -- 0:00:05 985000 -- (-3392.344) (-3394.190) [-3387.815] (-3388.047) * (-3380.365) [-3395.732] (-3389.650) (-3391.715) -- 0:00:05 Average standard deviation of split frequencies: 0.000359 985500 -- (-3398.960) [-3386.578] (-3386.125) (-3387.301) * (-3391.639) (-3391.578) (-3399.958) [-3389.192] -- 0:00:05 986000 -- (-3390.624) (-3388.271) (-3389.962) [-3392.531] * (-3389.151) (-3384.361) (-3384.077) [-3382.917] -- 0:00:05 986500 -- (-3389.820) (-3388.118) (-3391.248) [-3379.763] * (-3384.631) [-3388.545] (-3390.912) (-3390.698) -- 0:00:05 987000 -- (-3389.301) (-3385.755) (-3387.587) [-3383.055] * (-3391.282) [-3386.838] (-3389.395) (-3394.900) -- 0:00:04 987500 -- (-3388.391) [-3383.424] (-3392.429) (-3385.430) * (-3392.572) (-3384.809) (-3392.590) [-3385.097] -- 0:00:04 988000 -- (-3382.961) (-3389.554) (-3386.375) [-3385.784] * (-3386.707) [-3391.828] (-3383.233) (-3391.602) -- 0:00:04 988500 -- (-3384.236) (-3386.798) (-3386.201) [-3384.114] * (-3388.110) (-3389.892) (-3390.015) [-3388.530] -- 0:00:04 989000 -- (-3386.516) (-3400.533) [-3388.556] (-3389.132) * (-3385.925) (-3391.657) (-3382.661) [-3391.890] -- 0:00:04 989500 -- [-3385.283] (-3390.191) (-3387.265) (-3396.816) * [-3390.014] (-3386.699) (-3388.766) (-3384.477) -- 0:00:03 990000 -- [-3386.467] (-3387.507) (-3384.833) (-3398.561) * (-3385.906) (-3397.723) (-3390.644) [-3386.637] -- 0:00:03 Average standard deviation of split frequencies: 0.000357 990500 -- (-3390.191) (-3383.167) (-3388.784) [-3383.112] * (-3387.757) [-3388.948] (-3387.370) (-3382.566) -- 0:00:03 991000 -- (-3393.204) [-3383.466] (-3381.257) (-3389.927) * [-3389.609] (-3388.182) (-3386.950) (-3383.608) -- 0:00:03 991500 -- (-3389.032) (-3387.809) (-3387.095) [-3385.048] * (-3391.257) (-3388.712) [-3401.721] (-3388.473) -- 0:00:03 992000 -- [-3387.497] (-3397.038) (-3393.128) (-3388.212) * [-3381.245] (-3382.086) (-3397.831) (-3385.878) -- 0:00:02 992500 -- (-3387.855) (-3389.901) (-3393.454) [-3389.498] * (-3382.221) (-3397.036) [-3383.766] (-3385.308) -- 0:00:02 993000 -- [-3383.862] (-3388.930) (-3395.634) (-3388.568) * (-3383.868) (-3386.319) (-3386.129) [-3386.561] -- 0:00:02 993500 -- (-3386.785) [-3393.622] (-3397.202) (-3392.633) * [-3387.121] (-3384.083) (-3388.626) (-3388.770) -- 0:00:02 994000 -- (-3386.235) (-3392.233) (-3380.609) [-3388.087] * [-3388.331] (-3382.397) (-3393.688) (-3386.589) -- 0:00:02 994500 -- (-3384.592) (-3405.779) [-3391.457] (-3391.822) * (-3391.730) [-3381.806] (-3387.156) (-3383.463) -- 0:00:02 995000 -- [-3384.467] (-3387.299) (-3387.362) (-3390.712) * (-3384.687) (-3388.424) (-3384.145) [-3388.625] -- 0:00:01 Average standard deviation of split frequencies: 0.000355 995500 -- (-3387.526) (-3393.737) [-3381.442] (-3392.263) * (-3390.413) (-3393.830) [-3387.589] (-3386.614) -- 0:00:01 996000 -- [-3385.911] (-3394.146) (-3385.247) (-3387.615) * (-3390.717) (-3388.125) (-3393.654) [-3386.215] -- 0:00:01 996500 -- (-3386.179) (-3386.115) [-3395.581] (-3382.961) * [-3389.323] (-3385.698) (-3391.769) (-3388.922) -- 0:00:01 997000 -- (-3397.148) (-3387.853) [-3381.554] (-3388.304) * (-3389.459) (-3390.106) [-3388.042] (-3382.215) -- 0:00:01 997500 -- (-3392.711) [-3384.566] (-3391.359) (-3382.854) * (-3390.062) [-3379.554] (-3396.659) (-3385.078) -- 0:00:00 998000 -- [-3391.781] (-3388.739) (-3392.179) (-3385.589) * (-3386.642) (-3388.529) [-3384.207] (-3397.034) -- 0:00:00 998500 -- (-3393.509) [-3389.427] (-3386.930) (-3382.064) * (-3393.280) (-3388.936) (-3385.714) [-3385.354] -- 0:00:00 999000 -- [-3382.743] (-3384.428) (-3388.995) (-3388.297) * [-3389.381] (-3388.887) (-3389.493) (-3384.680) -- 0:00:00 999500 -- (-3390.564) [-3382.949] (-3392.710) (-3388.900) * (-3384.627) (-3383.619) [-3383.022] (-3383.077) -- 0:00:00 1000000 -- [-3384.937] (-3395.498) (-3390.641) (-3398.180) * (-3384.595) (-3387.278) [-3386.364] (-3390.739) -- 0:00:00 Average standard deviation of split frequencies: 0.000353 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3384.937043 -- 14.926808 Chain 1 -- -3384.937043 -- 14.926808 Chain 2 -- -3395.498306 -- 15.434799 Chain 2 -- -3395.498301 -- 15.434799 Chain 3 -- -3390.640727 -- 14.617178 Chain 3 -- -3390.640732 -- 14.617178 Chain 4 -- -3398.179685 -- 12.030030 Chain 4 -- -3398.179685 -- 12.030030 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3384.595455 -- 14.662037 Chain 1 -- -3384.595443 -- 14.662037 Chain 2 -- -3387.277726 -- 16.419486 Chain 2 -- -3387.277739 -- 16.419486 Chain 3 -- -3386.364278 -- 15.743899 Chain 3 -- -3386.364288 -- 15.743899 Chain 4 -- -3390.738980 -- 16.381333 Chain 4 -- -3390.738982 -- 16.381333 Analysis completed in 6 mins 11 seconds Analysis used 370.85 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3375.75 Likelihood of best state for "cold" chain of run 2 was -3375.75 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 43.9 % ( 33 %) Dirichlet(Revmat{all}) 59.5 % ( 45 %) Slider(Revmat{all}) 22.3 % ( 24 %) Dirichlet(Pi{all}) 25.8 % ( 24 %) Slider(Pi{all}) 59.7 % ( 35 %) Multiplier(Alpha{1,2}) 41.7 % ( 27 %) Multiplier(Alpha{3}) 45.1 % ( 27 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.1 % ( 0 %) NNI(Tau{all},V{all}) 0.1 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 25 %) Multiplier(V{all}) 28.3 % ( 28 %) Nodeslider(V{all}) 25.3 % ( 27 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 44.0 % ( 33 %) Dirichlet(Revmat{all}) 59.7 % ( 45 %) Slider(Revmat{all}) 22.5 % ( 24 %) Dirichlet(Pi{all}) 25.8 % ( 28 %) Slider(Pi{all}) 61.3 % ( 30 %) Multiplier(Alpha{1,2}) 42.1 % ( 32 %) Multiplier(Alpha{3}) 45.5 % ( 25 %) Slider(Pinvar{all}) 0.1 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.1 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 31 %) Multiplier(V{all}) 28.1 % ( 17 %) Nodeslider(V{all}) 25.4 % ( 20 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.65 0.52 2 | 166496 0.83 0.69 3 | 165991 166962 0.84 4 | 166796 167130 166625 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.65 0.52 2 | 166956 0.83 0.68 3 | 166058 166554 0.84 4 | 167406 167052 165974 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3385.08 | 1 2 1 | |1 1 | | 2 2 1 2 1 | | 12 1 2 2 | | 2 2 2 2 *1 2 1 1 | | 1 1 2 2 1| | 1 2 2 1 2 1 1 2 | | 1 2 1 2 1 22 2 1 2 * 1 2 2 11 | | 1 2 2 11 221 11 1 12 2 2 1 2 | | 112 21 1 2 1 2 2 2 2 2| | 2 22 11 1 1 2 2 1 1 2 2 2 | |2 1 2 2 1 1 2 1 11 | | 2 2 1 1 2 1 | | 2 1 | | 1 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3388.57 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3382.54 -3395.85 2 -3382.93 -3395.25 -------------------------------------- TOTAL -3382.71 -3395.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.502407 0.002429 0.407551 0.598454 0.499052 1501.00 1501.00 1.000 r(A<->C){all} 0.127469 0.000760 0.076612 0.182377 0.126030 978.65 1063.86 1.000 r(A<->G){all} 0.232638 0.001294 0.159760 0.300486 0.230896 980.78 984.66 1.001 r(A<->T){all} 0.163009 0.001074 0.097689 0.226318 0.161007 955.90 1010.40 1.007 r(C<->G){all} 0.101349 0.000355 0.068577 0.142154 0.100195 1110.41 1151.13 1.001 r(C<->T){all} 0.329771 0.001442 0.258815 0.408474 0.329068 847.96 880.43 1.000 r(G<->T){all} 0.045763 0.000214 0.019913 0.076394 0.044328 892.18 1030.90 1.000 pi(A){all} 0.211250 0.000107 0.190183 0.230587 0.211423 1005.11 1253.05 1.000 pi(C){all} 0.280057 0.000119 0.260100 0.301587 0.280039 1405.84 1453.42 1.000 pi(G){all} 0.279908 0.000131 0.257870 0.302111 0.279932 1234.52 1273.36 1.000 pi(T){all} 0.228785 0.000106 0.209786 0.249707 0.228570 1285.49 1315.87 1.000 alpha{1,2} 0.047627 0.000909 0.000104 0.097161 0.046192 744.06 1122.53 1.000 alpha{3} 3.413284 0.985121 1.762646 5.431063 3.286415 1333.95 1356.01 1.000 pinvar{all} 0.426720 0.002143 0.332089 0.512526 0.428400 1221.63 1259.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 Key to taxon bipartitions (saved to file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------- 1 -- .****** 2 -- .*..... 3 -- ..*.... 4 -- ...*... 5 -- ....*.. 6 -- .....*. 7 -- ......* 8 -- .....** 9 -- .**.... 10 -- ...**** 11 -- ...**.. ------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 3002 1.000000 0.000000 1.000000 1.000000 2 10 3000 0.999334 0.000942 0.998668 1.000000 2 11 2999 0.999001 0.000471 0.998668 0.999334 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.018545 0.000027 0.009247 0.029341 0.018036 1.000 2 length{all}[2] 0.007694 0.000009 0.002566 0.013535 0.007260 1.000 2 length{all}[3] 0.001110 0.000001 0.000000 0.003212 0.000787 1.000 2 length{all}[4] 0.050411 0.000092 0.033758 0.070247 0.049674 1.000 2 length{all}[5] 0.035729 0.000063 0.020436 0.050725 0.035084 1.000 2 length{all}[6] 0.102230 0.000386 0.065258 0.140679 0.100615 1.000 2 length{all}[7] 0.204763 0.001050 0.143781 0.265948 0.201425 1.000 2 length{all}[8] 0.042279 0.000194 0.016746 0.070574 0.041210 1.001 2 length{all}[9] 0.012945 0.000019 0.004992 0.021369 0.012454 1.000 2 length{all}[10] 0.012555 0.000025 0.003686 0.022938 0.011918 1.000 2 length{all}[11] 0.014164 0.000029 0.004734 0.024703 0.013566 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000353 Maximum standard deviation of split frequencies = 0.000942 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------ C2 (2) |----------------------100----------------------+ | \------------------------ C3 (3) + | /------------------------ C4 (4) | /----------100----------+ | | \------------------------ C5 (5) \----------100----------+ | /------------------------ C6 (6) \----------100----------+ \------------------------ C7 (7) Phylogram (based on average branch lengths): /----- C1 (1) | | /-- C2 (2) |---+ | \ C3 (3) + | /-------------- C4 (4) | /---+ | | \---------- C5 (5) \--+ | /---------------------------- C6 (6) \-----------+ \--------------------------------------------------------- C7 (7) |-------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (5 trees sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 7 ls = 1413 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Sites with gaps or missing data are removed. 93 ambiguity characters in seq. 1 78 ambiguity characters in seq. 2 78 ambiguity characters in seq. 3 60 ambiguity characters in seq. 4 93 ambiguity characters in seq. 5 75 ambiguity characters in seq. 6 84 ambiguity characters in seq. 7 31 sites are removed. 25 26 27 28 29 30 198 199 200 212 213 214 215 216 217 218 219 220 221 222 461 462 463 464 465 466 467 468 469 470 471 Sequences read.. Counting site patterns.. 0:00 234 patterns at 440 / 440 sites (100.0%), 0:00 Counting codons.. 168 bytes for distance 228384 bytes for conP 31824 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 570960 bytes for conP, adjusted 0.037675 0.019144 0.015545 0.000000 0.031914 0.009735 0.087202 0.068870 0.056428 0.168723 0.268523 0.300000 1.300000 ntime & nrate & np: 11 2 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 13 lnL0 = -3543.976301 Iterating by ming2 Initial: fx= 3543.976301 x= 0.03768 0.01914 0.01554 0.00000 0.03191 0.00974 0.08720 0.06887 0.05643 0.16872 0.26852 0.30000 1.30000 1 h-m-p 0.0000 0.0000 744.6714 ++ 3543.975287 m 0.0000 18 | 1/13 2 h-m-p 0.0000 0.0002 697.4349 ++YYYYYYCCC 3517.518393 8 0.0002 46 | 1/13 3 h-m-p 0.0000 0.0001 2614.2235 +YYCCC 3480.884469 4 0.0001 69 | 1/13 4 h-m-p 0.0000 0.0001 6150.0859 YYCYC 3452.588432 4 0.0000 90 | 1/13 5 h-m-p 0.0001 0.0003 1615.4406 +YCYYCCC 3394.712269 6 0.0002 116 | 1/13 6 h-m-p 0.0001 0.0003 1084.6679 +YYYYCCC 3362.095865 6 0.0003 141 | 1/13 7 h-m-p 0.0000 0.0002 1158.1094 +YYCCCC 3334.322519 5 0.0002 166 | 1/13 8 h-m-p 0.0000 0.0002 2343.0155 ++ 3191.305668 m 0.0002 182 | 1/13 9 h-m-p -0.0000 -0.0000 11986.0485 h-m-p: -2.70767305e-21 -1.35383653e-20 1.19860485e+04 3191.305668 .. | 1/13 10 h-m-p 0.0000 0.0002 6221.6576 CYYYCC 3173.410554 5 0.0000 218 | 1/13 11 h-m-p 0.0000 0.0002 808.3601 +YYYCCC 3135.437744 5 0.0001 242 | 1/13 12 h-m-p 0.0000 0.0001 1302.7418 CCC 3131.007967 2 0.0000 262 | 1/13 13 h-m-p 0.0000 0.0002 392.6533 +YCYCCC 3123.934289 5 0.0001 287 | 1/13 14 h-m-p 0.0000 0.0002 272.0553 YCYCCC 3120.918128 5 0.0001 311 | 1/13 15 h-m-p 0.0001 0.0006 439.9153 +YYYYYC 3111.587126 5 0.0003 333 | 1/13 16 h-m-p 0.0001 0.0003 773.8070 CCCCC 3108.161004 4 0.0001 357 | 1/13 17 h-m-p 0.0001 0.0006 122.0845 CYC 3107.634676 2 0.0001 376 | 1/13 18 h-m-p 0.0007 0.0090 19.0263 CC 3107.606473 1 0.0002 394 | 1/13 19 h-m-p 0.0003 0.0122 11.7198 CC 3107.587412 1 0.0003 412 | 1/13 20 h-m-p 0.0004 0.0823 10.5429 ++YCC 3107.430036 2 0.0046 433 | 1/13 21 h-m-p 0.0012 0.0418 38.5703 +CCCC 3106.794321 3 0.0052 456 | 1/13 22 h-m-p 0.9524 4.7618 0.0663 YCCC 3105.722052 3 0.6142 477 | 1/13 23 h-m-p 1.6000 8.0000 0.0113 CCC 3105.549662 2 1.3766 509 | 1/13 24 h-m-p 1.6000 8.0000 0.0046 CC 3105.529125 1 1.3999 539 | 1/13 25 h-m-p 1.6000 8.0000 0.0033 +YC 3105.466457 1 4.0292 569 | 1/13 26 h-m-p 1.3255 8.0000 0.0100 CC 3105.437983 1 1.4551 599 | 1/13 27 h-m-p 1.6000 8.0000 0.0014 CC 3105.435403 1 1.4374 629 | 1/13 28 h-m-p 1.6000 8.0000 0.0003 C 3105.434841 0 1.7914 657 | 1/13 29 h-m-p 1.6000 8.0000 0.0003 Y 3105.434809 0 1.1967 685 | 1/13 30 h-m-p 1.6000 8.0000 0.0001 Y 3105.434808 0 1.2432 713 | 1/13 31 h-m-p 1.6000 8.0000 0.0000 C 3105.434808 0 1.2829 741 | 1/13 32 h-m-p 1.6000 8.0000 0.0000 Y 3105.434808 0 1.1182 769 | 1/13 33 h-m-p 1.6000 8.0000 0.0000 C 3105.434808 0 0.5985 797 | 1/13 34 h-m-p 1.2902 8.0000 0.0000 ---------------Y 3105.434808 0 0.0000 840 Out.. lnL = -3105.434808 841 lfun, 841 eigenQcodon, 9251 P(t) Time used: 0:04 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 0.038153 0.019389 0.014430 0.000000 0.031699 0.009421 0.087016 0.069123 0.055558 0.170076 0.268177 1.430146 0.534390 0.193110 ntime & nrate & np: 11 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.860990 np = 14 lnL0 = -3265.510402 Iterating by ming2 Initial: fx= 3265.510402 x= 0.03815 0.01939 0.01443 0.00000 0.03170 0.00942 0.08702 0.06912 0.05556 0.17008 0.26818 1.43015 0.53439 0.19311 1 h-m-p 0.0000 0.0000 730.9280 ++ 3265.509266 m 0.0000 19 | 1/14 2 h-m-p 0.0000 0.0005 564.7087 +++ 3171.427439 m 0.0005 37 | 2/14 3 h-m-p 0.0000 0.0000 7539.8536 ++ 3165.184681 m 0.0000 54 | 2/14 4 h-m-p 0.0000 0.0000 2311.6058 h-m-p: 2.50014976e-20 1.25007488e-19 2.31160576e+03 3165.184681 .. | 2/14 5 h-m-p 0.0000 0.0002 4105.7267 YYYCCC 3139.420133 5 0.0000 92 | 2/14 6 h-m-p 0.0000 0.0002 409.0767 +YYYYYCCCCC 3117.928707 9 0.0002 123 | 2/14 7 h-m-p 0.0000 0.0001 1341.5354 +YYCCCC 3101.950164 5 0.0001 149 | 2/14 8 h-m-p 0.0001 0.0006 265.1636 YCYCCC 3095.359251 5 0.0002 174 | 1/14 9 h-m-p 0.0000 0.0000 4080.1141 CCCCC 3091.457042 4 0.0000 199 | 1/14 10 h-m-p 0.0000 0.0002 323.2545 CCCC 3089.780300 3 0.0001 222 | 1/14 11 h-m-p 0.0005 0.0031 45.0597 YCC 3089.504658 2 0.0003 242 | 1/14 12 h-m-p 0.0004 0.0020 33.0860 CC 3089.446649 1 0.0002 261 | 1/14 13 h-m-p 0.0002 0.0051 24.1249 CC 3089.390735 1 0.0003 280 | 1/14 14 h-m-p 0.0008 0.0139 9.9435 YC 3089.378808 1 0.0003 298 | 1/14 15 h-m-p 0.0010 0.1031 2.9698 CC 3089.371765 1 0.0011 317 | 1/14 16 h-m-p 0.0009 0.0565 3.8527 YC 3089.366048 1 0.0007 335 | 1/14 17 h-m-p 0.0045 2.2479 0.8624 +++YCCC 3088.092228 3 0.1825 360 | 1/14 18 h-m-p 0.0535 0.5457 2.9435 CCCC 3087.648415 3 0.0560 396 | 1/14 19 h-m-p 1.6000 8.0000 0.0134 CCC 3086.951913 2 2.4400 417 | 1/14 20 h-m-p 1.6000 8.0000 0.0130 YCC 3086.653568 2 1.1584 450 | 1/14 21 h-m-p 0.8899 5.5240 0.0169 CCCC 3086.264565 3 1.0350 486 | 1/14 22 h-m-p 1.6000 8.0000 0.0062 CCC 3086.106462 2 1.9476 520 | 1/14 23 h-m-p 1.3418 8.0000 0.0090 CC 3086.058239 1 1.5571 552 | 1/14 24 h-m-p 1.6000 8.0000 0.0027 YC 3086.055450 1 1.0686 583 | 1/14 25 h-m-p 1.6000 8.0000 0.0002 Y 3086.055410 0 0.8573 613 | 1/14 26 h-m-p 1.6000 8.0000 0.0000 Y 3086.055409 0 0.9058 643 | 1/14 27 h-m-p 1.6000 8.0000 0.0000 Y 3086.055409 0 1.0944 673 | 1/14 28 h-m-p 1.6000 8.0000 0.0000 Y 3086.055409 0 0.9115 703 | 1/14 29 h-m-p 1.6000 8.0000 0.0000 --------------C 3086.055409 0 0.0000 747 Out.. lnL = -3086.055409 748 lfun, 2244 eigenQcodon, 16456 P(t) Time used: 0:12 Model 2: PositiveSelection TREE # 1 (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 initial w for M2:NSpselection reset. 0.037930 0.019927 0.014719 0.000000 0.031464 0.008236 0.087327 0.068636 0.055998 0.169732 0.269985 1.461138 1.131355 0.291249 0.418683 2.981222 ntime & nrate & np: 11 3 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.116673 np = 16 lnL0 = -3345.612088 Iterating by ming2 Initial: fx= 3345.612088 x= 0.03793 0.01993 0.01472 0.00000 0.03146 0.00824 0.08733 0.06864 0.05600 0.16973 0.26998 1.46114 1.13136 0.29125 0.41868 2.98122 1 h-m-p 0.0000 0.0000 812.2402 ++ 3345.610547 m 0.0000 21 | 1/16 2 h-m-p 0.0000 0.0006 330.6031 ++YCCCC 3335.851290 4 0.0003 49 | 1/16 3 h-m-p 0.0001 0.0004 585.0054 +YYCYYYYCCC 3295.705486 10 0.0004 82 | 1/16 4 h-m-p 0.0000 0.0000 13440.3226 +YYYCYCCCC 3277.289006 8 0.0000 114 | 1/16 5 h-m-p 0.0000 0.0001 1913.8865 ++ 3253.698290 m 0.0001 133 | 2/16 6 h-m-p 0.0002 0.0010 114.9581 +YYCCC 3246.824855 4 0.0007 159 | 1/16 7 h-m-p 0.0000 0.0000 11339.6217 ++ 3241.868078 m 0.0000 178 | 1/16 8 h-m-p -0.0000 -0.0000 710.4881 h-m-p: -1.53299773e-21 -7.66498865e-21 7.10488146e+02 3241.868078 .. | 1/16 9 h-m-p 0.0000 0.0002 300339.1658 -CCYYCYYCCC 3205.039025 9 0.0000 229 | 1/16 10 h-m-p 0.0000 0.0000 773.0265 ++ 3197.306820 m 0.0000 248 | 2/16 11 h-m-p 0.0001 0.0007 212.6015 +CC 3192.084515 1 0.0003 270 | 2/16 12 h-m-p 0.0003 0.0021 249.7191 +CYCCC 3162.018284 4 0.0015 298 | 2/16 13 h-m-p 0.0001 0.0003 1205.5382 YCCC 3154.735628 3 0.0001 322 | 2/16 14 h-m-p 0.0004 0.0020 348.9582 +YCCC 3137.875576 3 0.0010 347 | 2/16 15 h-m-p 0.0008 0.0038 171.1686 CCCC 3132.011948 3 0.0010 372 | 1/16 16 h-m-p 0.0000 0.0001 4889.4315 YCCCC 3129.940626 4 0.0000 398 | 1/16 17 h-m-p 0.0003 0.0034 201.9994 YCCC 3126.985723 3 0.0005 422 | 1/16 18 h-m-p 0.0004 0.0028 253.0549 +YYCCC 3113.417226 4 0.0015 448 | 1/16 19 h-m-p 0.0006 0.0028 128.9183 CCCCC 3110.987000 4 0.0008 475 | 1/16 20 h-m-p 0.0007 0.0041 152.2497 CCCCC 3107.769017 4 0.0010 502 | 1/16 21 h-m-p 0.0325 0.7462 4.5919 +CCCCC 3104.056223 4 0.1687 530 | 1/16 22 h-m-p 0.0542 0.2752 14.2827 CCCCC 3099.395828 4 0.0726 557 | 1/16 23 h-m-p 0.2032 1.0772 5.1028 CYC 3094.311236 2 0.2326 579 | 1/16 24 h-m-p 1.2578 6.2890 0.5276 CCCC 3089.970364 3 1.2718 604 | 1/16 25 h-m-p 1.0356 7.8644 0.6480 CCCC 3088.887586 3 0.7765 644 | 1/16 26 h-m-p 0.9149 5.9218 0.5499 CCCCC 3087.880623 4 1.1584 686 | 1/16 27 h-m-p 0.5338 4.0531 1.1934 CC 3087.253307 1 0.6957 722 | 1/16 28 h-m-p 1.5857 8.0000 0.5236 YCCC 3086.905284 3 0.9556 746 | 1/16 29 h-m-p 1.1807 8.0000 0.4238 YC 3086.729290 1 0.8862 781 | 1/16 30 h-m-p 1.4135 8.0000 0.2657 CC 3086.531263 1 1.9894 817 | 1/16 31 h-m-p 0.9594 8.0000 0.5509 CCC 3086.353227 2 1.4618 855 | 1/16 32 h-m-p 1.6000 8.0000 0.4407 CC 3086.281311 1 1.4897 891 | 1/16 33 h-m-p 0.9508 8.0000 0.6905 CCC 3086.216984 2 1.2956 929 | 1/16 34 h-m-p 0.8599 8.0000 1.0403 YC 3086.135120 1 1.5755 964 | 1/16 35 h-m-p 1.6000 8.0000 0.7776 CYC 3086.102198 2 1.7997 986 | 1/16 36 h-m-p 1.6000 8.0000 0.8050 CY 3086.083754 1 1.7267 1022 | 1/16 37 h-m-p 1.4229 8.0000 0.9768 CYC 3086.068754 2 1.7522 1059 | 1/16 38 h-m-p 1.2725 8.0000 1.3451 CC 3086.062093 1 1.1140 1095 | 1/16 39 h-m-p 1.6000 8.0000 0.8763 C 3086.058796 0 1.6000 1114 | 1/16 40 h-m-p 1.4542 8.0000 0.9642 YC 3086.056616 1 2.7527 1149 | 1/16 41 h-m-p 1.6000 8.0000 0.8133 C 3086.055924 0 1.6000 1183 | 1/16 42 h-m-p 1.6000 8.0000 0.7884 YC 3086.055629 1 2.9259 1218 | 1/16 43 h-m-p 1.6000 8.0000 0.7622 C 3086.055503 0 1.9749 1252 | 1/16 44 h-m-p 1.6000 8.0000 0.7120 Y 3086.055446 0 3.0211 1286 | 1/16 45 h-m-p 1.6000 8.0000 0.7316 C 3086.055425 0 2.0303 1320 | 1/16 46 h-m-p 1.6000 8.0000 0.6583 Y 3086.055416 0 3.0012 1354 | 1/16 47 h-m-p 1.6000 8.0000 0.6722 C 3086.055412 0 2.5139 1388 | 1/16 48 h-m-p 1.6000 8.0000 0.7561 Y 3086.055410 0 2.5734 1422 | 1/16 49 h-m-p 1.6000 8.0000 0.6626 C 3086.055409 0 2.3158 1456 | 1/16 50 h-m-p 1.6000 8.0000 0.7762 Y 3086.055409 0 3.6080 1490 | 1/16 51 h-m-p 1.6000 8.0000 1.1721 C 3086.055409 0 2.0676 1524 | 1/16 52 h-m-p 1.0015 8.0000 2.4197 -------Y 3086.055409 0 0.0000 1550 | 1/16 53 h-m-p 0.0160 8.0000 0.0054 +C 3086.055409 0 0.0650 1570 | 1/16 54 h-m-p 1.6000 8.0000 0.0000 C 3086.055409 0 0.6110 1604 | 1/16 55 h-m-p 0.2626 8.0000 0.0001 ---------------.. | 1/16 56 h-m-p 0.0134 6.6908 0.0059 ---Y 3086.055409 0 0.0000 1688 | 1/16 57 h-m-p 0.0160 8.0000 0.0030 ---C 3086.055409 0 0.0001 1725 | 1/16 58 h-m-p 0.0160 8.0000 0.0006 ----C 3086.055409 0 0.0000 1763 Out.. lnL = -3086.055409 1764 lfun, 7056 eigenQcodon, 58212 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3111.794936 S = -3025.288545 -77.637917 Calculating f(w|X), posterior probabilities of site classes. did 10 / 234 patterns 0:40 did 20 / 234 patterns 0:40 did 30 / 234 patterns 0:40 did 40 / 234 patterns 0:40 did 50 / 234 patterns 0:40 did 60 / 234 patterns 0:40 did 70 / 234 patterns 0:41 did 80 / 234 patterns 0:41 did 90 / 234 patterns 0:41 did 100 / 234 patterns 0:41 did 110 / 234 patterns 0:41 did 120 / 234 patterns 0:41 did 130 / 234 patterns 0:41 did 140 / 234 patterns 0:41 did 150 / 234 patterns 0:41 did 160 / 234 patterns 0:41 did 170 / 234 patterns 0:41 did 180 / 234 patterns 0:41 did 190 / 234 patterns 0:41 did 200 / 234 patterns 0:41 did 210 / 234 patterns 0:41 did 220 / 234 patterns 0:41 did 230 / 234 patterns 0:41 did 234 / 234 patterns 0:41 Time used: 0:41 Model 3: discrete TREE # 1 (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 0.037732 0.019094 0.014717 0.000000 0.031160 0.008670 0.087969 0.068881 0.055816 0.169979 0.268366 1.461148 0.960589 0.897086 0.020435 0.052566 0.071588 ntime & nrate & np: 11 4 17 Bounds (np=17): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 19.110000 np = 17 lnL0 = -3106.909612 Iterating by ming2 Initial: fx= 3106.909612 x= 0.03773 0.01909 0.01472 0.00000 0.03116 0.00867 0.08797 0.06888 0.05582 0.16998 0.26837 1.46115 0.96059 0.89709 0.02043 0.05257 0.07159 1 h-m-p 0.0000 0.0000 606.5321 ++ 3106.908908 m 0.0000 22 | 1/17 2 h-m-p 0.0000 0.0001 217.1238 ++ 3103.444026 m 0.0001 42 | 2/17 3 h-m-p 0.0002 0.0014 124.9810 CYC 3102.609398 2 0.0002 65 | 2/17 4 h-m-p 0.0001 0.0004 136.8914 CCCC 3102.213218 3 0.0001 91 | 2/17 5 h-m-p 0.0001 0.0012 157.8150 +YCCC 3101.421275 3 0.0002 117 | 2/17 6 h-m-p 0.0000 0.0002 626.6845 ++ 3097.679359 m 0.0002 137 | 3/17 7 h-m-p 0.0011 0.0056 56.4155 YCCC 3097.081000 3 0.0006 162 | 3/17 8 h-m-p 0.0005 0.0027 26.9936 CC 3097.018236 1 0.0002 184 | 3/17 9 h-m-p 0.0004 0.0182 14.7079 C 3096.990735 0 0.0004 204 | 3/17 10 h-m-p 0.0006 0.1162 9.9967 +YCC 3096.917412 2 0.0018 228 | 3/17 11 h-m-p 0.0003 0.0151 52.5648 +YCC 3096.669757 2 0.0012 252 | 3/17 12 h-m-p 0.0007 0.0168 86.5561 CCC 3096.271050 2 0.0011 276 | 3/17 13 h-m-p 0.0009 0.0215 113.2958 +YCC 3095.043340 2 0.0028 300 | 3/17 14 h-m-p 0.1035 0.7070 3.0217 CCCCC 3093.838087 4 0.1131 328 | 2/17 15 h-m-p 0.0121 0.1094 28.2345 ---CY 3093.825826 1 0.0001 353 | 2/17 16 h-m-p 0.0004 0.0250 3.2381 +++ 3093.162337 m 0.0250 374 | 3/17 17 h-m-p 0.2268 2.3097 0.3575 +YYYC 3089.223973 3 0.8388 398 | 3/17 18 h-m-p 0.3692 5.1873 0.8123 YCCC 3087.458583 3 0.8528 437 | 2/17 19 h-m-p 0.0005 0.0026 1332.9992 CC 3087.338628 1 0.0002 473 | 2/17 20 h-m-p 0.8796 5.4385 0.2716 YYC 3087.064658 2 0.7390 495 | 2/17 21 h-m-p 0.5338 8.0000 0.3760 +CYC 3086.736638 2 2.0111 534 | 1/17 22 h-m-p 0.5139 4.2457 1.4713 ----C 3086.736515 0 0.0006 573 | 1/17 23 h-m-p 0.0054 2.6872 0.1859 +++YCC 3086.587740 2 0.2858 599 | 1/17 24 h-m-p 0.4521 8.0000 0.1175 +YCCC 3086.267868 3 3.9010 641 | 1/17 25 h-m-p 1.6000 8.0000 0.1979 CCC 3086.096911 2 1.5597 681 | 1/17 26 h-m-p 1.6000 8.0000 0.0395 CC 3086.064119 1 1.2927 719 | 1/17 27 h-m-p 0.5605 8.0000 0.0911 YC 3086.056888 1 1.1075 756 | 1/17 28 h-m-p 1.6000 8.0000 0.0239 YC 3086.052142 1 0.6522 793 | 1/17 29 h-m-p 0.5997 8.0000 0.0260 YC 3086.048424 1 1.4356 830 | 1/17 30 h-m-p 1.6000 8.0000 0.0040 YC 3086.047953 1 1.1069 867 | 1/17 31 h-m-p 1.6000 8.0000 0.0014 Y 3086.047921 0 0.9100 903 | 1/17 32 h-m-p 1.2396 8.0000 0.0011 C 3086.047914 0 1.4375 939 | 1/17 33 h-m-p 1.6000 8.0000 0.0001 ++ 3086.047893 m 8.0000 975 | 1/17 34 h-m-p 0.2517 8.0000 0.0018 +++ 3086.047672 m 8.0000 1012 | 1/17 35 h-m-p 0.8377 4.1885 0.0138 ++ 3086.044256 m 4.1885 1048 | 2/17 36 h-m-p 0.6082 3.0409 0.0434 -C 3086.043447 0 0.0364 1085 | 1/17 37 h-m-p 0.0000 0.0002 526.0149 ---Y 3086.043447 0 0.0000 1123 | 1/17 38 h-m-p 0.0002 0.0530 0.0990 +++++ 3086.042588 m 0.0530 1146 | 2/17 39 h-m-p 0.0675 8.0000 0.0778 ++CC 3086.036404 1 0.9759 1186 | 2/17 40 h-m-p 1.6000 8.0000 0.0026 Y 3086.036342 0 3.4695 1221 | 2/17 41 h-m-p 1.3481 8.0000 0.0067 ++ 3086.035564 m 8.0000 1256 | 2/17 42 h-m-p 0.0955 8.0000 0.5610 C 3086.034819 0 0.0998 1291 | 1/17 43 h-m-p 0.0003 0.1569 803.7703 C 3086.034279 0 0.0001 1326 | 1/17 44 h-m-p 0.7821 8.0000 0.0806 CC 3086.033641 1 0.8592 1348 | 1/17 45 h-m-p 1.0958 8.0000 0.0632 CC 3086.032377 1 1.4126 1386 | 1/17 46 h-m-p 1.6000 8.0000 0.0232 C 3086.031655 0 1.6000 1422 | 1/17 47 h-m-p 1.6000 8.0000 0.0143 YC 3086.031369 1 0.6959 1459 | 1/17 48 h-m-p 0.1340 8.0000 0.0742 +YC 3086.030470 1 1.1717 1497 | 1/17 49 h-m-p 1.4518 8.0000 0.0599 YY 3086.029581 1 1.4518 1534 | 1/17 50 h-m-p 1.0926 5.4632 0.0203 C 3086.027854 0 1.3838 1570 | 1/17 51 h-m-p 0.3148 8.0000 0.0892 YC 3086.026667 1 0.7393 1607 | 1/17 52 h-m-p 1.0816 5.4081 0.0467 C 3086.024600 0 1.1045 1643 | 1/17 53 h-m-p 0.2814 1.4072 0.0595 +YC 3086.022828 1 0.7832 1681 | 1/17 54 h-m-p 0.0745 0.3727 0.0860 ++ 3086.021142 m 0.3727 1717 | 2/17 55 h-m-p 0.1576 8.0000 0.2033 C 3086.020552 0 0.1576 1753 | 1/17 56 h-m-p 0.0000 0.0003 431323.9835 ----Y 3086.020547 0 0.0000 1792 | 1/17 57 h-m-p 0.0125 3.2406 0.2165 -------------.. | 2/17 58 h-m-p 0.0052 2.6011 3.9094 --YC 3086.020163 1 0.0001 1862 | 1/17 59 h-m-p 0.0002 0.0753 131.5803 -----Y 3086.020163 0 0.0000 1887 | 1/17 60 h-m-p 0.0000 0.0004 6.7786 +C 3086.019870 0 0.0000 1908 | 1/17 61 h-m-p 0.0001 0.0023 2.9384 YC 3086.019492 1 0.0002 1929 | 2/17 62 h-m-p 0.0013 0.1397 0.4374 -Y 3086.019480 0 0.0001 1950 | 2/17 63 h-m-p 0.0009 0.4497 0.2191 Y 3086.019478 0 0.0002 1985 | 2/17 64 h-m-p 0.0018 0.9202 0.0694 -C 3086.019477 0 0.0001 2021 | 2/17 65 h-m-p 0.0090 4.4815 0.0623 -C 3086.019477 0 0.0005 2057 | 2/17 66 h-m-p 0.0127 6.3685 0.0845 -Y 3086.019475 0 0.0016 2093 | 2/17 67 h-m-p 0.0011 0.5256 0.3475 Y 3086.019474 0 0.0002 2128 | 2/17 68 h-m-p 0.0150 7.5108 0.2276 Y 3086.019466 0 0.0026 2163 | 2/17 69 h-m-p 0.0160 8.0000 1.6522 YC 3086.019218 1 0.0109 2199 | 2/17 70 h-m-p 0.0069 1.1003 2.6169 -Y 3086.019188 0 0.0009 2220 | 2/17 71 h-m-p 0.0160 8.0000 0.4160 +CC 3086.018561 1 0.1019 2243 | 2/17 72 h-m-p 0.1087 8.0000 0.3900 Y 3086.018117 0 0.0709 2278 | 1/17 73 h-m-p 0.0006 0.3038 459.0772 C 3086.017463 0 0.0001 2313 | 1/17 74 h-m-p 1.6000 8.0000 0.0385 YC 3086.017065 1 0.7625 2334 | 1/17 75 h-m-p 1.6000 8.0000 0.0150 C 3086.016927 0 0.6032 2370 | 1/17 76 h-m-p 0.8249 8.0000 0.0110 +C 3086.016727 0 3.2998 2407 | 1/17 77 h-m-p 1.6000 8.0000 0.0033 C 3086.016576 0 2.2208 2443 | 1/17 78 h-m-p 0.5883 8.0000 0.0125 +C 3086.016422 0 2.3531 2480 | 1/17 79 h-m-p 0.4926 2.4630 0.0226 +C 3086.016186 0 2.0217 2517 | 1/17 80 h-m-p 0.0644 0.3221 0.0207 ++ 3086.016129 m 0.3221 2553 | 2/17 81 h-m-p 0.0185 8.0000 0.3599 Y 3086.016084 0 0.0122 2589 | 2/17 82 h-m-p 0.4126 8.0000 0.0107 Y 3086.016049 0 0.9884 2624 | 2/17 83 h-m-p 1.6000 8.0000 0.0018 C 3086.016048 0 1.4782 2659 | 2/17 84 h-m-p 1.6000 8.0000 0.0002 Y 3086.016048 0 1.2236 2694 | 2/17 85 h-m-p 1.6000 8.0000 0.0000 Y 3086.016048 0 0.8754 2729 | 2/17 86 h-m-p 1.6000 8.0000 0.0000 Y 3086.016048 0 0.4000 2764 | 2/17 87 h-m-p 0.5964 8.0000 0.0000 +Y 3086.016048 0 2.3856 2800 | 2/17 88 h-m-p 1.6000 8.0000 0.0000 ----------Y 3086.016048 0 0.0000 2845 Out.. lnL = -3086.016048 2846 lfun, 11384 eigenQcodon, 93918 P(t) Time used: 1:26 Model 7: beta TREE # 1 (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 0.037933 0.020073 0.014202 0.000000 0.030092 0.009982 0.087057 0.069769 0.056726 0.167667 0.264377 1.459426 0.496071 1.323761 ntime & nrate & np: 11 1 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 11.716344 np = 14 lnL0 = -3171.334463 Iterating by ming2 Initial: fx= 3171.334463 x= 0.03793 0.02007 0.01420 0.00000 0.03009 0.00998 0.08706 0.06977 0.05673 0.16767 0.26438 1.45943 0.49607 1.32376 1 h-m-p 0.0000 0.0000 614.0847 ++ 3171.333676 m 0.0000 19 | 1/14 2 h-m-p 0.0000 0.0007 269.2253 ++YCCCC 3162.916297 4 0.0003 45 | 1/14 3 h-m-p 0.0001 0.0003 853.2141 +YYYCYCYCC 3133.728822 8 0.0002 74 | 1/14 4 h-m-p 0.0000 0.0000 12340.1944 +YCYCCC 3113.950015 5 0.0000 100 | 1/14 5 h-m-p 0.0001 0.0003 266.1653 CYCCC 3112.092847 4 0.0001 124 | 1/14 6 h-m-p 0.0006 0.0081 41.7471 YCCC 3111.066041 3 0.0012 146 | 1/14 7 h-m-p 0.0002 0.0009 141.4565 YCCCC 3110.583814 4 0.0002 170 | 1/14 8 h-m-p 0.0002 0.0018 150.5756 YC 3109.811246 1 0.0003 188 | 1/14 9 h-m-p 0.0005 0.0044 96.9541 +YYYC 3107.119159 3 0.0019 209 | 1/14 10 h-m-p 0.0004 0.0018 304.4526 CCCC 3105.491250 3 0.0004 232 | 1/14 11 h-m-p 0.0015 0.0077 58.6174 YYYC 3104.534824 3 0.0015 252 | 1/14 12 h-m-p 0.0019 0.0097 29.2297 CC 3104.411852 1 0.0005 271 | 1/14 13 h-m-p 0.0068 0.7349 2.2928 ++CCCCC 3101.018277 4 0.1722 298 | 1/14 14 h-m-p 0.0467 0.2334 3.1982 YCCCC 3094.422881 4 0.1033 322 | 1/14 15 h-m-p 0.2762 1.3812 0.2660 YCCCC 3090.648623 4 0.5891 346 | 1/14 16 h-m-p 1.5382 8.0000 0.1019 CCC 3089.419456 2 1.6745 380 | 1/14 17 h-m-p 1.4536 8.0000 0.1174 YCCC 3089.052900 3 0.9140 415 | 1/14 18 h-m-p 0.8706 8.0000 0.1232 +YC 3088.568954 1 2.3934 447 | 1/14 19 h-m-p 1.5123 7.9740 0.1950 CCCCC 3088.196590 4 2.0199 485 | 1/14 20 h-m-p 0.5339 2.6693 0.4360 CYCYC 3087.693986 4 1.0785 522 | 1/14 21 h-m-p 1.1262 5.6312 0.0425 YYYC 3087.332978 3 0.9628 555 | 1/14 22 h-m-p 0.1081 1.7302 0.3786 +YCCC 3086.961675 3 0.2963 591 | 1/14 23 h-m-p 1.1256 5.6281 0.0986 YCC 3086.842058 2 0.6770 624 | 1/14 24 h-m-p 0.4594 4.0626 0.1453 YYC 3086.819823 2 0.3746 656 | 1/14 25 h-m-p 1.6000 8.0000 0.0081 YC 3086.815993 1 0.9261 687 | 1/14 26 h-m-p 1.6000 8.0000 0.0012 C 3086.815328 0 1.5834 717 | 1/14 27 h-m-p 1.6000 8.0000 0.0004 CC 3086.814620 1 2.5543 749 | 1/14 28 h-m-p 1.6000 8.0000 0.0006 C 3086.814494 0 1.3713 779 | 1/14 29 h-m-p 1.6000 8.0000 0.0002 Y 3086.814490 0 1.0117 809 | 1/14 30 h-m-p 1.6000 8.0000 0.0001 Y 3086.814490 0 0.8952 839 | 1/14 31 h-m-p 1.6000 8.0000 0.0000 Y 3086.814490 0 1.0791 869 | 1/14 32 h-m-p 1.6000 8.0000 0.0000 C 3086.814490 0 1.5371 899 | 1/14 33 h-m-p 1.6000 8.0000 0.0000 C 3086.814490 0 0.4000 929 | 1/14 34 h-m-p 0.6844 8.0000 0.0000 -Y 3086.814490 0 0.0428 960 Out.. lnL = -3086.814490 961 lfun, 10571 eigenQcodon, 105710 P(t) Time used: 2:16 Model 8: beta&w>1 TREE # 1 (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 initial w for M8:NSbetaw>1 reset. 0.038583 0.019701 0.014871 0.000000 0.030850 0.008696 0.087599 0.069016 0.055858 0.170198 0.270861 1.449545 0.900000 0.225525 1.016293 2.374037 ntime & nrate & np: 11 2 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 9.657962 np = 16 lnL0 = -3176.744701 Iterating by ming2 Initial: fx= 3176.744701 x= 0.03858 0.01970 0.01487 0.00000 0.03085 0.00870 0.08760 0.06902 0.05586 0.17020 0.27086 1.44954 0.90000 0.22553 1.01629 2.37404 1 h-m-p 0.0000 0.0000 946.3244 ++ 3176.742422 m 0.0000 21 | 1/16 2 h-m-p 0.0000 0.0001 1250.4581 ++ 3122.839473 m 0.0001 40 | 2/16 3 h-m-p 0.0000 0.0002 714.4703 +YYCYCC 3101.772200 5 0.0002 67 | 2/16 4 h-m-p 0.0000 0.0001 817.8075 CCCCC 3099.609263 4 0.0000 94 | 2/16 5 h-m-p 0.0005 0.0053 42.3316 CC 3099.184740 1 0.0004 115 | 1/16 6 h-m-p 0.0000 0.0003 912.5070 CYC 3097.399716 2 0.0000 137 | 1/16 7 h-m-p 0.0005 0.0039 48.4692 CC 3096.907165 1 0.0005 158 | 1/16 8 h-m-p 0.0004 0.0025 69.1162 CCC 3096.416562 2 0.0004 181 | 1/16 9 h-m-p 0.0010 0.0083 28.0958 YCCC 3096.107151 3 0.0006 205 | 1/16 10 h-m-p 0.0004 0.0041 41.9156 CCC 3095.595211 2 0.0007 228 | 1/16 11 h-m-p 0.0004 0.0072 75.3453 YCC 3094.525763 2 0.0008 250 | 1/16 12 h-m-p 0.0013 0.0091 47.1249 YC 3094.119305 1 0.0007 270 | 1/16 13 h-m-p 0.0012 0.0111 25.4520 YCC 3093.949896 2 0.0008 292 | 1/16 14 h-m-p 0.0029 0.1779 7.3542 +++ 3091.355032 m 0.1779 312 | 1/16 15 h-m-p -0.0000 -0.0000 11.5538 h-m-p: -0.00000000e+00 -0.00000000e+00 1.15538255e+01 3091.355032 .. | 1/16 16 h-m-p 0.0000 0.0005 407.7497 +CYCCC 3088.630900 4 0.0000 355 | 1/16 17 h-m-p 0.0001 0.0006 119.6600 CCCC 3087.627626 3 0.0001 380 | 1/16 18 h-m-p 0.0002 0.0008 115.8314 YYCC 3087.056441 3 0.0001 403 | 1/16 19 h-m-p 0.0003 0.0021 54.7950 CCC 3086.946964 2 0.0001 426 | 1/16 20 h-m-p 0.0001 0.0008 65.6879 CC 3086.861568 1 0.0001 447 | 1/16 21 h-m-p 0.0002 0.0023 35.4999 YCC 3086.814092 2 0.0001 469 | 1/16 22 h-m-p 0.0003 0.0145 14.5775 CC 3086.782887 1 0.0004 490 | 1/16 23 h-m-p 0.0002 0.0136 27.3030 CC 3086.760848 1 0.0002 511 | 1/16 24 h-m-p 0.0003 0.0088 18.6011 YC 3086.730052 1 0.0005 531 | 1/16 25 h-m-p 0.0006 0.0083 14.8638 YC 3086.715849 1 0.0003 551 | 1/16 26 h-m-p 0.0001 0.0307 41.0001 ++YC 3086.575833 1 0.0013 573 | 1/16 27 h-m-p 0.0005 0.0148 109.7052 YCCC 3086.300314 3 0.0010 597 | 1/16 28 h-m-p 0.0015 0.0194 73.4270 YC 3086.167578 1 0.0008 617 | 1/16 29 h-m-p 0.1362 2.2446 0.4091 +YYYC 3086.117374 3 0.5047 640 | 1/16 30 h-m-p 1.5075 8.0000 0.1369 CC 3086.079604 1 1.5818 676 | 1/16 31 h-m-p 1.5884 8.0000 0.1364 YCC 3086.068325 2 0.9065 713 | 1/16 32 h-m-p 0.9580 8.0000 0.1290 CC 3086.061134 1 0.8518 749 | 1/16 33 h-m-p 1.0467 8.0000 0.1050 +YC 3086.046536 1 5.1428 785 | 1/16 34 h-m-p 1.6000 8.0000 0.0882 YC 3086.039158 1 2.5981 820 | 1/16 35 h-m-p 1.6000 8.0000 0.1344 +YC 3086.029270 1 4.2606 856 | 1/16 36 h-m-p 1.6000 8.0000 0.0988 CC 3086.025516 1 2.3455 892 | 1/16 37 h-m-p 0.5585 5.5096 0.4148 YC 3086.023167 1 1.0954 927 | 1/16 38 h-m-p 1.6000 8.0000 0.2766 C 3086.021642 0 1.6795 961 | 1/16 39 h-m-p 1.6000 8.0000 0.1673 C 3086.020622 0 2.1104 995 | 1/16 40 h-m-p 1.3918 8.0000 0.2537 C 3086.020016 0 1.5970 1029 | 1/16 41 h-m-p 1.6000 8.0000 0.1745 C 3086.019850 0 2.1625 1063 | 1/16 42 h-m-p 1.6000 8.0000 0.0582 Y 3086.019814 0 0.7474 1097 | 1/16 43 h-m-p 0.4920 8.0000 0.0885 +Y 3086.019797 0 1.3416 1132 | 1/16 44 h-m-p 1.6000 8.0000 0.0143 C 3086.019792 0 2.1760 1166 | 1/16 45 h-m-p 1.6000 8.0000 0.0126 C 3086.019792 0 1.7365 1200 | 1/16 46 h-m-p 1.6000 8.0000 0.0027 Y 3086.019792 0 1.1987 1234 | 1/16 47 h-m-p 1.6000 8.0000 0.0002 C 3086.019792 0 1.3092 1268 | 1/16 48 h-m-p 1.6000 8.0000 0.0000 Y 3086.019792 0 0.2719 1302 | 1/16 49 h-m-p 1.6000 8.0000 0.0000 Y 3086.019792 0 0.4000 1336 | 1/16 50 h-m-p 0.0361 8.0000 0.0000 ++Y 3086.019792 0 0.5782 1372 | 1/16 51 h-m-p 0.4310 8.0000 0.0000 --------------Y 3086.019792 0 0.0000 1420 Out.. lnL = -3086.019792 1421 lfun, 17052 eigenQcodon, 171941 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3122.977338 S = -3025.358573 -88.741639 Calculating f(w|X), posterior probabilities of site classes. did 10 / 234 patterns 3:37 did 20 / 234 patterns 3:38 did 30 / 234 patterns 3:38 did 40 / 234 patterns 3:38 did 50 / 234 patterns 3:38 did 60 / 234 patterns 3:38 did 70 / 234 patterns 3:39 did 80 / 234 patterns 3:39 did 90 / 234 patterns 3:39 did 100 / 234 patterns 3:39 did 110 / 234 patterns 3:39 did 120 / 234 patterns 3:40 did 130 / 234 patterns 3:40 did 140 / 234 patterns 3:40 did 150 / 234 patterns 3:40 did 160 / 234 patterns 3:40 did 170 / 234 patterns 3:41 did 180 / 234 patterns 3:41 did 190 / 234 patterns 3:41 did 200 / 234 patterns 3:41 did 210 / 234 patterns 3:41 did 220 / 234 patterns 3:42 did 230 / 234 patterns 3:42 did 234 / 234 patterns 3:42 Time used: 3:42 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=471 D_melanogaster_ZnT35C-PB MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH D_sechellia_ZnT35C-PB MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH D_simulans_ZnT35C-PB MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH D_yakuba_ZnT35C-PB MLANWQTARKSSEMNDARLYGNAA------TSLDKSRLEMLHEYVRDHCH D_erecta_ZnT35C-PB MLANWQTARKSLEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH D_eugracilis_ZnT35C-PB MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH D_ficusphila_ZnT35C-PB MLANWQTARKSSEMNDARLYRKAA------TSLDKCRMEMLHEYVRDHCH *********** ******** :** *:***.*:************ D_melanogaster_ZnT35C-PB RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT D_sechellia_ZnT35C-PB RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT D_simulans_ZnT35C-PB RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT D_yakuba_ZnT35C-PB RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT D_erecta_ZnT35C-PB RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT D_eugracilis_ZnT35C-PB RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT D_ficusphila_ZnT35C-PB RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT *******************:****************************** D_melanogaster_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV D_sechellia_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV D_simulans_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV D_yakuba_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV D_erecta_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV D_eugracilis_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV D_ficusphila_ZnT35C-PB DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV ************************************************** D_melanogaster_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- D_sechellia_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- D_simulans_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- D_yakuba_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- D_erecta_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- D_eugracilis_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGG--- D_ficusphila_ZnT35C-PB WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGG *******************************************.*** D_melanogaster_ZnT35C-PB GHGHSHGGSKN-----------ASHVQATSTPCSDSPSQRIEGGVAYAPE D_sechellia_ZnT35C-PB GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE D_simulans_ZnT35C-PB GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE D_yakuba_ZnT35C-PB GHGHSHGGSKKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPE D_erecta_ZnT35C-PB GHGHSHGGTKN-----------PSHVQATSTPCSDSPSQRIEGGVAFAPE D_eugracilis_ZnT35C-PB AHGHSHGGSKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE D_ficusphila_ZnT35C-PB GHGHSHGGNKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE .*******.*: .**.:******* **.********:*** D_melanogaster_ZnT35C-PB DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA D_sechellia_ZnT35C-PB DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA D_simulans_ZnT35C-PB DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA D_yakuba_ZnT35C-PB DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREA D_erecta_ZnT35C-PB DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPAGREA D_eugracilis_ZnT35C-PB DAELPGGGLPTFSYQNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREA D_ficusphila_ZnT35C-PB DAELPGSGLPTYSYQNAKLVDPSLDLEIAAVLAETAPGAHHHGGPVGREA ******.****:****:*****: **************:******.**** D_melanogaster_ZnT35C-PB VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV D_sechellia_ZnT35C-PB VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV D_simulans_ZnT35C-PB VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV D_yakuba_ZnT35C-PB VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV D_erecta_ZnT35C-PB VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV D_eugracilis_ZnT35C-PB VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV D_ficusphila_ZnT35C-PB VNMNVRAALIHVIGDVIQSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIV *******************:****************************** D_melanogaster_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS D_sechellia_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS D_simulans_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS D_yakuba_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS D_erecta_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS D_eugracilis_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS D_ficusphila_ZnT35C-PB LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS ************************************************** D_melanogaster_ZnT35C-PB INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME D_sechellia_ZnT35C-PB INKVALSAHLAIADNANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME D_simulans_ZnT35C-PB INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME D_yakuba_ZnT35C-PB INKVALSAHLAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQME D_erecta_ZnT35C-PB INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME D_eugracilis_ZnT35C-PB INKVALSAHLAIAENANPKQILDAATSAVHLRYNFFETTIQIEDYTAQME D_ficusphila_ZnT35C-PB INKVALSAHLAIAANANPKMILDAATSAVHLRYNFFETTIQIEEYTAQME ************* ***** ***********************:****** D_melanogaster_ZnT35C-PB SCLQCNVPEKooooooooooo D_sechellia_ZnT35C-PB SCQQCNVPEKoooooo----- D_simulans_ZnT35C-PB SCQQCNVPEKoooooo----- D_yakuba_ZnT35C-PB SCQQCNVPEK----------- D_erecta_ZnT35C-PB SCQQCNVPEKooooooooooo D_eugracilis_ZnT35C-PB SCQQCNVPEKooooo------ D_ficusphila_ZnT35C-PB SCLQCNVPEKoooooooo--- ** *******
>D_melanogaster_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGTCAT CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCTCGCCGAAAACTGATCAT TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGCG TCCTATCGAACAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACG GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGGCG ACCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTT TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG GCGTTCAGCTGCAGCATGGCCATTCGCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGTGGTTCCAAGAAC----------------- ----------------GCATCCCATGTGCAGGCCACATCCACACCATGCT CCGATTCGCCCAGCCAGCGTATTGAGGGCGGTGTGGCCTACGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCAACGTTCTCCTACCAAAATAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCTGCCGTTCTGGCCG AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGAGTTTTTGTCGCCGCTGGCGTGATTTACTTTTGGCCAG AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCGTTGCTGGTGCTCATGGA GGGGACTCCCAACTATATGCACTACGCCGAGGTACTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCGAA TCCGAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTATA ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCTGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >D_sechellia_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGCCAT CGTGCCCGCAGCGAGGGTGTGGATGTGAAGGCTCGCCGAAAACTGATCAT TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGTG TCCTATCCAATAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGCGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG GCGTTCAGCTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGCGGTTCCAAGAAGTCAAAGAAGAAGAAC-- ----------------CCATCCCATGTGCAGGCCACATCCACACCATGCT CCGATTCGCCCAGCCAGCGGATTGAGGGCGGTGTGGCCTACGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCGTACCAAAATAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGTGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCAG AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACTCCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTAGCGCTATCTGCACATTTGGCCATTGCTGATAATGCGAA TCCTAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTACA ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >D_simulans_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGCCAT CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCTCGCCGAAAACTGATCAT TGCGAGCATTTTGTGTCTGGTTTTTATGATTGCCGAAATCGTGGGTGGCG TCCTATCCAACAGCCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGCGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACATCCGGCCTGGCCATATTGGTGAATGTCATCATGG GCGTTCAGCTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGCGGTTCCAAGAAGTCAAAGAAGAAGAAC-- ----------------CCATCCCATGTGCAGGCCACATCCACACCATGCT CCGATTCGCCCAGCCAGCGGATTGAGGGCGGTGTGGCCTACGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCGTACCAAAATAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG AAACGGCACCCGGATCACATCATCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCAG AGTACTCCATCGTTGATCCCATTTGCACGTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACTCCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCGAA TCCTAAGAGGATCCTGGATGCGGCCACATCGGCGGTTCATTTGCGCTACA ACTTCTTTGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >D_yakuba_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATGGGAATGCGGCA------------------ACTTCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTTCGGGATCATTGCCAT CGAGCCCGCAGCGAGGGCGTCGACGTGAAGGCGCGACGAAAACTGATCAT TGCGAGCATTTTGTGTTTGGTTTTCATGATTGCGGAAATCGTGGGTGGCG TCTTATCGAACAGTCTAGCCATTGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCTGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCCGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACCTCCGGGCTGGCCATTTTGGTGAATGTCATCATGG GCGTTCAACTGCAGCATGGCCATTCCCATGGCCTGGGCGGT--------- GGGCATGGTCACAGCCATGGCGGCTCCAAGAAACTAAAGAAGAAGAACCC CGCAGCAACTGCCATACCGTCCCATGTGCAGGCCACATCCACACCCTGTT CCGATTCACCCAGCCAACGCATTGAGGGCGGTGTGGCCTTCGCGCCGGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCGACGTTCTCCTACCAAAACAC CAAGTTGGTCGATCCCACACTGGATTTGGAAATTGCAGCCGTTCTGGCCG AAACGGCACCCGGAGCACATCACCACGGCGGACCGGTTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGACGTCAT CCAGAGCGTTGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTCTGGCCCG AGTACTCCATCGTTGATCCCATTTGCACTTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACACCCAACTATATGCACTATGCCGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGAGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAATGCCAA TCCGAAGAAGATCCTGGACGCTGCTACATCGGCGGTACACTTGCGCTACA ACTTCTTTGAGACCACCATCCAGATCGAAGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >D_erecta_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGCTGGAAATGAATGATGC CCGGCTGTATAGGAATGCGGCA------------------ACATCGCTGG ATAAAAGCCGCTTGGAAATGCTGCACGAATATGTCCGGGATCATTGTCAT CGTGCCCGCAGCGAGGGCGTGGATGTGAAGGCGCGCCGGAAACTGATCAT TGCGAGCATTTTGTGCTTGGTTTTCATGATTGCCGAAATCGTGGGTGGCG TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCTCATTTGCTAACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG ACCATCTACGCAGCGCATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGCTGGCCATCGGACGACTCATCAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACCTCGGGCCTGGCCATTTTGGTGAATGTCATCATGG GCGTGCAACTGCAGCATGGCCATTCGCATGGCCTGGGCGGC--------- GGGCATGGTCACAGCCATGGTGGCACCAAGAAC----------------- ----------------CCATCCCATGTGCAGGCCACATCCACGCCCTGCT CCGATTCACCCAGCCAACGGATTGAGGGCGGCGTGGCCTTCGCGCCGGAG GATGCCGAATTGCCTGGCGGCGGGCTGCCAACGTTCTCCTACCAAAATAC CAAGCTGGTCGATCCCACACTGGACCTGGAAATTGCAGCCGTGCTGGCCG AAACGGCACCCGGCTCACATCACCACGGCGGACCGGCTGGACGCGAGGCC GTCAACATGAATGTCCGGGCAGCCCTCATCCATGTGATTGGCGATGTCAT CCAGAGCGTGGGAGTGTTTGTCGCCGCCGGCGTGATTTACTTTTGGCCGG AGTACTCCATCGTTGATCCCATTTGCACTTTTGTGTTCTCCATCATTGTG CTCTTCACCACGTTCACGATCATGAAGGATGCCCTGCTGGTGCTCATGGA GGGGACTCCCAACTACATGCACTACGCCGAGGTGCTGCAGATATTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCACATTTGGCCATTGCTGAAAACGCGAA TCCGAAGCGGATCCTGGATGCAGCCACATCGGCGGTACACTTGCGATACA ACTTCTTCGAGACCACCATCCAGATCGAGGACTATACCGCCCAAATGGAG AGCTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >D_eugracilis_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATAGGAAGGCGGCGTCGGCAGCGGCAGAAACGACTACGCTGG ATAAATGCCGCTTGGAAATGCTGCACGAATATGTACGGGATCATTGTCAT CGTGCCCGCAGCGAGGGGGTGGATGTAAAGGCGCGCCGGAAACTGATCAT AGCCAGCGTTTTGTGTTTGGTCTTTATGATTGCAGAAATCGTGGGTGGCG TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCACATTTGCTCACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG ACCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCTGAGGTTATTG GCGCCATGGCCTCCGTCTTTATGATCTGGGTCATCACAGGCATACTGGTC TGGCTGGCCATTGGACGTCTCATTAGCGGCGACTACGAGGTGAATGCGAA GATCATGCTGATCACCTCGGGCCTGGCCATATTGGTGAATGTCATAATGG GAGTCCAGCTGCAGCATGGCCATTCGCATGCCCTGGGCGGT--------- GCGCATGGTCACAGCCACGGTGGCTCCAAGAAC----------------- ----------------CCATCCCATGCCCATGCCACATCCACACCATGTT CCGCTTCGCCCAACCAAAGGATTGAGGGCGGTGTGGCCTTTGCGCCCGAG GATGCCGAATTGCCTGGCGGCGGATTGCCCACGTTTTCCTACCAAAATGC AAAGTTAGTGGATCCCGCAAAGGATTTAGAAATTGCAGCAGTTCTGGCCG AGACAGCACCAGGATCACATCATCACGGCGGACCAGTTGGACGGGAGGCC GTCAACATGAATGTCCGAGCTGCCCTCATCCATGTGATTGGCGATGTCAT TCAGAGCGTTGGAGTGTTTGTGGCCGCCGGGGTCATCTACTTTTGGCCAG AGTATTCCATCGTTGATCCGATTTGCACATTTGTTTTCTCCATTATTGTC CTCTTTACCACGTTCACGATTATGAAGGATGCCCTGCTGGTACTCATGGA GGGGACTCCCAACTACATGCACTACGCCGAGGTGCTGCAGATATTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCGCATTTGGCCATTGCTGAAAATGCGAA TCCCAAGCAAATCTTGGATGCAGCCACATCGGCGGTTCACTTGCGCTACA ACTTTTTTGAGACCACCATCCAGATCGAGGACTATACGGCCCAGATGGAG AGTTGCCAGCAGTGCAATGTGCCCGAGAAG-------------------- ------------- >D_ficusphila_ZnT35C-PB ATGCTCGCTAATTGGCAGACGGCACGGAAATCGTCGGAAATGAATGATGC CCGGCTATATCGAAAAGCGGCG------------------ACTTCGCTGG ATAAATGCCGCATGGAAATGCTGCACGAATATGTCCGAGACCATTGCCAT CGGGCAAGAAGCGAGGGAGTGGACGTGAAAGCCCGCCGAAAACTGATCAT AGCCAGCATCCTGTGCTTGGTTTTTATGATTGCCGAAATCGTAGGTGGCG TCCTATCGAACAGTCTGGCCATCGCAACAGACGCCGCACATTTGCTCACC GATTTCGCCAGTTTTATGATCTCGTTGTTTGCCATCTGGATTGCCGGACG CCCATCTACGCAGCGGATGTCCTTCGGCTGGTATCGGGCCGAGGTTATTG GCGCCATGGCCTCCGTCTTCATGATCTGGGTCATCACGGGCATCCTCGTC TGGTTGGCCATCGGAAGACTCATCAGCGGCGATTACGAGGTGAATGCGAA GATCATGCTGATCACCTCGGGCCTGGCCATATTGGTTAATGTCATCATGG GCGTTCAGCTGCAGCACGGCCATTCCCATGGACTCGGCGGAGGCGGCGGT GGGCATGGTCACAGCCACGGTGGCAACAAGAAC----------------- ----------------CCATCCCATGCCCATGCCACATCCACTCCCTGTT CCGCATCGCCCAATCAACGGATCGAAGGGGGCGTGGCCTTTGCACCCGAG GATGCGGAGTTGCCTGGCAGCGGACTGCCAACGTACTCATACCAGAACGC CAAGCTGGTGGATCCATCGCTGGACCTCGAAATTGCGGCCGTTTTGGCGG AAACCGCTCCCGGTGCTCATCATCACGGCGGACCCGTTGGTCGCGAAGCC GTAAACATGAATGTCCGGGCAGCTCTTATTCACGTGATTGGCGACGTCAT CCAGAGCCTTGGTGTTTTCGTCGCCGCCGGCGTGATCTACTTTTGGCCAG AGTACTCCATCGTTGACCCCATTTGCACGTTTGTGTTCTCCATTATTGTC CTCTTTACCACGTTTACGATCATGAAGGATGCCCTGCTGGTTCTCATGGA GGGGACCCCCAATTACATGCACTACGCGGAGGTGCTGCAGATTTTCCAAG GCATCGAGGGCGTTGAGCGGGTGCACAATTTGCGCATCTGGGCGCTGAGC ATTAATAAAGTGGCGCTATCTGCGCATTTGGCCATTGCTGCCAATGCGAA TCCAAAGATGATCCTGGATGCAGCCACCTCGGCGGTTCATCTGCGCTACA ATTTCTTCGAGACGACCATTCAGATCGAGGAGTACACGGCCCAAATGGAG AGCTGCCTGCAGTGCAATGTGCCCGAAAAG-------------------- -------------
>D_melanogaster_ZnT35C-PB MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKN-----------ASHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCLQCNVPEK >D_sechellia_ZnT35C-PB MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIADNANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >D_simulans_ZnT35C-PB MLANWQTARKSSEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKSKKKN------PSHVQATSTPCSDSPSQRIEGGVAYAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >D_yakuba_ZnT35C-PB MLANWQTARKSSEMNDARLYGNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGSKKLKKKNPAATAIPSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKKILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >D_erecta_ZnT35C-PB MLANWQTARKSLEMNDARLYRNAA------TSLDKSRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGG--- GHGHSHGGTKN-----------PSHVQATSTPCSDSPSQRIEGGVAFAPE DAELPGGGLPTFSYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPAGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >D_eugracilis_ZnT35C-PB MLANWQTARKSSEMNDARLYRKAASAAAETTTLDKCRLEMLHEYVRDHCH RARSEGVDVKARRKLIIASVLCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHALGG--- AHGHSHGGSKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGGGLPTFSYQNAKLVDPAKDLEIAAVLAETAPGSHHHGGPVGREA VNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAENANPKQILDAATSAVHLRYNFFETTIQIEDYTAQME SCQQCNVPEK >D_ficusphila_ZnT35C-PB MLANWQTARKSSEMNDARLYRKAA------TSLDKCRMEMLHEYVRDHCH RARSEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLT DFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILV WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGGG GHGHSHGGNKN-----------PSHAHATSTPCSASPNQRIEGGVAFAPE DAELPGSGLPTYSYQNAKLVDPSLDLEIAAVLAETAPGAHHHGGPVGREA VNMNVRAALIHVIGDVIQSLGVFVAAGVIYFWPEYSIVDPICTFVFSIIV LFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALS INKVALSAHLAIAANANPKMILDAATSAVHLRYNFFETTIQIEEYTAQME SCLQCNVPEK
#NEXUS [ID: 0968003640] begin taxa; dimensions ntax=7; taxlabels D_melanogaster_ZnT35C-PB D_sechellia_ZnT35C-PB D_simulans_ZnT35C-PB D_yakuba_ZnT35C-PB D_erecta_ZnT35C-PB D_eugracilis_ZnT35C-PB D_ficusphila_ZnT35C-PB ; end; begin trees; translate 1 D_melanogaster_ZnT35C-PB, 2 D_sechellia_ZnT35C-PB, 3 D_simulans_ZnT35C-PB, 4 D_yakuba_ZnT35C-PB, 5 D_erecta_ZnT35C-PB, 6 D_eugracilis_ZnT35C-PB, 7 D_ficusphila_ZnT35C-PB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01803642,(2:0.007259954,3:7.874134E-4)1.000:0.01245415,((4:0.04967419,5:0.03508397)0.999:0.01356558,(6:0.1006147,7:0.2014251)1.000:0.04120956)0.999:0.01191798); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01803642,(2:0.007259954,3:7.874134E-4):0.01245415,((4:0.04967419,5:0.03508397):0.01356558,(6:0.1006147,7:0.2014251):0.04120956):0.01191798); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3382.54 -3395.85 2 -3382.93 -3395.25 -------------------------------------- TOTAL -3382.71 -3395.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/444/ZnT35C-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.502407 0.002429 0.407551 0.598454 0.499052 1501.00 1501.00 1.000 r(A<->C){all} 0.127469 0.000760 0.076612 0.182377 0.126030 978.65 1063.86 1.000 r(A<->G){all} 0.232638 0.001294 0.159760 0.300486 0.230896 980.78 984.66 1.001 r(A<->T){all} 0.163009 0.001074 0.097689 0.226318 0.161007 955.90 1010.40 1.007 r(C<->G){all} 0.101349 0.000355 0.068577 0.142154 0.100195 1110.41 1151.13 1.001 r(C<->T){all} 0.329771 0.001442 0.258815 0.408474 0.329068 847.96 880.43 1.000 r(G<->T){all} 0.045763 0.000214 0.019913 0.076394 0.044328 892.18 1030.90 1.000 pi(A){all} 0.211250 0.000107 0.190183 0.230587 0.211423 1005.11 1253.05 1.000 pi(C){all} 0.280057 0.000119 0.260100 0.301587 0.280039 1405.84 1453.42 1.000 pi(G){all} 0.279908 0.000131 0.257870 0.302111 0.279932 1234.52 1273.36 1.000 pi(T){all} 0.228785 0.000106 0.209786 0.249707 0.228570 1285.49 1315.87 1.000 alpha{1,2} 0.047627 0.000909 0.000104 0.097161 0.046192 744.06 1122.53 1.000 alpha{3} 3.413284 0.985121 1.762646 5.431063 3.286415 1333.95 1356.01 1.000 pinvar{all} 0.426720 0.002143 0.332089 0.512526 0.428400 1221.63 1259.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/444/ZnT35C-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 7 ls = 440 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 7 7 7 5 5 12 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 6 6 6 6 4 5 | Cys TGT 2 1 1 2 1 3 TTC 9 9 9 12 12 5 | TCC 10 11 11 11 8 9 | TAC 6 6 6 5 7 6 | TGC 4 5 5 4 5 4 Leu TTA 0 0 0 1 0 2 | TCA 1 1 1 1 2 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 12 11 11 12 10 12 | TCG 8 7 7 6 7 8 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 1 2 2 1 1 1 | His CAT 14 14 14 12 12 13 | Arg CGT 2 1 1 0 1 2 CTC 6 6 6 6 6 6 | CCC 7 7 7 8 7 7 | CAC 5 5 5 7 7 7 | CGC 6 8 8 7 6 5 CTA 4 4 4 4 3 3 | CCA 4 4 4 1 3 6 | Gln CAA 3 3 3 5 5 4 | CGA 3 2 2 4 3 2 CTG 18 18 18 16 21 15 | CCG 2 2 2 5 4 1 | CAG 10 11 11 9 9 10 | CGG 7 7 7 7 9 8 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 14 14 14 16 14 15 | Thr ACT 2 2 2 2 2 2 | Asn AAT 12 13 12 11 11 11 | Ser AGT 1 1 1 2 2 3 ATC 23 23 23 22 23 17 | ACC 5 6 6 7 8 5 | AAC 5 3 4 5 6 6 | AGC 10 10 10 9 9 6 ATA 1 1 1 0 1 5 | ACA 6 6 6 6 5 7 | Lys AAA 4 4 4 5 4 4 | Arg AGA 0 0 0 0 0 0 Met ATG 15 15 15 15 15 15 | ACG 9 8 8 7 8 7 | AAG 7 8 8 8 7 9 | AGG 2 2 2 0 1 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 10 8 8 9 4 9 | Ala GCT 7 5 5 6 5 5 | Asp GAT 13 14 13 10 12 12 | Gly GGT 6 8 5 4 3 5 GTC 10 11 11 11 11 12 | GCC 24 26 26 25 26 27 | GAC 3 3 3 6 4 3 | GGC 19 18 20 19 23 16 GTA 1 1 0 1 1 3 | GCA 7 7 7 8 8 10 | Glu GAA 8 7 8 9 8 7 | GGA 5 5 6 7 5 8 GTG 16 17 18 16 20 13 | GCG 10 9 9 9 9 11 | GAG 15 15 15 14 15 16 | GGG 4 3 3 5 3 3 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------ Phe TTT 8 | Ser TCT 2 | Tyr TAT 3 | Cys TGT 1 TTC 8 | TCC 8 | TAC 9 | TGC 6 Leu TTA 0 | TCA 1 | *** TAA 0 | *** TGA 0 TTG 9 | TCG 9 | TAG 0 | Trp TGG 7 ------------------------------------------------------ Leu CTT 2 | Pro CCT 1 | His CAT 12 | Arg CGT 0 CTC 8 | CCC 8 | CAC 8 | CGC 6 CTA 3 | CCA 6 | Gln CAA 3 | CGA 3 CTG 18 | CCG 0 | CAG 9 | CGG 8 ------------------------------------------------------ Ile ATT 13 | Thr ACT 2 | Asn AAT 13 | Ser AGT 2 ATC 23 | ACC 7 | AAC 5 | AGC 8 ATA 2 | ACA 2 | Lys AAA 6 | Arg AGA 2 Met ATG 17 | ACG 9 | AAG 6 | AGG 0 ------------------------------------------------------ Val GTT 11 | Ala GCT 5 | Asp GAT 8 | Gly GGT 6 GTC 10 | GCC 27 | GAC 6 | GGC 17 GTA 2 | GCA 8 | Glu GAA 9 | GGA 7 GTG 12 | GCG 12 | GAG 14 | GGG 3 ------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_ZnT35C-PB position 1: T:0.16818 C:0.20909 A:0.26364 G:0.35909 position 2: T:0.33182 C:0.23864 A:0.25227 G:0.17727 position 3: T:0.22500 C:0.34545 A:0.10682 G:0.32273 Average T:0.24167 C:0.26439 A:0.20758 G:0.28636 #2: D_sechellia_ZnT35C-PB position 1: T:0.16591 C:0.21364 A:0.26364 G:0.35682 position 2: T:0.32955 C:0.23864 A:0.25455 G:0.17727 position 3: T:0.22273 C:0.35682 A:0.10227 G:0.31818 Average T:0.23939 C:0.26970 A:0.20682 G:0.28409 #3: D_simulans_ZnT35C-PB position 1: T:0.16591 C:0.21364 A:0.26364 G:0.35682 position 2: T:0.32955 C:0.23864 A:0.25455 G:0.17727 position 3: T:0.21136 C:0.36364 A:0.10455 G:0.32045 Average T:0.23561 C:0.27197 A:0.20758 G:0.28485 #4: D_yakuba_ZnT35C-PB position 1: T:0.16818 C:0.20909 A:0.26136 G:0.36136 position 2: T:0.33182 C:0.23864 A:0.25455 G:0.17500 position 3: T:0.20000 C:0.37273 A:0.11818 G:0.30909 Average T:0.23333 C:0.27348 A:0.21136 G:0.28182 #5: D_erecta_ZnT35C-PB position 1: T:0.15909 C:0.22045 A:0.26364 G:0.35682 position 2: T:0.33182 C:0.23864 A:0.25227 G:0.17727 position 3: T:0.17955 C:0.38182 A:0.10909 G:0.32955 Average T:0.22348 C:0.28030 A:0.20833 G:0.28788 #6: D_eugracilis_ZnT35C-PB position 1: T:0.17273 C:0.20455 A:0.25909 G:0.36364 position 2: T:0.32727 C:0.24773 A:0.25682 G:0.16818 position 3: T:0.22727 C:0.32045 A:0.14091 G:0.31136 Average T:0.24242 C:0.25758 A:0.21894 G:0.28106 #7: D_ficusphila_ZnT35C-PB position 1: T:0.16136 C:0.21591 A:0.26591 G:0.35682 position 2: T:0.33182 C:0.24318 A:0.25227 G:0.17273 position 3: T:0.20227 C:0.37273 A:0.12273 G:0.30227 Average T:0.23182 C:0.27727 A:0.21364 G:0.27727 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 51 | Ser S TCT 14 | Tyr Y TAT 36 | Cys C TGT 11 TTC 64 | TCC 68 | TAC 45 | TGC 33 Leu L TTA 3 | TCA 8 | *** * TAA 0 | *** * TGA 0 TTG 77 | TCG 52 | TAG 0 | Trp W TGG 49 ------------------------------------------------------------------------------ Leu L CTT 2 | Pro P CCT 9 | His H CAT 91 | Arg R CGT 7 CTC 44 | CCC 51 | CAC 44 | CGC 46 CTA 25 | CCA 28 | Gln Q CAA 26 | CGA 19 CTG 124 | CCG 16 | CAG 69 | CGG 53 ------------------------------------------------------------------------------ Ile I ATT 100 | Thr T ACT 14 | Asn N AAT 83 | Ser S AGT 12 ATC 154 | ACC 44 | AAC 34 | AGC 62 ATA 11 | ACA 38 | Lys K AAA 31 | Arg R AGA 2 Met M ATG 107 | ACG 56 | AAG 53 | AGG 9 ------------------------------------------------------------------------------ Val V GTT 59 | Ala A GCT 38 | Asp D GAT 82 | Gly G GGT 37 GTC 76 | GCC 181 | GAC 28 | GGC 132 GTA 9 | GCA 55 | Glu E GAA 56 | GGA 43 GTG 112 | GCG 69 | GAG 104 | GGG 24 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16591 C:0.21234 A:0.26299 G:0.35877 position 2: T:0.33052 C:0.24058 A:0.25390 G:0.17500 position 3: T:0.20974 C:0.35909 A:0.11494 G:0.31623 Average T:0.23539 C:0.27067 A:0.21061 G:0.28333 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_ZnT35C-PB D_sechellia_ZnT35C-PB 0.0476 (0.0040 0.0846) D_simulans_ZnT35C-PB 0.0447 (0.0030 0.0676) 0.0646 (0.0010 0.0156) D_yakuba_ZnT35C-PB 0.0340 (0.0071 0.2080) 0.0273 (0.0050 0.1843) 0.0244 (0.0040 0.1648) D_erecta_ZnT35C-PB 0.0379 (0.0066 0.1735) 0.0347 (0.0066 0.1894) 0.0327 (0.0056 0.1698) 0.0431 (0.0081 0.1875) D_eugracilis_ZnT35C-PB 0.0601 (0.0198 0.3299) 0.0553 (0.0188 0.3401) 0.0554 (0.0178 0.3208) 0.0478 (0.0193 0.4037) 0.0556 (0.0188 0.3385) D_ficusphila_ZnT35C-PB 0.0496 (0.0235 0.4731) 0.0528 (0.0240 0.4540) 0.0557 (0.0245 0.4398) 0.0460 (0.0235 0.5098) 0.0511 (0.0235 0.4601) 0.0438 (0.0233 0.5310) Model 0: one-ratio TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 lnL(ntime: 11 np: 13): -3105.434808 +0.000000 8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7 0.032821 0.025328 0.014265 0.000004 0.023380 0.022760 0.093285 0.067178 0.073558 0.157558 0.290712 1.430146 0.040870 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.80085 (1: 0.032821, (2: 0.014265, 3: 0.000004): 0.025328, ((4: 0.093285, 5: 0.067178): 0.022760, (6: 0.157558, 7: 0.290712): 0.073558): 0.023380); (D_melanogaster_ZnT35C-PB: 0.032821, (D_sechellia_ZnT35C-PB: 0.014265, D_simulans_ZnT35C-PB: 0.000004): 0.025328, ((D_yakuba_ZnT35C-PB: 0.093285, D_erecta_ZnT35C-PB: 0.067178): 0.022760, (D_eugracilis_ZnT35C-PB: 0.157558, D_ficusphila_ZnT35C-PB: 0.290712): 0.073558): 0.023380); Detailed output identifying parameters kappa (ts/tv) = 1.43015 omega (dN/dS) = 0.04087 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.033 1000.3 319.7 0.0409 0.0016 0.0400 1.6 12.8 8..9 0.025 1000.3 319.7 0.0409 0.0013 0.0309 1.3 9.9 9..2 0.014 1000.3 319.7 0.0409 0.0007 0.0174 0.7 5.6 9..3 0.000 1000.3 319.7 0.0409 0.0000 0.0000 0.0 0.0 8..10 0.023 1000.3 319.7 0.0409 0.0012 0.0285 1.2 9.1 10..11 0.023 1000.3 319.7 0.0409 0.0011 0.0278 1.1 8.9 11..4 0.093 1000.3 319.7 0.0409 0.0047 0.1138 4.7 36.4 11..5 0.067 1000.3 319.7 0.0409 0.0034 0.0820 3.4 26.2 10..12 0.074 1000.3 319.7 0.0409 0.0037 0.0898 3.7 28.7 12..6 0.158 1000.3 319.7 0.0409 0.0079 0.1922 7.9 61.5 12..7 0.291 1000.3 319.7 0.0409 0.0145 0.3547 14.5 113.4 tree length for dN: 0.0399 tree length for dS: 0.9772 Time used: 0:04 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 lnL(ntime: 11 np: 14): -3086.055409 +0.000000 8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7 0.033328 0.025646 0.014449 0.000004 0.024002 0.023218 0.094593 0.068434 0.075045 0.160942 0.300278 1.461138 0.962961 0.016611 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.81994 (1: 0.033328, (2: 0.014449, 3: 0.000004): 0.025646, ((4: 0.094593, 5: 0.068434): 0.023218, (6: 0.160942, 7: 0.300278): 0.075045): 0.024002); (D_melanogaster_ZnT35C-PB: 0.033328, (D_sechellia_ZnT35C-PB: 0.014449, D_simulans_ZnT35C-PB: 0.000004): 0.025646, ((D_yakuba_ZnT35C-PB: 0.094593, D_erecta_ZnT35C-PB: 0.068434): 0.023218, (D_eugracilis_ZnT35C-PB: 0.160942, D_ficusphila_ZnT35C-PB: 0.300278): 0.075045): 0.024002); Detailed output identifying parameters kappa (ts/tv) = 1.46114 dN/dS (w) for site classes (K=2) p: 0.96296 0.03704 w: 0.01661 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.033 999.6 320.4 0.0530 0.0021 0.0393 2.1 12.6 8..9 0.026 999.6 320.4 0.0530 0.0016 0.0302 1.6 9.7 9..2 0.014 999.6 320.4 0.0530 0.0009 0.0170 0.9 5.5 9..3 0.000 999.6 320.4 0.0530 0.0000 0.0000 0.0 0.0 8..10 0.024 999.6 320.4 0.0530 0.0015 0.0283 1.5 9.1 10..11 0.023 999.6 320.4 0.0530 0.0015 0.0274 1.5 8.8 11..4 0.095 999.6 320.4 0.0530 0.0059 0.1115 5.9 35.7 11..5 0.068 999.6 320.4 0.0530 0.0043 0.0806 4.3 25.8 10..12 0.075 999.6 320.4 0.0530 0.0047 0.0884 4.7 28.3 12..6 0.161 999.6 320.4 0.0530 0.0101 0.1896 10.1 60.8 12..7 0.300 999.6 320.4 0.0530 0.0188 0.3538 18.8 113.4 Time used: 0:12 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 lnL(ntime: 11 np: 16): -3086.055409 +0.000000 8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7 0.033328 0.025646 0.014449 0.000004 0.024002 0.023218 0.094593 0.068434 0.075045 0.160942 0.300278 1.461148 0.962961 0.037039 0.016611 31.909660 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.81994 (1: 0.033328, (2: 0.014449, 3: 0.000004): 0.025646, ((4: 0.094593, 5: 0.068434): 0.023218, (6: 0.160942, 7: 0.300278): 0.075045): 0.024002); (D_melanogaster_ZnT35C-PB: 0.033328, (D_sechellia_ZnT35C-PB: 0.014449, D_simulans_ZnT35C-PB: 0.000004): 0.025646, ((D_yakuba_ZnT35C-PB: 0.094593, D_erecta_ZnT35C-PB: 0.068434): 0.023218, (D_eugracilis_ZnT35C-PB: 0.160942, D_ficusphila_ZnT35C-PB: 0.300278): 0.075045): 0.024002); Detailed output identifying parameters kappa (ts/tv) = 1.46115 dN/dS (w) for site classes (K=3) p: 0.96296 0.03704 0.00000 w: 0.01661 1.00000 31.90966 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.033 999.6 320.4 0.0530 0.0021 0.0393 2.1 12.6 8..9 0.026 999.6 320.4 0.0530 0.0016 0.0302 1.6 9.7 9..2 0.014 999.6 320.4 0.0530 0.0009 0.0170 0.9 5.5 9..3 0.000 999.6 320.4 0.0530 0.0000 0.0000 0.0 0.0 8..10 0.024 999.6 320.4 0.0530 0.0015 0.0283 1.5 9.1 10..11 0.023 999.6 320.4 0.0530 0.0015 0.0274 1.5 8.8 11..4 0.095 999.6 320.4 0.0530 0.0059 0.1115 5.9 35.7 11..5 0.068 999.6 320.4 0.0530 0.0043 0.0806 4.3 25.8 10..12 0.075 999.6 320.4 0.0530 0.0047 0.0884 4.7 28.3 12..6 0.161 999.6 320.4 0.0530 0.0101 0.1896 10.1 60.8 12..7 0.300 999.6 320.4 0.0530 0.0188 0.3538 18.8 113.4 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_ZnT35C-PB) Pr(w>1) post mean +- SE for w 200 S 0.556 1.460 +- 0.683 253 T 0.559 1.492 +- 0.965 269 S 0.619 1.632 +- 1.123 394 E 0.526 1.403 +- 0.715 400 R 0.738 1.834 +- 1.202 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.710 0.179 0.055 0.023 0.012 0.007 0.005 0.004 0.003 0.002 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 0:41 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 lnL(ntime: 11 np: 17): -3086.016048 +0.000000 8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7 0.033330 0.025666 0.014452 0.000004 0.024031 0.023232 0.094584 0.068496 0.074909 0.161333 0.300624 1.459426 0.764192 0.207427 0.000001 0.101543 1.123332 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.82066 (1: 0.033330, (2: 0.014452, 3: 0.000004): 0.025666, ((4: 0.094584, 5: 0.068496): 0.023232, (6: 0.161333, 7: 0.300624): 0.074909): 0.024031); (D_melanogaster_ZnT35C-PB: 0.033330, (D_sechellia_ZnT35C-PB: 0.014452, D_simulans_ZnT35C-PB: 0.000004): 0.025666, ((D_yakuba_ZnT35C-PB: 0.094584, D_erecta_ZnT35C-PB: 0.068496): 0.023232, (D_eugracilis_ZnT35C-PB: 0.161333, D_ficusphila_ZnT35C-PB: 0.300624): 0.074909): 0.024031); Detailed output identifying parameters kappa (ts/tv) = 1.45943 dN/dS (w) for site classes (K=3) p: 0.76419 0.20743 0.02838 w: 0.00000 0.10154 1.12333 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.033 999.6 320.4 0.0529 0.0021 0.0393 2.1 12.6 8..9 0.026 999.6 320.4 0.0529 0.0016 0.0303 1.6 9.7 9..2 0.014 999.6 320.4 0.0529 0.0009 0.0170 0.9 5.5 9..3 0.000 999.6 320.4 0.0529 0.0000 0.0000 0.0 0.0 8..10 0.024 999.6 320.4 0.0529 0.0015 0.0283 1.5 9.1 10..11 0.023 999.6 320.4 0.0529 0.0014 0.0274 1.4 8.8 11..4 0.095 999.6 320.4 0.0529 0.0059 0.1115 5.9 35.7 11..5 0.068 999.6 320.4 0.0529 0.0043 0.0807 4.3 25.9 10..12 0.075 999.6 320.4 0.0529 0.0047 0.0883 4.7 28.3 12..6 0.161 999.6 320.4 0.0529 0.0101 0.1902 10.1 60.9 12..7 0.301 999.6 320.4 0.0529 0.0188 0.3543 18.8 113.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_ZnT35C-PB) Pr(w>1) post mean +- SE for w 200 S 0.970* 1.092 202 N 0.534 0.648 253 T 0.868 0.989 254 L 0.771 0.889 269 S 0.894 1.015 394 E 0.913 1.035 400 R 0.993** 1.116 433 L 0.720 0.837 Time used: 1:26 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 lnL(ntime: 11 np: 14): -3086.814490 +0.000000 8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7 0.033208 0.025594 0.014414 0.000004 0.023862 0.023136 0.094214 0.068035 0.072073 0.163052 0.300815 1.449545 0.033439 0.559704 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.81841 (1: 0.033208, (2: 0.014414, 3: 0.000004): 0.025594, ((4: 0.094214, 5: 0.068035): 0.023136, (6: 0.163052, 7: 0.300815): 0.072073): 0.023862); (D_melanogaster_ZnT35C-PB: 0.033208, (D_sechellia_ZnT35C-PB: 0.014414, D_simulans_ZnT35C-PB: 0.000004): 0.025594, ((D_yakuba_ZnT35C-PB: 0.094214, D_erecta_ZnT35C-PB: 0.068035): 0.023136, (D_eugracilis_ZnT35C-PB: 0.163052, D_ficusphila_ZnT35C-PB: 0.300815): 0.072073): 0.023862); Detailed output identifying parameters kappa (ts/tv) = 1.44954 Parameters in M7 (beta): p = 0.03344 q = 0.55970 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00054 0.02259 0.48963 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.033 999.8 320.2 0.0513 0.0020 0.0393 2.0 12.6 8..9 0.026 999.8 320.2 0.0513 0.0016 0.0303 1.6 9.7 9..2 0.014 999.8 320.2 0.0513 0.0009 0.0171 0.9 5.5 9..3 0.000 999.8 320.2 0.0513 0.0000 0.0000 0.0 0.0 8..10 0.024 999.8 320.2 0.0513 0.0014 0.0283 1.4 9.1 10..11 0.023 999.8 320.2 0.0513 0.0014 0.0274 1.4 8.8 11..4 0.094 999.8 320.2 0.0513 0.0057 0.1116 5.7 35.7 11..5 0.068 999.8 320.2 0.0513 0.0041 0.0806 4.1 25.8 10..12 0.072 999.8 320.2 0.0513 0.0044 0.0854 4.4 27.3 12..6 0.163 999.8 320.2 0.0513 0.0099 0.1932 9.9 61.8 12..7 0.301 999.8 320.2 0.0513 0.0183 0.3564 18.3 114.1 Time used: 2:16 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), ((4, 5), (6, 7))); MP score: 280 lnL(ntime: 11 np: 16): -3086.019792 +0.000000 8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..12 12..6 12..7 0.033328 0.025663 0.014451 0.000004 0.024027 0.023229 0.094580 0.068486 0.074901 0.161307 0.300589 1.459354 0.971387 0.146283 5.693777 1.114223 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.82057 (1: 0.033328, (2: 0.014451, 3: 0.000004): 0.025663, ((4: 0.094580, 5: 0.068486): 0.023229, (6: 0.161307, 7: 0.300589): 0.074901): 0.024027); (D_melanogaster_ZnT35C-PB: 0.033328, (D_sechellia_ZnT35C-PB: 0.014451, D_simulans_ZnT35C-PB: 0.000004): 0.025663, ((D_yakuba_ZnT35C-PB: 0.094580, D_erecta_ZnT35C-PB: 0.068486): 0.023229, (D_eugracilis_ZnT35C-PB: 0.161307, D_ficusphila_ZnT35C-PB: 0.300589): 0.074901): 0.024027); Detailed output identifying parameters kappa (ts/tv) = 1.45935 Parameters in M8 (beta&w>1): p0 = 0.97139 p = 0.14628 q = 5.69378 (p1 = 0.02861) w = 1.11422 dN/dS (w) for site classes (K=11) p: 0.09714 0.09714 0.09714 0.09714 0.09714 0.09714 0.09714 0.09714 0.09714 0.09714 0.02861 w: 0.00000 0.00000 0.00001 0.00009 0.00051 0.00202 0.00643 0.01792 0.04731 0.14206 1.11422 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.033 999.6 320.4 0.0529 0.0021 0.0393 2.1 12.6 8..9 0.026 999.6 320.4 0.0529 0.0016 0.0303 1.6 9.7 9..2 0.014 999.6 320.4 0.0529 0.0009 0.0170 0.9 5.5 9..3 0.000 999.6 320.4 0.0529 0.0000 0.0000 0.0 0.0 8..10 0.024 999.6 320.4 0.0529 0.0015 0.0283 1.5 9.1 10..11 0.023 999.6 320.4 0.0529 0.0014 0.0274 1.4 8.8 11..4 0.095 999.6 320.4 0.0529 0.0059 0.1115 5.9 35.7 11..5 0.068 999.6 320.4 0.0529 0.0043 0.0807 4.3 25.9 10..12 0.075 999.6 320.4 0.0529 0.0047 0.0883 4.7 28.3 12..6 0.161 999.6 320.4 0.0529 0.0101 0.1902 10.1 60.9 12..7 0.301 999.6 320.4 0.0529 0.0187 0.3544 18.7 113.5 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_ZnT35C-PB) Pr(w>1) post mean +- SE for w 200 S 0.962* 1.077 202 N 0.548 0.669 253 T 0.867 0.983 254 L 0.774 0.892 269 S 0.893 1.008 394 E 0.909 1.025 400 R 0.990** 1.105 433 L 0.725 0.844 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_ZnT35C-PB) Pr(w>1) post mean +- SE for w 200 S 0.777 1.434 +- 0.660 253 T 0.696 1.329 +- 0.788 254 L 0.508 1.028 +- 0.726 269 S 0.754 1.422 +- 0.802 394 E 0.709 1.331 +- 0.705 400 R 0.911 1.635 +- 0.697 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.013 0.133 0.853 ws: 0.839 0.124 0.025 0.007 0.003 0.001 0.001 0.000 0.000 0.000 Time used: 3:42
Model 1: NearlyNeutral -3086.055409 Model 2: PositiveSelection -3086.055409 Model 0: one-ratio -3105.434808 Model 3: discrete -3086.016048 Model 7: beta -3086.81449 Model 8: beta&w>1 -3086.019792 Model 0 vs 1 38.75879799999984 Model 2 vs 1 0.0 Model 8 vs 7 1.5893960000003062