--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 10 13:17:28 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/zetaTry-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2149.62 -2157.68
2 -2149.50 -2158.96
--------------------------------------
TOTAL -2149.56 -2158.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.332629 0.001331 0.265708 0.406423 0.330473 1413.70 1415.11 1.000
r(A<->C){all} 0.116455 0.000890 0.059962 0.172551 0.113767 1019.30 1025.92 1.002
r(A<->G){all} 0.202088 0.001215 0.137262 0.268375 0.200087 1043.96 1054.78 1.000
r(A<->T){all} 0.165676 0.001315 0.102215 0.244226 0.163246 899.76 991.77 1.000
r(C<->G){all} 0.092578 0.000509 0.055038 0.142017 0.090472 971.28 1026.96 1.000
r(C<->T){all} 0.344030 0.002144 0.252694 0.433154 0.342322 718.68 848.12 1.000
r(G<->T){all} 0.079173 0.000590 0.032792 0.125980 0.077508 1077.38 1121.80 1.000
pi(A){all} 0.205542 0.000175 0.179199 0.231529 0.205372 848.86 1111.87 1.000
pi(C){all} 0.274095 0.000201 0.247518 0.302297 0.274018 921.84 1211.42 1.000
pi(G){all} 0.292202 0.000230 0.262069 0.320820 0.291795 1148.87 1200.40 1.000
pi(T){all} 0.228160 0.000182 0.202011 0.254947 0.228143 1216.92 1232.67 1.000
alpha{1,2} 0.253009 0.025288 0.000140 0.539667 0.224062 1279.28 1300.51 1.000
alpha{3} 1.493012 0.440208 0.477047 2.795138 1.365237 1331.86 1354.33 1.000
pinvar{all} 0.130870 0.009973 0.000050 0.323442 0.110139 1223.84 1224.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2070.187425
Model 2: PositiveSelection -2070.187425
Model 0: one-ratio -2074.965666
Model 3: discrete -2069.173888
Model 7: beta -2069.5032
Model 8: beta&w>1 -2069.503212
Model 0 vs 1 9.55648199999996
Model 2 vs 1 0.0
Model 8 vs 7 2.3999999939405825E-5
>C1
MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQV
PYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV
AGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFT
IKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQ
DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW
GNSCALPNYPGVYANVAYLRPWIDAVLAGLo
>C2
MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQV
PYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKVV
AGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNFT
IKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCDQ
DYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVSW
GNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C3
MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQV
PYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV
AGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFT
IKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQ
DYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVSW
GNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C4
MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQV
PYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKVV
AGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNFT
IKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCDQ
DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVSW
GNKCALPNYPGVYANVAYLRPWIDAVLAGLo
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=282
C1 -MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
C2 -MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
C3 -MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
C4 -MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
C5 MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
****: ***.*.. ::*:***********:..*.*******.*****
C1 VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
C2 VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
C3 VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
C4 VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
C5 VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
*****:****.*::*:**:********.*****:*****::******:**
C1 VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
C2 VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
C3 VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
C4 VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
C5 VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
***:*::*.:********.::*** * **********:************
C1 TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
C2 TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
C3 TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
C4 TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
C5 TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
*****:** * *::*: **:****:* ..* :* **********.*:***
C1 QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
C2 QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
C3 QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
C4 QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
C5 LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
***:* ****:********************.******.*** *:****
C1 WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
C2 WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
C3 WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
C4 WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
C5 WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-
***.************** ******** ***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 281 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 281 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5688]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5688]--->[5684]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.290 Mb, Max= 30.586 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
-MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
>C2
-MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C3
-MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C4
-MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-
FORMAT of file /tmp/tmp3373879098649502982aln Not Supported[FATAL:T-COFFEE]
>C1
-MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
>C2
-MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C3
-MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C4
-MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:282 S:99 BS:282
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 92.88 C1 C2 92.88
TOP 1 0 92.88 C2 C1 92.88
BOT 0 2 96.09 C1 C3 96.09
TOP 2 0 96.09 C3 C1 96.09
BOT 0 3 90.39 C1 C4 90.39
TOP 3 0 90.39 C4 C1 90.39
BOT 0 4 84.29 C1 C5 84.29
TOP 4 0 84.29 C5 C1 84.29
BOT 1 2 96.09 C2 C3 96.09
TOP 2 1 96.09 C3 C2 96.09
BOT 1 3 88.26 C2 C4 88.26
TOP 3 1 88.26 C4 C2 88.26
BOT 1 4 82.14 C2 C5 82.14
TOP 4 1 82.14 C5 C2 82.14
BOT 2 3 90.75 C3 C4 90.75
TOP 3 2 90.75 C4 C3 90.75
BOT 2 4 84.29 C3 C5 84.29
TOP 4 2 84.29 C5 C3 84.29
BOT 3 4 82.86 C4 C5 82.86
TOP 4 3 82.86 C5 C4 82.86
AVG 0 C1 * 90.91
AVG 1 C2 * 89.84
AVG 2 C3 * 91.80
AVG 3 C4 * 88.06
AVG 4 C5 * 83.39
TOT TOT * 88.80
CLUSTAL W (1.83) multiple sequence alignment
C1 ---ATGTCGAGCTCTTGGATAGTTGGCCTCTTGGCCTTTCTCGTCAGCTT
C2 ---ATGTCGAGCTCTTGGCTGGTTTGCCTCTTGGCCTTTCTCGTCAGTTT
C3 ---ATGTCGAGCTCTTGGCTGGTTTGCCTATTGGCCTTTCTCGTCAGTTT
C4 ---ATGTCGAGCTCTTGGCTGGTCTGCCTTTTGGCTCTTCTCGTCGGCGT
C5 ATGTCGAGCTCTTCTTGGCTGGGTTGCCTCCTGGCCGTTCTATTCAGCGC
: *: : ******.*.* **** **** ****. **.*
C1 GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
C2 GGTGACCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
C3 GGTGGCCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
C4 GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
C5 CTTGGCCTTGAGCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAACA
**.****** *********************** *********** *
C1 GCGTTCCGGATGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
C2 ACGTTCCGGGAGGTCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
C3 GCGTTCCGGGAGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
C4 GCGTTCCGGGCGGGCGCATTGTGGGTGGCTATGTGACGGACATAGCGCAG
C5 GCTTTCCGGATGGCCGCATTGTGGGTGGCTACGTGACGGACATAGCGCAG
.* ******. ** ***************** * ****************
C1 GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCACCACGCCGGAGAA
C2 GTCCCGTACCAGATTTCCCTGCGCTACAAGGCTATCAGCACGCCGCAGAA
C3 GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCAGCACGCCGGAGAA
C4 GTACCGTACCAGATTTCGCTGCGCTACAAGGGTATCACCACGCCGGAGAA
C5 GTCCCATACCAGATTACCCTGCGCTACAAGGCCATCAGCTCGCCGGAGAA
**.**.*********:* ************* **** *:***** ****
C1 TCCCTTTCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACTACAATAG
C2 TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
C3 TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
C4 TCCCTATAGACACCGTTGCGGAGGATCCATTTTCAATGAAACCACAATAG
C5 TCCCTTTCGGCATCGGTGCGGAGGATCCATTGTCAATGAGACTACAATAC
*****:*.* ** ** *************** *******.** ******
C1 TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCAAGTCAATATAAAGTG
C2 TGACAGCGGCGCACTGCGTCGTAGGAACGGTGGCCAGTCAATATAAGGTC
C3 TGACAGCGGCGCACTGCGTCATCGGAACGGTGGCCAGTCAATATAAGGTT
C4 TGACAGCGGCGCACTGCATCATCGGCACGGTGGCTAGTCAATTCAAGGTG
C5 TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCTAGTCAGTTCAAGGTG
*****************.**.*.**.******** *****.*: **.**
C1 GTGGCCGGGACAAATTTCCAAACCGGCTCCGATGGCGTTATCACCAATGT
C2 GTGGCCGGAACAAATTTCCAAACCAGCTCCGATGGCGTTATCACCAATGT
C3 GTGGCCGGGACCAATTTCCAAACCGGATCCGATGGCGTTATCACCAATGT
C4 GTGGCCGGGTCAAACTGGCGAACAGGCTCCGATGGCGTCATCACCAATGT
C5 GTGGCCGGTACCAATTTCCAAACAGGCACCGATGGCGTCATCACCAATGT
******** :*.** * *.***..*.:********** ***********
C1 CAAGGAGATCGTTATGCACGAAGGGTATTACTCGGGAGCTGCCTACAACA
C2 CAAGCAGATCGTTATGCACGAAGGGTACGACTCGGGAGCTGCCTACAACA
C3 CAAGCAGATCGTTATGCACGAAGGTTACTACTCGGGAGCTGCCTACAACA
C4 CAAGCAGATCGTTATGCATGAGGAGTACTTCTCGGGAGCTGCCTACAACA
C5 CAAGCGGGTCATCATGCACGAGGGATACAACTCGGGAGCAGCCTACAATA
**** .*.**.* ***** **.*. ** :*********:******** *
C1 ACGATATTGCCATTCTATTTGTGGATCCCCCATTGCCGCTCAACAACTTC
C2 ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
C3 ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
C4 ATGATATCGCCATTCTATTCGTGGATCCCCCATTGCCACTCAATAACTTC
C5 ACGATATTGCCGTTCTATTTGTGGATCCCCCATTGCCCCTGAACAACTTC
* ** ** ***.****.** ******** ******** ** ** ******
C1 ACCATCAAGGCCATTAAGCTGGCCTTGGAACAACCAATTGAGGGAACGGT
C2 ACCATCAAGGCCATTAAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
C3 ACCATCAAGGCCATTCAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
C4 ACCATCAAGGCCATTAAGCTGGCTTCGGAGCCACCACTTGAGGGAACGGT
C5 ACCATCAAGGCCATTAAGCTGGCTACGGAGCCACCACTTGATGGAGCGCC
***************.******* : ***.*.****.**** ***.**
C1 CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
C2 CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACACCTCGT
C3 CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
C4 CAGCAAGATCAGCGGATGGGGAACCACTTCTTCCGCTGGCTCCGCCTCGA
C5 CAGCAAGATCAGCGGATGGGGCTCCACTTATCCCGGCGGCTACTCCTCCA
*******.*************.:******.* *** ****.* **** :
C1 ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTTTGTGAT
C2 ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
C3 ACCAACTGCTTGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
C4 ATCAACTACTCGCGGTAGATGTGCCGATTGTGAGCAACGAGTTGTGTGAC
C5 ACCAACTTCTCGCGGTGGATGTCCCGATTGTGGGCAACGACTTGTGTGAC
* ***** ** ***** ***** *********.******* * *****
C1 CAGGACTACGAGGATTTTGGCGACGAGACCTACCGCATTACATCGGCCAT
C2 CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
C3 CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
C4 CAGGACTACGAGGACTTCGGCGATGAGACCTACCGCATCACATCGGCCAT
C5 CTGGACTACGAGAACTTCATCGATGAGACCTACCACATCACATCCGCCAT
*:**********.* ** . *** **********.*** ***** *****
C1 GTTGTGTGCCGGCAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGAG
C2 GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGCTG
C3 GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGTG
C4 GTTGTGTGCCGGCAAACGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
C5 GTTGTGTGCCGGCAAGCGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
************ **.*********** ******************* :*
C1 ATTCCGGAGGACCGTTGGCGGTGCGCGATGAACTCTATGGAGTCGTGTCC
C2 ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
C3 ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
C4 ATTCCGGTGGGCCGTTGGTGGTGCGCGATGAGCTCCATGGAGTCGTGTCC
C5 ATTCCGGCGGACCGTTGGTGGTGCGCGACGAGCTCCATGGAGTCGTGTCC
******* **.******* ********* *:.*** *************
C1 TGGGGCAACAGTTGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C2 TGGGGTAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C3 TGGGGCAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C4 TGGGGCAACAAATGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C5 TGGGGCAACAGTTGCGCCCTGCCCAATTATCCCGGCGTCTACGCCAATGT
***** ****.:** **.*********************** ********
C1 GGCGTACCTGAGGCCTTGGATCGATGCCGTTTTGGCAGGGCTC---
C2 GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
C3 GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
C4 GGCTTACCTGAGACCCTGGATCGATGCTGTTCTGGCGGGGCTC---
C5 GGCGTTCCTGAGGCCCTGGATCGATGCCGTTCGGGCAGGTCTC---
*** ::******.** *********** *** ***.** ***
>C1
---ATGTCGAGCTCTTGGATAGTTGGCCTCTTGGCCTTTCTCGTCAGCTT
GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
GCGTTCCGGATGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCACCACGCCGGAGAA
TCCCTTTCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACTACAATAG
TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCAAGTCAATATAAAGTG
GTGGCCGGGACAAATTTCCAAACCGGCTCCGATGGCGTTATCACCAATGT
CAAGGAGATCGTTATGCACGAAGGGTATTACTCGGGAGCTGCCTACAACA
ACGATATTGCCATTCTATTTGTGGATCCCCCATTGCCGCTCAACAACTTC
ACCATCAAGGCCATTAAGCTGGCCTTGGAACAACCAATTGAGGGAACGGT
CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTTTGTGAT
CAGGACTACGAGGATTTTGGCGACGAGACCTACCGCATTACATCGGCCAT
GTTGTGTGCCGGCAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGAG
ATTCCGGAGGACCGTTGGCGGTGCGCGATGAACTCTATGGAGTCGTGTCC
TGGGGCAACAGTTGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCGTACCTGAGGCCTTGGATCGATGCCGTTTTGGCAGGGCTC---
>C2
---ATGTCGAGCTCTTGGCTGGTTTGCCTCTTGGCCTTTCTCGTCAGTTT
GGTGACCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
ACGTTCCGGGAGGTCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
GTCCCGTACCAGATTTCCCTGCGCTACAAGGCTATCAGCACGCCGCAGAA
TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
TGACAGCGGCGCACTGCGTCGTAGGAACGGTGGCCAGTCAATATAAGGTC
GTGGCCGGAACAAATTTCCAAACCAGCTCCGATGGCGTTATCACCAATGT
CAAGCAGATCGTTATGCACGAAGGGTACGACTCGGGAGCTGCCTACAACA
ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
ACCATCAAGGCCATTAAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACACCTCGT
ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGCTG
ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
TGGGGTAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
>C3
---ATGTCGAGCTCTTGGCTGGTTTGCCTATTGGCCTTTCTCGTCAGTTT
GGTGGCCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
GCGTTCCGGGAGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCAGCACGCCGGAGAA
TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
TGACAGCGGCGCACTGCGTCATCGGAACGGTGGCCAGTCAATATAAGGTT
GTGGCCGGGACCAATTTCCAAACCGGATCCGATGGCGTTATCACCAATGT
CAAGCAGATCGTTATGCACGAAGGTTACTACTCGGGAGCTGCCTACAACA
ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
ACCATCAAGGCCATTCAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
ACCAACTGCTTGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGTG
ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
TGGGGCAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
>C4
---ATGTCGAGCTCTTGGCTGGTCTGCCTTTTGGCTCTTCTCGTCGGCGT
GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
GCGTTCCGGGCGGGCGCATTGTGGGTGGCTATGTGACGGACATAGCGCAG
GTACCGTACCAGATTTCGCTGCGCTACAAGGGTATCACCACGCCGGAGAA
TCCCTATAGACACCGTTGCGGAGGATCCATTTTCAATGAAACCACAATAG
TGACAGCGGCGCACTGCATCATCGGCACGGTGGCTAGTCAATTCAAGGTG
GTGGCCGGGTCAAACTGGCGAACAGGCTCCGATGGCGTCATCACCAATGT
CAAGCAGATCGTTATGCATGAGGAGTACTTCTCGGGAGCTGCCTACAACA
ATGATATCGCCATTCTATTCGTGGATCCCCCATTGCCACTCAATAACTTC
ACCATCAAGGCCATTAAGCTGGCTTCGGAGCCACCACTTGAGGGAACGGT
CAGCAAGATCAGCGGATGGGGAACCACTTCTTCCGCTGGCTCCGCCTCGA
ATCAACTACTCGCGGTAGATGTGCCGATTGTGAGCAACGAGTTGTGTGAC
CAGGACTACGAGGACTTCGGCGATGAGACCTACCGCATCACATCGGCCAT
GTTGTGTGCCGGCAAACGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
ATTCCGGTGGGCCGTTGGTGGTGCGCGATGAGCTCCATGGAGTCGTGTCC
TGGGGCAACAAATGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCTTACCTGAGACCCTGGATCGATGCTGTTCTGGCGGGGCTC---
>C5
ATGTCGAGCTCTTCTTGGCTGGGTTGCCTCCTGGCCGTTCTATTCAGCGC
CTTGGCCTTGAGCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAACA
GCTTTCCGGATGGCCGCATTGTGGGTGGCTACGTGACGGACATAGCGCAG
GTCCCATACCAGATTACCCTGCGCTACAAGGCCATCAGCTCGCCGGAGAA
TCCCTTTCGGCATCGGTGCGGAGGATCCATTGTCAATGAGACTACAATAC
TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCTAGTCAGTTCAAGGTG
GTGGCCGGTACCAATTTCCAAACAGGCACCGATGGCGTCATCACCAATGT
CAAGCGGGTCATCATGCACGAGGGATACAACTCGGGAGCAGCCTACAATA
ACGATATTGCCGTTCTATTTGTGGATCCCCCATTGCCCCTGAACAACTTC
ACCATCAAGGCCATTAAGCTGGCTACGGAGCCACCACTTGATGGAGCGCC
CAGCAAGATCAGCGGATGGGGCTCCACTTATCCCGGCGGCTACTCCTCCA
ACCAACTTCTCGCGGTGGATGTCCCGATTGTGGGCAACGACTTGTGTGAC
CTGGACTACGAGAACTTCATCGATGAGACCTACCACATCACATCCGCCAT
GTTGTGTGCCGGCAAGCGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
ATTCCGGCGGACCGTTGGTGGTGCGCGACGAGCTCCATGGAGTCGTGTCC
TGGGGCAACAGTTGCGCCCTGCCCAATTATCCCGGCGTCTACGCCAATGT
GGCGTTCCTGAGGCCCTGGATCGATGCCGTTCGGGCAGGTCTC---
>C1
oMSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
WGNSCALPNYPGVYANVAYLRPWIDAVLAGL
>C2
oMSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGL
>C3
oMSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGL
>C4
oMSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNKCALPNYPGVYANVAYLRPWIDAVLAGL
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 846 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481375613
Setting output file names to "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1305873983
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7533981066
Seed = 1677725866
Swapseed = 1481375613
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 37 unique site patterns
Division 2 has 32 unique site patterns
Division 3 has 57 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2418.560719 -- -25.624409
Chain 2 -- -2478.706439 -- -25.624409
Chain 3 -- -2487.017828 -- -25.624409
Chain 4 -- -2473.006779 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2471.853347 -- -25.624409
Chain 2 -- -2421.902147 -- -25.624409
Chain 3 -- -2418.560719 -- -25.624409
Chain 4 -- -2471.014327 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2418.561] (-2478.706) (-2487.018) (-2473.007) * [-2471.853] (-2421.902) (-2418.561) (-2471.014)
500 -- (-2173.077) (-2157.355) (-2166.930) [-2155.580] * (-2179.258) (-2167.720) [-2164.522] (-2164.760) -- 0:00:00
1000 -- (-2170.225) [-2162.881] (-2161.255) (-2155.589) * (-2171.344) (-2172.170) (-2157.714) [-2156.960] -- 0:00:00
1500 -- (-2163.150) (-2151.918) [-2156.227] (-2155.442) * [-2153.430] (-2169.084) (-2157.589) (-2159.570) -- 0:00:00
2000 -- (-2158.914) (-2153.713) (-2161.570) [-2147.982] * [-2152.404] (-2165.341) (-2159.110) (-2152.297) -- 0:00:00
2500 -- [-2154.665] (-2153.511) (-2155.275) (-2150.578) * (-2149.778) (-2162.052) [-2152.565] (-2153.139) -- 0:06:39
3000 -- (-2152.375) (-2162.857) (-2155.960) [-2152.434] * (-2150.245) (-2155.089) [-2157.521] (-2155.753) -- 0:05:32
3500 -- (-2151.835) (-2150.478) (-2149.687) [-2155.397] * (-2152.296) (-2153.880) (-2158.694) [-2151.097] -- 0:04:44
4000 -- (-2152.424) (-2150.422) (-2152.988) [-2154.762] * (-2155.066) [-2153.005] (-2156.039) (-2151.433) -- 0:04:09
4500 -- (-2158.277) (-2154.094) [-2151.646] (-2155.753) * (-2149.109) (-2150.354) (-2154.843) [-2149.518] -- 0:03:41
5000 -- [-2150.096] (-2151.066) (-2150.606) (-2155.948) * [-2148.070] (-2152.490) (-2158.667) (-2150.882) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- [-2151.215] (-2149.625) (-2151.765) (-2158.245) * [-2152.190] (-2155.372) (-2156.513) (-2151.716) -- 0:03:00
6000 -- (-2150.621) (-2158.515) (-2156.222) [-2153.845] * [-2152.244] (-2152.816) (-2151.835) (-2151.968) -- 0:02:45
6500 -- [-2154.540] (-2156.637) (-2153.538) (-2158.562) * (-2149.182) [-2154.766] (-2151.271) (-2153.007) -- 0:02:32
7000 -- (-2155.355) (-2158.870) (-2152.588) [-2154.870] * [-2152.579] (-2152.733) (-2151.601) (-2152.962) -- 0:02:21
7500 -- (-2158.471) (-2153.994) [-2149.078] (-2151.088) * (-2149.958) (-2157.115) (-2159.931) [-2149.484] -- 0:04:24
8000 -- (-2156.502) (-2155.925) [-2147.446] (-2153.065) * [-2148.381] (-2153.873) (-2152.845) (-2156.038) -- 0:04:08
8500 -- (-2154.733) [-2152.594] (-2150.110) (-2148.153) * [-2147.804] (-2154.067) (-2157.716) (-2154.777) -- 0:03:53
9000 -- (-2153.099) [-2153.403] (-2147.311) (-2153.285) * (-2148.187) [-2150.554] (-2150.461) (-2151.327) -- 0:03:40
9500 -- (-2153.638) (-2151.615) [-2153.723] (-2151.260) * (-2148.254) (-2155.032) [-2151.544] (-2153.132) -- 0:03:28
10000 -- (-2150.165) (-2159.893) [-2152.431] (-2150.197) * (-2151.076) [-2149.255] (-2151.999) (-2155.009) -- 0:03:18
Average standard deviation of split frequencies: 0.000000
10500 -- (-2155.928) (-2150.058) [-2153.839] (-2156.751) * [-2150.700] (-2149.395) (-2152.665) (-2151.680) -- 0:03:08
11000 -- [-2153.016] (-2153.818) (-2157.816) (-2151.038) * [-2149.968] (-2148.999) (-2158.770) (-2152.526) -- 0:02:59
11500 -- (-2153.598) (-2151.518) [-2150.776] (-2151.413) * (-2146.285) [-2151.463] (-2151.858) (-2153.318) -- 0:02:51
12000 -- (-2150.917) [-2147.084] (-2155.122) (-2154.480) * [-2150.944] (-2152.702) (-2151.369) (-2152.324) -- 0:02:44
12500 -- [-2152.551] (-2156.157) (-2155.397) (-2152.937) * [-2154.110] (-2158.406) (-2152.212) (-2153.349) -- 0:02:38
13000 -- [-2148.654] (-2148.454) (-2152.337) (-2153.327) * (-2155.490) (-2152.291) [-2147.829] (-2152.426) -- 0:03:47
13500 -- (-2150.118) (-2156.529) [-2149.930] (-2147.423) * (-2159.599) [-2154.347] (-2153.449) (-2154.457) -- 0:03:39
14000 -- (-2156.609) [-2148.052] (-2152.074) (-2154.591) * (-2156.154) (-2151.733) [-2157.392] (-2153.245) -- 0:03:31
14500 -- (-2150.829) (-2150.983) (-2152.018) [-2152.239] * (-2159.210) (-2152.124) (-2148.280) [-2150.087] -- 0:03:23
15000 -- (-2152.629) (-2151.005) [-2152.908] (-2153.471) * (-2161.855) (-2150.327) (-2156.487) [-2148.890] -- 0:03:17
Average standard deviation of split frequencies: 0.000000
15500 -- (-2148.022) (-2152.438) (-2153.638) [-2149.803] * (-2156.097) (-2159.930) (-2157.314) [-2150.960] -- 0:03:10
16000 -- [-2150.448] (-2161.827) (-2161.166) (-2154.029) * (-2158.378) (-2159.258) [-2152.787] (-2155.206) -- 0:03:04
16500 -- (-2151.677) (-2156.828) [-2153.003] (-2153.040) * [-2149.276] (-2168.753) (-2157.557) (-2148.856) -- 0:02:58
17000 -- (-2153.787) (-2150.181) [-2152.425] (-2151.803) * (-2151.180) (-2159.638) (-2150.730) [-2152.531] -- 0:02:53
17500 -- (-2151.887) (-2158.518) [-2152.245] (-2153.949) * (-2148.922) (-2152.694) (-2147.888) [-2150.799] -- 0:02:48
18000 -- (-2153.406) [-2154.299] (-2147.393) (-2150.115) * [-2149.041] (-2157.183) (-2153.682) (-2151.003) -- 0:02:43
18500 -- (-2158.139) (-2149.825) [-2148.729] (-2151.948) * [-2154.020] (-2150.658) (-2157.870) (-2152.161) -- 0:03:32
19000 -- (-2152.523) (-2150.723) (-2156.306) [-2151.298] * (-2154.818) (-2154.683) (-2158.429) [-2151.545] -- 0:03:26
19500 -- (-2151.109) (-2150.757) (-2158.687) [-2151.362] * (-2151.271) [-2153.260] (-2155.617) (-2149.698) -- 0:03:21
20000 -- [-2149.709] (-2156.771) (-2152.519) (-2152.430) * (-2149.358) (-2158.419) [-2150.006] (-2151.592) -- 0:03:16
Average standard deviation of split frequencies: 0.000000
20500 -- (-2147.937) (-2151.800) (-2162.302) [-2155.569] * [-2147.725] (-2155.371) (-2154.284) (-2156.567) -- 0:03:11
21000 -- (-2152.309) (-2152.618) (-2149.680) [-2152.245] * (-2148.572) [-2153.133] (-2155.589) (-2163.350) -- 0:03:06
21500 -- [-2153.197] (-2156.266) (-2146.767) (-2153.718) * (-2150.591) (-2152.364) [-2153.766] (-2160.816) -- 0:03:02
22000 -- (-2156.598) [-2148.707] (-2158.390) (-2151.340) * (-2155.812) (-2152.622) (-2152.661) [-2155.921] -- 0:02:57
22500 -- (-2157.000) (-2151.742) (-2152.987) [-2154.430] * (-2152.956) (-2154.100) (-2164.131) [-2151.099] -- 0:02:53
23000 -- (-2156.269) (-2151.056) [-2154.158] (-2153.186) * (-2150.481) (-2150.553) [-2155.651] (-2153.623) -- 0:02:49
23500 -- (-2157.565) (-2151.709) (-2156.581) [-2151.531] * (-2150.344) [-2152.469] (-2148.921) (-2151.888) -- 0:02:46
24000 -- (-2163.358) (-2149.880) [-2152.335] (-2148.686) * [-2151.071] (-2153.787) (-2152.741) (-2154.583) -- 0:03:23
24500 -- (-2154.970) (-2150.451) [-2152.663] (-2146.496) * (-2150.464) (-2161.408) [-2153.620] (-2153.554) -- 0:03:19
25000 -- (-2151.554) (-2150.936) (-2151.670) [-2148.403] * [-2147.855] (-2161.201) (-2160.077) (-2152.128) -- 0:03:15
Average standard deviation of split frequencies: 0.000000
25500 -- (-2152.048) [-2151.301] (-2149.572) (-2152.216) * (-2153.018) (-2154.587) [-2153.323] (-2150.418) -- 0:03:11
26000 -- (-2151.562) (-2153.756) (-2152.437) [-2151.872] * [-2150.478] (-2160.861) (-2152.867) (-2154.618) -- 0:03:07
26500 -- (-2148.784) [-2155.255] (-2148.454) (-2154.736) * [-2150.605] (-2161.268) (-2156.206) (-2157.695) -- 0:03:03
27000 -- (-2148.277) [-2148.902] (-2151.653) (-2152.537) * (-2152.909) (-2157.898) [-2147.192] (-2159.822) -- 0:03:00
27500 -- [-2149.964] (-2149.043) (-2153.869) (-2152.891) * (-2155.818) [-2161.497] (-2155.231) (-2152.731) -- 0:02:56
28000 -- [-2151.056] (-2152.951) (-2158.965) (-2154.852) * [-2152.019] (-2151.092) (-2155.267) (-2152.488) -- 0:02:53
28500 -- (-2157.677) (-2148.353) (-2158.167) [-2151.581] * (-2148.891) [-2149.240] (-2159.717) (-2155.440) -- 0:02:50
29000 -- (-2150.367) [-2151.397] (-2154.800) (-2155.594) * (-2152.675) (-2150.912) [-2154.163] (-2158.866) -- 0:03:20
29500 -- (-2151.660) (-2153.638) [-2159.874] (-2152.966) * [-2153.912] (-2153.242) (-2154.029) (-2151.344) -- 0:03:17
30000 -- (-2146.823) (-2151.376) (-2155.978) [-2151.781] * [-2152.924] (-2155.265) (-2156.690) (-2153.352) -- 0:03:14
Average standard deviation of split frequencies: 0.000000
30500 -- (-2149.668) (-2159.607) (-2153.084) [-2151.478] * (-2153.434) (-2153.102) [-2152.985] (-2152.005) -- 0:03:10
31000 -- (-2152.292) (-2153.195) (-2153.922) [-2147.653] * (-2151.688) (-2155.845) [-2151.364] (-2155.674) -- 0:03:07
31500 -- (-2147.788) (-2153.825) (-2149.569) [-2154.211] * (-2150.376) (-2154.515) (-2152.315) [-2147.014] -- 0:03:04
32000 -- [-2153.354] (-2153.415) (-2160.659) (-2155.705) * (-2156.746) (-2152.524) (-2151.264) [-2147.919] -- 0:03:01
32500 -- (-2155.651) (-2156.032) (-2154.096) [-2158.683] * (-2164.980) (-2157.383) [-2152.078] (-2148.758) -- 0:02:58
33000 -- [-2150.146] (-2155.688) (-2149.502) (-2153.410) * (-2159.223) (-2158.706) (-2153.071) [-2152.247] -- 0:02:55
33500 -- [-2154.233] (-2155.050) (-2151.781) (-2157.386) * (-2151.269) (-2151.507) (-2149.826) [-2151.356] -- 0:02:53
34000 -- [-2148.442] (-2155.422) (-2157.206) (-2154.098) * [-2152.491] (-2148.904) (-2159.034) (-2150.297) -- 0:02:50
34500 -- [-2150.046] (-2158.026) (-2151.360) (-2152.049) * (-2152.977) [-2148.712] (-2153.576) (-2150.179) -- 0:03:15
35000 -- (-2152.690) [-2155.132] (-2155.995) (-2153.492) * (-2155.059) (-2152.594) [-2149.070] (-2150.935) -- 0:03:13
Average standard deviation of split frequencies: 0.000000
35500 -- (-2153.598) (-2150.446) (-2153.105) [-2154.749] * (-2153.484) [-2149.372] (-2151.770) (-2151.144) -- 0:03:10
36000 -- (-2153.549) [-2150.642] (-2154.251) (-2154.994) * (-2154.330) (-2148.802) [-2149.942] (-2148.957) -- 0:03:07
36500 -- (-2152.728) (-2160.679) (-2155.741) [-2154.506] * (-2154.725) (-2152.334) [-2152.126] (-2153.562) -- 0:03:04
37000 -- (-2155.324) (-2154.873) (-2154.784) [-2156.869] * (-2153.027) [-2153.646] (-2160.063) (-2154.643) -- 0:03:02
37500 -- (-2154.425) (-2156.580) (-2154.548) [-2152.070] * (-2152.465) (-2149.561) (-2156.155) [-2150.251] -- 0:02:59
38000 -- (-2148.251) [-2152.000] (-2149.800) (-2152.672) * (-2154.846) (-2151.319) (-2152.239) [-2149.999] -- 0:02:57
38500 -- (-2149.744) [-2152.284] (-2157.253) (-2148.037) * (-2149.218) (-2149.561) [-2152.147] (-2153.530) -- 0:02:54
39000 -- [-2148.462] (-2157.824) (-2154.166) (-2153.973) * (-2154.922) (-2158.298) (-2152.671) [-2152.646] -- 0:02:52
39500 -- [-2153.262] (-2157.814) (-2159.595) (-2153.000) * (-2157.278) (-2155.290) [-2155.531] (-2152.114) -- 0:02:50
40000 -- [-2150.863] (-2153.674) (-2151.850) (-2152.268) * (-2149.712) (-2152.403) [-2149.527] (-2150.666) -- 0:03:12
Average standard deviation of split frequencies: 0.000000
40500 -- (-2150.353) (-2154.948) (-2152.895) [-2151.726] * (-2155.590) (-2151.296) (-2155.220) [-2151.929] -- 0:03:09
41000 -- (-2154.701) (-2154.807) [-2152.808] (-2152.322) * (-2152.421) [-2151.909] (-2158.388) (-2152.200) -- 0:03:07
41500 -- (-2153.181) (-2156.864) [-2149.141] (-2155.042) * (-2154.565) (-2152.885) (-2156.464) [-2150.150] -- 0:03:04
42000 -- (-2149.751) [-2151.996] (-2152.972) (-2159.822) * (-2147.889) (-2160.252) (-2158.775) [-2152.089] -- 0:03:02
42500 -- (-2152.371) (-2151.459) (-2154.850) [-2152.847] * (-2149.235) (-2154.710) (-2169.169) [-2152.518] -- 0:03:00
43000 -- (-2153.910) [-2155.395] (-2149.441) (-2154.573) * (-2152.256) (-2148.647) [-2149.114] (-2149.758) -- 0:02:58
43500 -- (-2152.865) (-2153.307) [-2151.650] (-2154.279) * (-2152.311) (-2150.318) [-2150.134] (-2154.161) -- 0:02:55
44000 -- (-2159.415) [-2149.961] (-2153.717) (-2157.969) * (-2149.865) (-2152.446) [-2150.164] (-2155.542) -- 0:02:53
44500 -- (-2160.604) [-2148.587] (-2153.343) (-2152.479) * (-2152.395) (-2151.288) (-2153.695) [-2151.335] -- 0:02:51
45000 -- (-2154.067) (-2151.537) (-2150.692) [-2152.798] * [-2149.660] (-2154.094) (-2148.064) (-2152.329) -- 0:02:49
Average standard deviation of split frequencies: 0.000000
45500 -- (-2154.695) (-2150.119) [-2145.539] (-2154.682) * (-2152.097) (-2152.204) (-2150.950) [-2148.005] -- 0:03:08
46000 -- [-2155.608] (-2159.051) (-2148.263) (-2150.284) * (-2148.312) (-2160.237) (-2154.322) [-2154.205] -- 0:03:06
46500 -- (-2152.460) (-2152.496) [-2154.362] (-2147.293) * [-2155.966] (-2158.118) (-2152.432) (-2154.603) -- 0:03:04
47000 -- (-2148.533) (-2156.125) (-2160.260) [-2152.434] * (-2155.172) (-2149.729) [-2149.936] (-2155.362) -- 0:03:02
47500 -- [-2153.284] (-2157.451) (-2158.070) (-2149.671) * [-2155.564] (-2157.855) (-2152.134) (-2158.653) -- 0:03:00
48000 -- (-2155.344) [-2150.856] (-2149.109) (-2154.543) * [-2152.373] (-2159.081) (-2151.662) (-2159.058) -- 0:02:58
48500 -- (-2155.827) (-2153.272) [-2153.349] (-2154.766) * (-2152.026) [-2161.294] (-2151.921) (-2162.874) -- 0:02:56
49000 -- (-2157.299) (-2152.068) [-2148.349] (-2154.840) * [-2153.784] (-2160.494) (-2154.507) (-2156.805) -- 0:02:54
49500 -- (-2151.089) (-2149.486) (-2151.270) [-2150.257] * (-2157.151) (-2153.335) [-2150.813] (-2151.307) -- 0:02:52
50000 -- (-2157.489) [-2149.798] (-2151.761) (-2148.972) * (-2154.077) (-2154.154) (-2156.046) [-2149.234] -- 0:02:51
Average standard deviation of split frequencies: 0.000000
50500 -- (-2148.523) (-2152.411) [-2150.242] (-2149.975) * (-2156.368) (-2148.557) (-2154.129) [-2152.622] -- 0:02:49
51000 -- [-2148.366] (-2157.170) (-2154.846) (-2157.639) * (-2151.633) (-2152.843) (-2154.076) [-2147.780] -- 0:03:06
51500 -- (-2155.167) (-2156.697) (-2160.933) [-2153.923] * (-2154.337) (-2157.063) (-2157.521) [-2153.603] -- 0:03:04
52000 -- [-2152.444] (-2158.937) (-2158.141) (-2155.120) * [-2150.714] (-2164.146) (-2158.512) (-2149.114) -- 0:03:02
52500 -- (-2151.444) (-2154.095) (-2154.389) [-2150.783] * [-2154.233] (-2160.038) (-2153.302) (-2149.595) -- 0:03:00
53000 -- [-2155.385] (-2157.581) (-2152.406) (-2150.631) * [-2150.755] (-2158.218) (-2162.000) (-2156.075) -- 0:02:58
53500 -- (-2151.105) (-2156.105) (-2151.545) [-2151.362] * (-2153.828) [-2153.036] (-2156.815) (-2153.677) -- 0:02:56
54000 -- (-2145.734) (-2163.017) (-2156.635) [-2156.980] * (-2150.826) (-2155.534) (-2152.125) [-2156.235] -- 0:02:55
54500 -- [-2154.600] (-2153.947) (-2153.802) (-2154.902) * [-2151.473] (-2150.455) (-2151.434) (-2152.746) -- 0:02:53
55000 -- (-2149.165) (-2155.040) [-2148.554] (-2158.102) * (-2156.950) (-2150.609) [-2153.923] (-2152.151) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
55500 -- (-2152.752) (-2153.441) (-2159.652) [-2153.839] * (-2153.397) (-2148.983) (-2149.909) [-2152.460] -- 0:02:50
56000 -- [-2149.181] (-2153.826) (-2154.029) (-2160.902) * (-2158.948) (-2150.886) [-2149.712] (-2156.768) -- 0:03:05
56500 -- (-2149.882) (-2157.242) [-2149.514] (-2159.232) * [-2152.664] (-2152.860) (-2148.443) (-2152.827) -- 0:03:03
57000 -- (-2155.649) (-2154.105) [-2152.155] (-2152.035) * (-2150.440) (-2152.692) (-2152.761) [-2152.703] -- 0:03:01
57500 -- (-2149.727) (-2161.887) (-2150.516) [-2156.873] * (-2155.821) (-2150.036) (-2148.465) [-2151.381] -- 0:03:00
58000 -- [-2155.767] (-2155.948) (-2149.410) (-2163.651) * (-2152.175) [-2154.793] (-2149.586) (-2154.805) -- 0:02:58
58500 -- (-2157.899) (-2152.759) (-2158.116) [-2154.910] * (-2150.910) [-2152.652] (-2152.902) (-2150.588) -- 0:02:57
59000 -- (-2155.540) (-2155.843) (-2159.359) [-2155.492] * (-2155.042) (-2151.082) [-2148.694] (-2152.997) -- 0:02:55
59500 -- (-2154.129) (-2151.556) (-2157.477) [-2149.280] * (-2153.332) (-2152.201) [-2150.549] (-2154.735) -- 0:02:53
60000 -- (-2153.862) (-2146.836) [-2158.382] (-2152.441) * (-2157.847) [-2149.726] (-2154.347) (-2156.501) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
60500 -- (-2160.919) (-2147.757) [-2150.246] (-2150.790) * (-2153.841) (-2151.521) [-2152.797] (-2155.897) -- 0:02:50
61000 -- (-2151.070) (-2155.317) [-2151.645] (-2157.647) * (-2156.176) [-2146.727] (-2154.546) (-2150.692) -- 0:02:49
61500 -- (-2154.846) (-2156.388) [-2149.685] (-2150.150) * (-2158.110) (-2155.491) [-2147.139] (-2154.540) -- 0:03:03
62000 -- (-2152.601) (-2155.591) [-2148.618] (-2156.369) * (-2153.058) (-2159.560) [-2147.924] (-2150.855) -- 0:03:01
62500 -- [-2152.011] (-2157.469) (-2150.154) (-2163.139) * (-2151.623) (-2149.987) [-2155.541] (-2155.273) -- 0:03:00
63000 -- (-2151.500) [-2149.954] (-2151.550) (-2156.588) * [-2152.851] (-2153.205) (-2160.369) (-2152.382) -- 0:02:58
63500 -- (-2151.823) [-2147.017] (-2168.866) (-2160.501) * (-2149.192) [-2151.752] (-2152.738) (-2147.211) -- 0:02:56
64000 -- (-2152.593) [-2151.105] (-2153.697) (-2156.429) * (-2148.701) [-2153.067] (-2149.753) (-2154.967) -- 0:02:55
64500 -- (-2154.522) [-2155.950] (-2153.261) (-2155.271) * (-2155.387) [-2153.330] (-2149.415) (-2149.675) -- 0:02:54
65000 -- (-2156.074) [-2151.459] (-2158.131) (-2150.488) * [-2148.282] (-2149.308) (-2152.196) (-2166.181) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
65500 -- (-2156.729) [-2150.753] (-2167.490) (-2157.282) * (-2150.101) [-2159.950] (-2155.609) (-2151.141) -- 0:02:51
66000 -- (-2155.830) [-2155.514] (-2158.652) (-2149.884) * (-2151.612) [-2152.223] (-2156.660) (-2154.232) -- 0:02:49
66500 -- (-2156.788) (-2148.221) (-2157.222) [-2148.679] * (-2152.218) [-2148.765] (-2149.821) (-2152.809) -- 0:02:48
67000 -- (-2152.183) (-2150.835) (-2150.952) [-2148.088] * (-2150.270) [-2155.836] (-2152.173) (-2154.092) -- 0:03:01
67500 -- (-2155.956) [-2148.488] (-2149.589) (-2150.425) * [-2149.607] (-2159.794) (-2153.509) (-2152.801) -- 0:02:59
68000 -- (-2159.327) (-2149.054) [-2150.049] (-2153.333) * [-2151.722] (-2152.015) (-2156.158) (-2158.139) -- 0:02:58
68500 -- (-2156.013) [-2148.794] (-2147.488) (-2153.219) * [-2149.754] (-2158.535) (-2155.420) (-2154.486) -- 0:02:56
69000 -- [-2158.104] (-2157.336) (-2155.161) (-2154.938) * [-2154.461] (-2165.503) (-2157.411) (-2158.724) -- 0:02:55
69500 -- (-2154.348) [-2150.918] (-2157.723) (-2148.936) * [-2155.315] (-2160.800) (-2152.865) (-2155.693) -- 0:02:54
70000 -- (-2151.879) (-2156.192) [-2150.622] (-2158.100) * (-2152.783) [-2151.529] (-2153.273) (-2153.488) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
70500 -- [-2150.307] (-2155.622) (-2158.281) (-2156.296) * [-2150.464] (-2156.721) (-2149.814) (-2151.348) -- 0:02:51
71000 -- (-2152.567) (-2153.302) [-2151.864] (-2155.806) * (-2150.682) (-2151.059) (-2153.356) [-2152.421] -- 0:02:50
71500 -- (-2152.180) (-2153.309) [-2152.915] (-2149.558) * (-2153.963) [-2148.563] (-2152.201) (-2151.813) -- 0:02:48
72000 -- (-2153.659) (-2152.294) [-2147.645] (-2148.966) * (-2153.005) (-2157.632) (-2148.503) [-2154.087] -- 0:02:47
72500 -- (-2154.794) (-2157.505) [-2155.333] (-2149.882) * [-2153.755] (-2154.857) (-2153.274) (-2153.887) -- 0:02:59
73000 -- (-2151.884) (-2158.850) (-2158.139) [-2153.925] * [-2154.858] (-2156.269) (-2155.201) (-2156.218) -- 0:02:57
73500 -- (-2154.909) (-2155.442) (-2156.098) [-2152.069] * (-2152.780) [-2150.993] (-2153.013) (-2158.152) -- 0:02:56
74000 -- [-2154.050] (-2151.191) (-2159.371) (-2151.774) * (-2150.183) (-2146.623) [-2153.948] (-2158.821) -- 0:02:55
74500 -- [-2153.434] (-2153.899) (-2153.193) (-2150.220) * [-2149.210] (-2153.858) (-2160.338) (-2152.321) -- 0:02:53
75000 -- (-2152.852) [-2155.462] (-2152.495) (-2151.122) * [-2153.662] (-2148.855) (-2149.934) (-2158.638) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
75500 -- (-2149.975) (-2155.038) (-2155.157) [-2153.544] * (-2149.536) (-2154.262) [-2150.716] (-2152.246) -- 0:02:51
76000 -- (-2150.034) (-2165.726) (-2154.265) [-2148.896] * (-2151.544) [-2151.929] (-2149.064) (-2155.490) -- 0:02:50
76500 -- (-2151.622) (-2155.902) [-2150.585] (-2152.714) * (-2151.854) (-2148.281) (-2151.530) [-2151.063] -- 0:02:49
77000 -- (-2151.612) [-2157.733] (-2155.776) (-2149.487) * (-2156.103) (-2152.173) [-2150.429] (-2158.823) -- 0:02:47
77500 -- (-2151.442) [-2150.335] (-2155.298) (-2152.841) * (-2155.984) (-2150.983) [-2156.947] (-2153.104) -- 0:02:46
78000 -- (-2150.972) (-2156.856) (-2153.327) [-2156.047] * [-2156.544] (-2158.671) (-2150.542) (-2154.928) -- 0:02:57
78500 -- (-2148.448) [-2156.435] (-2147.888) (-2158.806) * (-2161.112) (-2158.655) [-2149.067] (-2154.517) -- 0:02:56
79000 -- (-2156.484) [-2152.348] (-2157.636) (-2156.585) * (-2150.839) (-2156.924) [-2151.648] (-2158.631) -- 0:02:54
79500 -- (-2154.010) (-2156.481) (-2149.539) [-2151.121] * (-2149.511) [-2148.341] (-2154.810) (-2154.380) -- 0:02:53
80000 -- [-2150.024] (-2160.430) (-2150.867) (-2160.780) * [-2151.429] (-2155.970) (-2155.057) (-2156.520) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
80500 -- [-2152.638] (-2160.721) (-2158.405) (-2151.774) * (-2148.736) (-2156.851) (-2155.080) [-2152.725] -- 0:02:51
81000 -- (-2155.758) (-2152.724) [-2151.761] (-2156.116) * (-2159.470) (-2156.122) [-2155.581] (-2152.487) -- 0:02:50
81500 -- (-2154.266) (-2149.242) (-2148.213) [-2149.484] * (-2151.694) [-2156.457] (-2153.597) (-2156.010) -- 0:02:49
82000 -- (-2156.466) [-2153.277] (-2150.342) (-2153.144) * [-2152.913] (-2155.452) (-2153.436) (-2148.572) -- 0:02:47
82500 -- (-2152.893) [-2154.729] (-2151.647) (-2153.822) * (-2149.004) [-2152.740] (-2154.571) (-2151.148) -- 0:02:46
83000 -- (-2151.363) (-2152.621) (-2150.853) [-2150.228] * (-2152.830) (-2153.474) (-2156.428) [-2147.826] -- 0:02:56
83500 -- (-2163.175) (-2153.034) (-2153.480) [-2148.300] * [-2152.582] (-2154.166) (-2158.746) (-2155.459) -- 0:02:55
84000 -- (-2159.772) [-2150.727] (-2157.368) (-2149.474) * [-2152.868] (-2153.610) (-2154.409) (-2157.714) -- 0:02:54
84500 -- [-2146.841] (-2154.595) (-2156.138) (-2156.952) * (-2159.648) (-2159.241) [-2151.254] (-2151.678) -- 0:02:53
85000 -- (-2150.244) (-2154.081) (-2153.971) [-2151.146] * [-2150.045] (-2156.593) (-2156.356) (-2159.641) -- 0:02:52
Average standard deviation of split frequencies: 0.000000
85500 -- (-2153.331) [-2150.383] (-2155.414) (-2155.932) * [-2151.981] (-2154.521) (-2153.520) (-2155.774) -- 0:02:51
86000 -- [-2155.805] (-2149.621) (-2152.784) (-2154.775) * [-2154.583] (-2152.685) (-2153.865) (-2154.719) -- 0:02:50
86500 -- (-2151.587) (-2148.542) (-2149.704) [-2152.408] * [-2152.477] (-2153.568) (-2152.002) (-2157.770) -- 0:02:48
87000 -- (-2154.712) [-2154.566] (-2155.486) (-2158.611) * [-2155.463] (-2155.666) (-2152.094) (-2149.849) -- 0:02:47
87500 -- [-2151.330] (-2148.239) (-2152.954) (-2156.358) * (-2154.659) (-2158.803) (-2153.940) [-2149.919] -- 0:02:46
88000 -- (-2159.086) [-2150.692] (-2153.789) (-2153.856) * (-2149.259) (-2147.409) (-2155.970) [-2158.731] -- 0:02:45
88500 -- (-2157.922) (-2157.749) [-2153.325] (-2157.894) * (-2147.809) (-2148.062) [-2152.332] (-2151.198) -- 0:02:55
89000 -- [-2151.949] (-2155.722) (-2156.208) (-2154.978) * [-2150.704] (-2151.404) (-2153.962) (-2150.371) -- 0:02:54
89500 -- (-2160.428) (-2152.370) (-2160.753) [-2147.276] * (-2156.103) (-2155.061) [-2153.058] (-2157.797) -- 0:02:52
90000 -- (-2165.511) (-2160.931) [-2155.490] (-2156.915) * [-2149.652] (-2152.322) (-2154.777) (-2151.727) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
90500 -- (-2152.186) [-2149.880] (-2153.214) (-2155.285) * (-2148.745) (-2158.160) (-2151.805) [-2147.474] -- 0:02:50
91000 -- [-2155.545] (-2154.374) (-2156.662) (-2154.610) * [-2151.620] (-2166.160) (-2157.427) (-2153.840) -- 0:02:49
91500 -- [-2147.829] (-2154.041) (-2151.605) (-2147.942) * (-2155.463) [-2149.383] (-2156.104) (-2148.498) -- 0:02:48
92000 -- (-2152.468) (-2150.555) [-2154.164] (-2148.707) * (-2149.610) (-2154.502) [-2149.855] (-2150.024) -- 0:02:47
92500 -- (-2149.328) [-2148.871] (-2157.334) (-2152.238) * (-2159.712) [-2151.787] (-2149.612) (-2150.952) -- 0:02:46
93000 -- (-2157.407) (-2163.740) (-2151.546) [-2153.625] * (-2166.789) (-2151.338) [-2156.467] (-2153.240) -- 0:02:45
93500 -- (-2152.208) [-2148.621] (-2151.581) (-2151.147) * (-2159.124) (-2152.875) [-2151.340] (-2150.424) -- 0:02:44
94000 -- (-2152.174) [-2148.436] (-2156.083) (-2162.790) * (-2154.596) [-2153.233] (-2153.838) (-2154.033) -- 0:02:53
94500 -- (-2156.258) (-2148.697) [-2152.271] (-2156.635) * (-2153.814) [-2150.710] (-2149.328) (-2156.529) -- 0:02:52
95000 -- (-2158.325) (-2154.972) (-2159.637) [-2154.648] * [-2155.056] (-2149.223) (-2151.071) (-2155.052) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
95500 -- (-2161.048) (-2147.639) (-2146.884) [-2152.704] * (-2151.475) (-2150.775) [-2148.332] (-2151.912) -- 0:02:50
96000 -- (-2158.100) (-2161.319) [-2154.435] (-2149.925) * [-2148.944] (-2150.192) (-2148.574) (-2153.262) -- 0:02:49
96500 -- (-2155.762) (-2152.609) (-2156.713) [-2152.944] * (-2150.479) (-2152.295) [-2147.534] (-2149.062) -- 0:02:48
97000 -- (-2160.850) (-2154.521) (-2154.979) [-2152.052] * [-2153.464] (-2149.015) (-2149.062) (-2156.410) -- 0:02:47
97500 -- (-2156.696) (-2162.158) (-2153.012) [-2151.838] * (-2153.406) [-2154.603] (-2155.513) (-2158.232) -- 0:02:46
98000 -- (-2156.145) [-2152.245] (-2149.404) (-2150.911) * (-2148.756) (-2152.062) [-2151.881] (-2153.882) -- 0:02:45
98500 -- (-2151.010) [-2156.103] (-2150.739) (-2154.342) * (-2151.560) (-2154.589) [-2149.986] (-2151.620) -- 0:02:44
99000 -- (-2152.600) (-2150.149) [-2154.154] (-2148.632) * (-2160.441) (-2154.138) [-2152.421] (-2159.720) -- 0:02:43
99500 -- (-2150.713) (-2161.013) [-2157.829] (-2158.008) * [-2150.255] (-2158.671) (-2154.425) (-2155.494) -- 0:02:51
100000 -- (-2153.344) (-2155.299) [-2154.290] (-2162.425) * (-2160.263) (-2159.310) [-2148.262] (-2151.712) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
100500 -- (-2154.314) [-2151.738] (-2150.691) (-2155.280) * [-2152.045] (-2158.635) (-2151.685) (-2153.245) -- 0:02:50
101000 -- (-2165.094) [-2149.388] (-2148.400) (-2156.546) * (-2158.955) (-2156.327) (-2162.760) [-2152.763] -- 0:02:49
101500 -- (-2164.646) (-2151.067) (-2156.008) [-2152.858] * (-2153.614) (-2150.814) (-2155.678) [-2154.961] -- 0:02:48
102000 -- [-2154.792] (-2155.459) (-2152.756) (-2153.052) * (-2157.102) (-2152.803) [-2151.541] (-2157.734) -- 0:02:47
102500 -- [-2154.227] (-2157.567) (-2156.419) (-2152.627) * (-2159.174) (-2158.812) [-2151.619] (-2154.228) -- 0:02:46
103000 -- (-2155.339) (-2157.405) (-2151.874) [-2154.100] * (-2150.148) (-2157.932) [-2149.713] (-2154.710) -- 0:02:45
103500 -- [-2150.106] (-2161.088) (-2154.541) (-2152.262) * (-2162.249) (-2151.843) [-2152.798] (-2152.516) -- 0:02:44
104000 -- [-2152.424] (-2148.149) (-2154.898) (-2151.465) * (-2166.310) [-2151.093] (-2163.647) (-2151.636) -- 0:02:43
104500 -- (-2155.161) [-2148.326] (-2154.982) (-2155.114) * (-2158.224) (-2150.747) [-2150.404] (-2149.612) -- 0:02:42
105000 -- (-2155.303) [-2151.990] (-2155.655) (-2158.238) * (-2147.925) (-2158.154) (-2155.959) [-2146.411] -- 0:02:50
Average standard deviation of split frequencies: 0.000000
105500 -- (-2151.748) [-2148.958] (-2151.406) (-2159.650) * (-2150.117) (-2152.838) (-2153.303) [-2152.700] -- 0:02:49
106000 -- (-2153.927) (-2150.658) [-2154.261] (-2147.242) * (-2152.122) [-2151.938] (-2154.803) (-2148.096) -- 0:02:48
106500 -- (-2149.099) [-2151.894] (-2154.511) (-2155.885) * (-2149.359) (-2153.815) (-2157.645) [-2151.343] -- 0:02:47
107000 -- (-2149.229) [-2147.923] (-2150.580) (-2153.554) * (-2151.044) (-2150.369) (-2155.629) [-2148.574] -- 0:02:46
107500 -- [-2151.729] (-2148.355) (-2155.991) (-2154.654) * [-2150.006] (-2156.694) (-2147.359) (-2151.423) -- 0:02:46
108000 -- (-2160.440) (-2150.756) (-2155.981) [-2152.748] * [-2163.452] (-2155.789) (-2151.319) (-2153.015) -- 0:02:45
108500 -- (-2157.863) (-2156.529) (-2152.917) [-2150.066] * [-2153.143] (-2152.641) (-2152.580) (-2149.868) -- 0:02:44
109000 -- (-2153.110) [-2154.557] (-2155.922) (-2148.442) * (-2152.500) [-2154.856] (-2156.016) (-2152.043) -- 0:02:43
109500 -- (-2154.232) [-2151.014] (-2153.209) (-2154.784) * (-2149.645) (-2149.865) (-2150.661) [-2151.331] -- 0:02:42
110000 -- (-2156.920) [-2152.663] (-2150.577) (-2153.203) * (-2156.017) (-2154.144) [-2150.897] (-2155.076) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
110500 -- [-2157.510] (-2148.465) (-2159.775) (-2152.246) * (-2155.596) (-2154.934) (-2150.017) [-2147.482] -- 0:02:49
111000 -- (-2158.679) [-2147.594] (-2153.639) (-2147.691) * [-2156.600] (-2152.981) (-2156.230) (-2154.427) -- 0:02:48
111500 -- [-2156.814] (-2152.275) (-2155.846) (-2154.628) * (-2154.812) [-2158.244] (-2153.874) (-2153.967) -- 0:02:47
112000 -- (-2154.374) [-2147.504] (-2148.566) (-2149.409) * (-2154.479) (-2150.423) (-2154.796) [-2147.983] -- 0:02:46
112500 -- (-2155.162) (-2154.385) (-2149.263) [-2145.742] * [-2151.748] (-2154.686) (-2156.705) (-2152.519) -- 0:02:45
113000 -- (-2157.199) (-2152.383) (-2154.802) [-2152.532] * (-2151.179) [-2148.150] (-2160.349) (-2151.542) -- 0:02:44
113500 -- (-2152.886) (-2152.592) [-2149.459] (-2153.104) * (-2152.886) [-2146.560] (-2161.620) (-2147.311) -- 0:02:44
114000 -- (-2154.552) (-2153.002) [-2150.147] (-2154.794) * (-2150.787) (-2150.787) (-2162.511) [-2148.933] -- 0:02:43
114500 -- (-2149.108) [-2148.961] (-2157.766) (-2157.526) * (-2153.530) (-2151.440) (-2158.956) [-2152.301] -- 0:02:42
115000 -- (-2153.969) (-2158.977) [-2163.123] (-2151.710) * (-2153.508) [-2149.252] (-2151.043) (-2150.069) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
115500 -- (-2149.292) (-2148.851) (-2151.453) [-2154.017] * (-2149.879) (-2150.824) [-2154.557] (-2149.622) -- 0:02:40
116000 -- [-2147.666] (-2152.810) (-2153.297) (-2157.414) * [-2153.784] (-2150.919) (-2152.998) (-2152.840) -- 0:02:47
116500 -- (-2149.671) [-2152.989] (-2160.436) (-2153.986) * (-2161.272) (-2153.589) (-2158.567) [-2147.579] -- 0:02:46
117000 -- [-2151.128] (-2157.769) (-2159.485) (-2157.520) * (-2152.246) [-2157.859] (-2154.144) (-2151.803) -- 0:02:46
117500 -- [-2152.074] (-2151.477) (-2163.548) (-2155.169) * (-2153.454) (-2156.160) [-2152.539] (-2154.594) -- 0:02:45
118000 -- (-2152.551) (-2150.146) [-2150.580] (-2158.357) * (-2155.295) (-2152.500) (-2157.142) [-2152.488] -- 0:02:44
118500 -- (-2153.451) (-2155.271) [-2156.164] (-2156.731) * (-2158.294) (-2153.822) [-2156.313] (-2151.559) -- 0:02:43
119000 -- (-2155.032) [-2152.088] (-2153.217) (-2151.379) * (-2155.344) (-2170.931) [-2149.755] (-2157.990) -- 0:02:42
119500 -- (-2161.049) [-2155.935] (-2153.526) (-2152.203) * (-2157.540) (-2153.579) [-2151.635] (-2159.457) -- 0:02:42
120000 -- (-2154.881) (-2152.861) (-2158.441) [-2152.521] * (-2151.784) (-2161.069) (-2152.979) [-2151.089] -- 0:02:41
Average standard deviation of split frequencies: 0.000000
120500 -- [-2149.306] (-2150.933) (-2152.695) (-2151.457) * (-2153.255) (-2155.482) (-2160.291) [-2155.869] -- 0:02:40
121000 -- (-2155.704) (-2151.269) [-2154.635] (-2158.505) * [-2148.401] (-2157.372) (-2161.973) (-2156.547) -- 0:02:39
121500 -- (-2155.538) [-2150.001] (-2157.899) (-2152.404) * [-2152.450] (-2165.402) (-2156.725) (-2150.212) -- 0:02:46
122000 -- [-2152.186] (-2151.863) (-2150.518) (-2154.481) * (-2152.740) (-2150.888) [-2154.246] (-2150.424) -- 0:02:45
122500 -- [-2149.325] (-2149.978) (-2149.931) (-2157.826) * (-2156.361) [-2151.895] (-2151.395) (-2156.114) -- 0:02:44
123000 -- (-2151.628) (-2152.930) [-2153.517] (-2157.846) * (-2153.523) (-2154.790) [-2150.281] (-2153.741) -- 0:02:43
123500 -- (-2147.577) (-2158.023) [-2156.124] (-2150.170) * [-2154.829] (-2150.960) (-2156.341) (-2151.416) -- 0:02:43
124000 -- (-2153.228) (-2155.693) [-2154.238] (-2152.473) * [-2149.705] (-2153.058) (-2157.932) (-2157.919) -- 0:02:42
124500 -- (-2148.940) (-2155.971) (-2153.421) [-2156.962] * [-2151.251] (-2155.201) (-2160.660) (-2154.397) -- 0:02:41
125000 -- (-2149.026) [-2155.974] (-2154.415) (-2154.652) * (-2151.768) (-2150.328) [-2149.756] (-2148.419) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
125500 -- (-2152.445) (-2150.610) (-2155.418) [-2152.241] * (-2153.907) [-2149.931] (-2149.606) (-2149.112) -- 0:02:40
126000 -- [-2150.195] (-2161.945) (-2154.659) (-2156.514) * (-2152.571) (-2155.895) [-2147.765] (-2151.427) -- 0:02:39
126500 -- (-2156.843) [-2151.674] (-2153.690) (-2150.906) * (-2152.430) (-2155.582) (-2157.756) [-2150.747] -- 0:02:45
127000 -- (-2153.735) [-2154.416] (-2148.806) (-2150.177) * (-2150.009) (-2153.596) [-2148.126] (-2160.319) -- 0:02:44
127500 -- (-2152.625) (-2154.523) [-2150.646] (-2155.970) * [-2150.687] (-2155.006) (-2158.049) (-2149.800) -- 0:02:44
128000 -- [-2152.218] (-2153.224) (-2147.300) (-2157.007) * (-2156.481) (-2157.996) [-2151.802] (-2158.244) -- 0:02:43
128500 -- (-2157.756) (-2155.254) (-2150.135) [-2153.124] * (-2161.035) (-2161.944) [-2152.002] (-2152.664) -- 0:02:42
129000 -- (-2156.755) (-2153.780) [-2150.134] (-2157.744) * (-2156.993) [-2158.196] (-2155.187) (-2154.791) -- 0:02:42
129500 -- (-2160.294) (-2158.837) (-2150.068) [-2159.633] * (-2157.583) (-2153.939) (-2150.948) [-2155.776] -- 0:02:41
130000 -- (-2155.965) (-2156.805) [-2152.228] (-2151.102) * [-2151.855] (-2157.124) (-2155.323) (-2155.108) -- 0:02:40
Average standard deviation of split frequencies: 0.001804
130500 -- (-2154.388) (-2159.768) (-2152.375) [-2153.194] * (-2148.919) [-2149.319] (-2151.631) (-2155.731) -- 0:02:39
131000 -- (-2153.025) (-2156.957) (-2152.465) [-2151.892] * [-2155.633] (-2148.602) (-2152.160) (-2157.222) -- 0:02:39
131500 -- [-2154.068] (-2156.000) (-2154.736) (-2153.452) * [-2160.706] (-2151.647) (-2158.066) (-2158.206) -- 0:02:38
132000 -- (-2152.865) (-2151.321) [-2156.853] (-2153.851) * (-2155.467) (-2157.648) (-2152.537) [-2150.338] -- 0:02:44
132500 -- [-2150.945] (-2153.313) (-2152.518) (-2148.977) * (-2153.133) (-2151.083) [-2154.414] (-2155.178) -- 0:02:43
133000 -- (-2151.315) (-2153.363) (-2150.388) [-2152.808] * (-2148.342) (-2162.752) [-2150.613] (-2151.933) -- 0:02:42
133500 -- [-2159.120] (-2151.196) (-2151.152) (-2166.437) * (-2155.213) (-2158.342) [-2154.968] (-2149.782) -- 0:02:42
134000 -- (-2153.450) (-2153.752) [-2154.723] (-2157.278) * [-2155.231] (-2156.569) (-2151.299) (-2151.276) -- 0:02:41
134500 -- [-2153.420] (-2153.793) (-2153.596) (-2154.798) * (-2155.649) (-2152.620) (-2154.281) [-2155.954] -- 0:02:40
135000 -- (-2149.421) (-2154.344) [-2155.741] (-2149.378) * (-2154.011) (-2155.158) (-2148.536) [-2148.582] -- 0:02:40
Average standard deviation of split frequencies: 0.001733
135500 -- (-2151.418) (-2159.357) [-2148.760] (-2156.163) * (-2153.045) (-2154.500) [-2155.584] (-2151.526) -- 0:02:39
136000 -- (-2162.872) (-2158.863) [-2152.018] (-2151.741) * (-2154.781) (-2156.904) [-2154.481] (-2150.982) -- 0:02:38
136500 -- (-2157.538) [-2147.967] (-2150.061) (-2151.847) * (-2157.814) (-2153.560) [-2153.356] (-2152.989) -- 0:02:38
137000 -- (-2148.617) (-2149.197) [-2149.855] (-2150.465) * (-2159.348) (-2157.147) (-2150.097) [-2149.871] -- 0:02:37
137500 -- (-2153.541) [-2150.473] (-2147.282) (-2158.775) * (-2169.278) [-2150.314] (-2159.477) (-2155.321) -- 0:02:43
138000 -- (-2153.056) (-2154.806) [-2148.193] (-2150.427) * [-2152.351] (-2151.400) (-2155.018) (-2152.857) -- 0:02:42
138500 -- (-2153.440) [-2152.027] (-2153.071) (-2154.356) * (-2152.618) (-2151.484) [-2152.144] (-2157.072) -- 0:02:41
139000 -- (-2155.228) (-2152.668) (-2153.169) [-2149.648] * (-2150.689) (-2154.385) [-2158.485] (-2147.136) -- 0:02:41
139500 -- (-2156.353) (-2157.483) [-2153.241] (-2155.481) * [-2152.371] (-2154.455) (-2165.295) (-2153.632) -- 0:02:40
140000 -- (-2149.921) (-2155.135) [-2150.214] (-2151.761) * (-2152.367) [-2150.500] (-2153.447) (-2158.880) -- 0:02:39
Average standard deviation of split frequencies: 0.001676
140500 -- (-2157.320) (-2148.440) (-2158.002) [-2153.846] * (-2153.337) [-2150.602] (-2155.780) (-2156.628) -- 0:02:39
141000 -- (-2161.367) (-2151.921) [-2150.602] (-2155.356) * (-2158.348) [-2153.429] (-2155.512) (-2153.783) -- 0:02:38
141500 -- (-2154.566) (-2158.411) (-2149.652) [-2154.660] * (-2151.182) (-2154.790) [-2152.244] (-2157.734) -- 0:02:37
142000 -- (-2154.378) (-2155.667) (-2150.546) [-2153.029] * [-2151.093] (-2154.499) (-2154.904) (-2156.004) -- 0:02:37
142500 -- [-2156.291] (-2160.479) (-2154.767) (-2152.344) * (-2149.105) (-2153.933) [-2156.110] (-2148.549) -- 0:02:36
143000 -- (-2158.621) [-2155.145] (-2151.268) (-2160.875) * (-2146.040) [-2150.217] (-2151.786) (-2152.608) -- 0:02:41
143500 -- (-2158.914) (-2152.067) [-2159.015] (-2156.621) * [-2150.124] (-2152.418) (-2148.613) (-2151.217) -- 0:02:41
144000 -- (-2152.741) (-2152.314) (-2161.476) [-2152.051] * (-2152.023) (-2159.647) (-2151.132) [-2153.255] -- 0:02:40
144500 -- [-2149.298] (-2151.891) (-2154.113) (-2149.216) * (-2151.722) (-2150.992) [-2151.489] (-2153.378) -- 0:02:39
145000 -- (-2150.179) [-2150.203] (-2158.784) (-2155.617) * (-2157.294) (-2152.542) (-2154.401) [-2155.142] -- 0:02:39
Average standard deviation of split frequencies: 0.001614
145500 -- [-2149.916] (-2151.855) (-2152.696) (-2153.873) * (-2157.114) [-2147.896] (-2149.994) (-2156.363) -- 0:02:38
146000 -- (-2150.150) (-2152.625) (-2150.269) [-2150.680] * [-2150.646] (-2156.798) (-2148.050) (-2154.076) -- 0:02:37
146500 -- [-2157.385] (-2151.576) (-2153.727) (-2155.142) * (-2157.916) [-2149.239] (-2149.339) (-2154.026) -- 0:02:37
147000 -- [-2148.434] (-2159.806) (-2153.003) (-2158.437) * (-2156.359) [-2151.560] (-2156.587) (-2149.815) -- 0:02:36
147500 -- (-2153.522) (-2156.405) (-2153.767) [-2147.857] * [-2156.042] (-2151.815) (-2163.066) (-2152.729) -- 0:02:36
148000 -- (-2153.832) (-2149.256) [-2151.457] (-2163.005) * (-2157.088) (-2150.524) [-2164.154] (-2157.527) -- 0:02:35
148500 -- (-2163.064) (-2146.738) [-2148.841] (-2155.531) * (-2158.958) (-2151.112) [-2154.547] (-2154.218) -- 0:02:40
149000 -- (-2155.477) (-2150.394) [-2148.265] (-2150.987) * (-2155.354) (-2154.566) (-2151.831) [-2157.809] -- 0:02:39
149500 -- (-2154.939) [-2150.386] (-2154.189) (-2154.509) * (-2145.753) (-2156.731) (-2151.636) [-2152.930] -- 0:02:39
150000 -- [-2155.733] (-2150.390) (-2151.481) (-2149.120) * (-2150.050) (-2151.874) [-2149.123] (-2155.802) -- 0:02:38
Average standard deviation of split frequencies: 0.001564
150500 -- (-2154.613) (-2152.821) [-2152.614] (-2156.989) * (-2150.202) [-2154.342] (-2150.577) (-2150.704) -- 0:02:38
151000 -- (-2151.909) (-2154.257) (-2156.043) [-2148.801] * (-2152.094) (-2161.781) (-2150.917) [-2148.864] -- 0:02:37
151500 -- (-2159.827) (-2150.808) [-2150.620] (-2156.580) * (-2152.943) [-2158.115] (-2154.962) (-2150.510) -- 0:02:36
152000 -- (-2158.279) (-2148.490) [-2148.719] (-2158.522) * (-2153.301) [-2155.742] (-2155.568) (-2150.194) -- 0:02:36
152500 -- [-2154.545] (-2153.975) (-2157.383) (-2156.235) * [-2151.785] (-2154.841) (-2160.825) (-2153.579) -- 0:02:35
153000 -- (-2152.271) (-2154.699) [-2153.418] (-2153.806) * [-2155.334] (-2152.037) (-2156.768) (-2157.891) -- 0:02:35
153500 -- [-2148.035] (-2153.970) (-2155.833) (-2159.840) * (-2155.002) [-2150.434] (-2154.159) (-2151.628) -- 0:02:34
154000 -- [-2153.979] (-2153.953) (-2156.714) (-2158.461) * (-2152.403) [-2152.378] (-2156.719) (-2149.425) -- 0:02:39
154500 -- (-2149.831) [-2151.084] (-2159.042) (-2150.995) * (-2148.671) (-2151.676) (-2152.136) [-2156.679] -- 0:02:38
155000 -- (-2155.363) (-2164.209) [-2149.470] (-2153.424) * (-2150.822) (-2153.424) [-2149.893] (-2152.117) -- 0:02:38
Average standard deviation of split frequencies: 0.001511
155500 -- (-2151.134) (-2153.046) (-2149.048) [-2154.540] * (-2152.207) [-2150.590] (-2151.427) (-2151.403) -- 0:02:37
156000 -- (-2149.989) (-2158.329) [-2151.666] (-2151.075) * (-2149.434) [-2154.336] (-2151.818) (-2157.097) -- 0:02:36
156500 -- (-2151.780) (-2151.986) (-2150.625) [-2153.728] * (-2154.443) (-2149.531) (-2161.312) [-2151.862] -- 0:02:36
157000 -- (-2153.260) (-2152.306) [-2149.220] (-2157.605) * (-2159.808) (-2156.062) (-2157.926) [-2152.044] -- 0:02:35
157500 -- (-2158.876) (-2150.997) [-2148.889] (-2154.415) * [-2160.659] (-2149.714) (-2159.461) (-2150.102) -- 0:02:35
158000 -- (-2155.497) [-2156.807] (-2149.015) (-2152.218) * (-2151.404) [-2155.773] (-2159.224) (-2150.831) -- 0:02:34
158500 -- [-2150.803] (-2151.063) (-2151.950) (-2153.437) * [-2149.859] (-2154.579) (-2155.302) (-2148.626) -- 0:02:33
159000 -- (-2157.201) (-2157.040) (-2155.621) [-2158.038] * (-2153.973) (-2154.769) [-2149.736] (-2154.698) -- 0:02:33
159500 -- (-2156.914) [-2152.470] (-2157.764) (-2154.744) * (-2164.369) [-2158.806] (-2154.198) (-2155.769) -- 0:02:38
160000 -- (-2154.953) (-2152.196) [-2155.859] (-2152.550) * (-2163.970) [-2148.895] (-2150.916) (-2152.979) -- 0:02:37
Average standard deviation of split frequencies: 0.001467
160500 -- (-2153.383) [-2148.112] (-2156.717) (-2155.056) * (-2161.305) (-2153.208) (-2148.712) [-2151.517] -- 0:02:36
161000 -- (-2153.244) (-2148.912) (-2158.957) [-2161.972] * (-2149.800) (-2149.813) (-2154.753) [-2150.232] -- 0:02:36
161500 -- (-2154.994) (-2154.046) (-2157.028) [-2158.566] * (-2161.442) (-2154.018) (-2153.627) [-2152.656] -- 0:02:35
162000 -- (-2154.191) [-2154.203] (-2154.526) (-2152.936) * [-2156.883] (-2156.389) (-2154.238) (-2153.601) -- 0:02:35
162500 -- (-2155.857) (-2151.422) [-2155.687] (-2148.879) * (-2155.876) (-2150.884) [-2150.753] (-2152.197) -- 0:02:34
163000 -- (-2155.983) (-2152.629) [-2156.674] (-2150.139) * [-2153.497] (-2154.078) (-2153.063) (-2149.735) -- 0:02:34
163500 -- (-2156.506) [-2151.861] (-2149.692) (-2151.888) * [-2153.202] (-2151.691) (-2150.577) (-2147.876) -- 0:02:33
164000 -- [-2152.910] (-2149.572) (-2151.762) (-2150.745) * (-2157.067) (-2152.965) (-2157.136) [-2159.279] -- 0:02:32
164500 -- (-2153.107) (-2147.226) (-2150.245) [-2153.452] * (-2159.823) [-2154.123] (-2157.836) (-2157.279) -- 0:02:37
165000 -- (-2154.483) [-2150.734] (-2154.405) (-2150.037) * (-2154.145) (-2146.864) [-2152.292] (-2150.432) -- 0:02:36
Average standard deviation of split frequencies: 0.001420
165500 -- (-2152.547) (-2149.352) (-2149.666) [-2151.675] * (-2155.291) (-2149.176) [-2154.211] (-2156.084) -- 0:02:36
166000 -- (-2149.362) (-2155.741) (-2150.586) [-2151.338] * (-2154.163) [-2148.548] (-2153.292) (-2149.509) -- 0:02:35
166500 -- [-2147.305] (-2152.244) (-2155.262) (-2151.467) * (-2149.073) [-2154.080] (-2152.657) (-2151.778) -- 0:02:35
167000 -- [-2151.434] (-2152.454) (-2154.166) (-2149.012) * (-2149.463) [-2150.325] (-2155.539) (-2152.729) -- 0:02:34
167500 -- [-2152.458] (-2152.497) (-2153.603) (-2150.133) * (-2148.207) (-2151.964) [-2147.406] (-2156.836) -- 0:02:34
168000 -- (-2151.559) (-2152.202) [-2153.431] (-2152.669) * [-2148.354] (-2151.398) (-2150.702) (-2153.959) -- 0:02:33
168500 -- [-2154.195] (-2158.656) (-2147.662) (-2153.019) * (-2156.602) [-2148.902] (-2148.753) (-2158.516) -- 0:02:32
169000 -- (-2155.811) [-2154.087] (-2159.123) (-2155.644) * (-2153.282) (-2148.703) [-2146.363] (-2158.918) -- 0:02:32
169500 -- (-2153.362) (-2156.166) (-2154.254) [-2151.003] * [-2149.046] (-2147.335) (-2152.062) (-2166.673) -- 0:02:31
170000 -- (-2152.977) (-2154.446) (-2150.714) [-2159.780] * (-2149.629) (-2164.680) [-2150.525] (-2159.672) -- 0:02:36
Average standard deviation of split frequencies: 0.001381
170500 -- (-2152.282) (-2152.481) (-2152.450) [-2151.756] * (-2152.717) [-2147.523] (-2149.288) (-2158.414) -- 0:02:35
171000 -- (-2150.039) (-2151.891) (-2151.777) [-2152.413] * (-2151.054) [-2152.828] (-2145.775) (-2151.616) -- 0:02:35
171500 -- (-2156.338) [-2149.203] (-2151.298) (-2153.081) * [-2153.710] (-2153.703) (-2151.008) (-2152.259) -- 0:02:34
172000 -- [-2151.565] (-2153.148) (-2156.354) (-2150.542) * (-2159.199) [-2154.334] (-2155.641) (-2149.451) -- 0:02:34
172500 -- [-2150.946] (-2154.614) (-2150.846) (-2154.926) * [-2151.836] (-2154.946) (-2155.113) (-2149.828) -- 0:02:33
173000 -- [-2152.152] (-2153.503) (-2153.120) (-2154.834) * (-2152.307) (-2151.737) (-2156.204) [-2157.500] -- 0:02:32
173500 -- (-2152.080) (-2148.791) (-2150.337) [-2154.771] * (-2149.879) (-2150.161) (-2153.377) [-2152.360] -- 0:02:32
174000 -- (-2157.880) [-2149.582] (-2150.489) (-2151.251) * (-2151.278) [-2149.300] (-2159.178) (-2152.732) -- 0:02:31
174500 -- (-2155.726) (-2156.422) (-2153.596) [-2156.057] * (-2153.831) [-2154.271] (-2157.977) (-2157.430) -- 0:02:31
175000 -- [-2147.748] (-2158.198) (-2152.903) (-2149.163) * (-2148.603) (-2148.543) (-2149.164) [-2150.927] -- 0:02:30
Average standard deviation of split frequencies: 0.001339
175500 -- (-2146.920) (-2160.070) (-2149.431) [-2149.853] * [-2149.607] (-2150.466) (-2149.633) (-2152.499) -- 0:02:35
176000 -- [-2148.727] (-2161.480) (-2154.345) (-2154.269) * (-2153.281) (-2147.861) (-2153.429) [-2154.113] -- 0:02:34
176500 -- (-2152.789) (-2153.088) [-2149.969] (-2150.596) * (-2154.284) (-2156.326) (-2162.226) [-2153.380] -- 0:02:33
177000 -- (-2152.448) (-2158.734) (-2156.735) [-2153.748] * [-2158.440] (-2156.450) (-2158.653) (-2158.156) -- 0:02:33
177500 -- [-2157.343] (-2153.531) (-2157.483) (-2149.955) * (-2155.998) (-2151.242) (-2153.091) [-2155.098] -- 0:02:32
178000 -- (-2150.254) (-2157.985) [-2153.803] (-2160.608) * (-2153.819) (-2152.416) [-2150.116] (-2155.625) -- 0:02:32
178500 -- [-2149.866] (-2157.684) (-2153.706) (-2152.863) * (-2149.769) (-2153.503) (-2152.866) [-2157.108] -- 0:02:31
179000 -- [-2153.985] (-2148.484) (-2154.601) (-2151.390) * (-2158.080) (-2149.718) (-2153.805) [-2154.466] -- 0:02:31
179500 -- (-2153.560) (-2150.460) [-2153.326] (-2158.122) * (-2150.986) (-2159.689) [-2150.736] (-2151.446) -- 0:02:30
180000 -- (-2148.327) (-2152.801) (-2157.102) [-2157.824] * [-2151.244] (-2155.026) (-2155.043) (-2148.307) -- 0:02:30
Average standard deviation of split frequencies: 0.001305
180500 -- [-2148.613] (-2157.845) (-2155.989) (-2156.545) * [-2150.394] (-2151.622) (-2154.115) (-2149.606) -- 0:02:29
181000 -- (-2148.493) (-2150.910) [-2155.526] (-2165.937) * (-2149.355) (-2154.165) (-2153.650) [-2157.472] -- 0:02:33
181500 -- (-2152.821) [-2152.371] (-2161.225) (-2152.542) * (-2156.563) (-2160.920) [-2150.552] (-2151.971) -- 0:02:33
182000 -- (-2152.386) (-2153.179) (-2153.090) [-2154.164] * (-2151.096) (-2158.739) (-2149.582) [-2153.054] -- 0:02:32
182500 -- (-2152.037) (-2153.499) [-2156.112] (-2157.529) * (-2155.926) [-2150.758] (-2152.919) (-2153.772) -- 0:02:32
183000 -- (-2150.108) (-2149.980) (-2152.659) [-2150.161] * (-2152.060) [-2148.278] (-2148.717) (-2152.366) -- 0:02:31
183500 -- (-2155.888) (-2153.882) (-2151.689) [-2155.359] * (-2150.511) [-2151.507] (-2148.732) (-2158.377) -- 0:02:31
184000 -- (-2152.278) (-2148.497) (-2154.713) [-2156.645] * [-2149.378] (-2154.812) (-2150.857) (-2156.804) -- 0:02:30
184500 -- (-2157.076) [-2156.102] (-2153.010) (-2151.523) * [-2151.332] (-2152.582) (-2150.651) (-2162.421) -- 0:02:30
185000 -- [-2151.830] (-2153.495) (-2153.660) (-2157.482) * (-2149.512) [-2148.324] (-2149.345) (-2159.204) -- 0:02:29
Average standard deviation of split frequencies: 0.001267
185500 -- (-2154.041) (-2158.780) [-2152.336] (-2153.569) * [-2151.758] (-2155.631) (-2152.111) (-2153.025) -- 0:02:29
186000 -- [-2155.893] (-2149.934) (-2155.874) (-2155.350) * (-2149.085) (-2154.331) [-2149.162] (-2150.354) -- 0:02:28
186500 -- [-2152.227] (-2153.665) (-2156.504) (-2152.761) * (-2153.986) (-2153.979) (-2164.245) [-2145.966] -- 0:02:32
187000 -- (-2148.667) [-2156.466] (-2162.779) (-2151.478) * (-2150.836) [-2158.089] (-2157.511) (-2151.202) -- 0:02:32
187500 -- [-2147.568] (-2155.511) (-2160.194) (-2160.850) * [-2152.223] (-2150.238) (-2156.455) (-2150.394) -- 0:02:31
188000 -- (-2152.220) [-2150.169] (-2156.394) (-2149.930) * [-2150.050] (-2155.339) (-2153.538) (-2170.605) -- 0:02:31
188500 -- [-2149.705] (-2149.165) (-2153.410) (-2149.860) * (-2155.071) (-2152.990) (-2154.301) [-2150.953] -- 0:02:30
189000 -- (-2149.059) (-2157.910) (-2160.214) [-2154.282] * (-2153.153) (-2154.366) (-2154.048) [-2149.394] -- 0:02:30
189500 -- (-2158.420) (-2153.841) [-2156.918] (-2151.778) * (-2162.136) (-2154.766) (-2156.019) [-2153.250] -- 0:02:29
190000 -- (-2162.679) [-2151.060] (-2155.811) (-2150.695) * [-2155.188] (-2152.580) (-2151.593) (-2157.966) -- 0:02:29
Average standard deviation of split frequencies: 0.001236
190500 -- [-2156.668] (-2158.566) (-2150.930) (-2153.479) * (-2152.504) (-2152.647) [-2149.572] (-2151.283) -- 0:02:28
191000 -- (-2153.559) (-2154.786) [-2153.156] (-2156.762) * [-2154.226] (-2150.466) (-2151.576) (-2154.166) -- 0:02:28
191500 -- (-2152.691) (-2152.332) (-2157.629) [-2157.444] * (-2157.524) (-2153.220) [-2151.717] (-2153.481) -- 0:02:27
192000 -- (-2156.286) (-2154.008) [-2156.548] (-2155.464) * (-2159.008) (-2151.184) [-2148.540] (-2157.810) -- 0:02:31
192500 -- (-2151.374) (-2156.935) [-2152.902] (-2156.060) * (-2155.273) (-2150.138) (-2155.594) [-2151.785] -- 0:02:31
193000 -- (-2156.644) (-2155.963) (-2155.821) [-2151.291] * [-2149.806] (-2149.507) (-2151.862) (-2148.795) -- 0:02:30
193500 -- [-2148.393] (-2153.685) (-2152.886) (-2149.149) * (-2157.391) (-2153.071) (-2156.419) [-2155.402] -- 0:02:30
194000 -- [-2149.463] (-2154.723) (-2149.330) (-2153.692) * [-2153.950] (-2152.257) (-2151.199) (-2155.368) -- 0:02:29
194500 -- (-2157.357) (-2153.289) [-2156.582] (-2152.453) * [-2152.837] (-2155.495) (-2152.188) (-2153.321) -- 0:02:29
195000 -- [-2151.876] (-2151.598) (-2159.420) (-2150.247) * (-2155.075) (-2155.283) (-2152.167) [-2150.241] -- 0:02:28
Average standard deviation of split frequencies: 0.001203
195500 -- (-2155.227) (-2158.738) (-2154.988) [-2149.896] * (-2154.617) (-2151.992) [-2149.831] (-2148.914) -- 0:02:28
196000 -- [-2150.610] (-2151.988) (-2153.750) (-2150.333) * (-2156.309) (-2151.573) (-2151.585) [-2149.633] -- 0:02:27
196500 -- (-2155.205) (-2153.192) [-2154.226] (-2149.822) * (-2148.212) [-2151.369] (-2157.402) (-2151.261) -- 0:02:27
197000 -- (-2149.424) [-2150.216] (-2154.859) (-2149.506) * (-2149.392) (-2159.431) [-2155.926] (-2156.053) -- 0:02:30
197500 -- (-2156.984) (-2154.528) (-2153.729) [-2152.996] * (-2146.935) (-2153.674) [-2156.954] (-2151.886) -- 0:02:30
198000 -- (-2155.298) (-2154.033) (-2158.591) [-2149.857] * (-2150.458) (-2147.203) (-2152.738) [-2155.500] -- 0:02:29
198500 -- (-2156.000) (-2153.522) [-2152.342] (-2152.703) * [-2147.845] (-2146.944) (-2155.117) (-2150.680) -- 0:02:29
199000 -- (-2153.192) (-2151.625) (-2151.501) [-2153.643] * (-2153.987) [-2147.669] (-2150.208) (-2153.944) -- 0:02:28
199500 -- [-2152.174] (-2154.322) (-2149.376) (-2155.544) * (-2161.905) [-2149.680] (-2152.159) (-2152.041) -- 0:02:28
200000 -- [-2150.187] (-2151.030) (-2154.813) (-2150.442) * (-2164.572) (-2151.279) (-2153.546) [-2150.879] -- 0:02:28
Average standard deviation of split frequencies: 0.001175
200500 -- (-2159.255) (-2154.174) (-2160.504) [-2151.131] * (-2155.539) [-2151.953] (-2151.032) (-2151.046) -- 0:02:27
201000 -- (-2156.297) (-2149.193) [-2154.492] (-2156.817) * (-2152.448) [-2149.874] (-2150.912) (-2151.065) -- 0:02:27
201500 -- [-2149.271] (-2154.942) (-2152.258) (-2153.767) * (-2151.691) (-2153.856) (-2151.972) [-2153.367] -- 0:02:26
202000 -- (-2153.947) (-2151.134) [-2150.342] (-2152.495) * (-2151.807) (-2150.226) [-2149.611] (-2149.315) -- 0:02:26
202500 -- (-2153.917) (-2157.328) (-2153.815) [-2148.306] * [-2151.539] (-2149.495) (-2149.335) (-2150.201) -- 0:02:29
203000 -- [-2156.138] (-2152.132) (-2154.620) (-2154.685) * (-2160.650) (-2157.962) (-2154.859) [-2155.959] -- 0:02:29
203500 -- (-2155.930) [-2152.926] (-2150.073) (-2150.165) * (-2151.557) (-2157.018) [-2147.551] (-2153.906) -- 0:02:28
204000 -- (-2152.574) (-2164.084) (-2153.689) [-2153.097] * [-2150.326] (-2154.752) (-2152.605) (-2156.898) -- 0:02:28
204500 -- (-2153.560) (-2157.328) (-2155.455) [-2153.370] * [-2156.567] (-2155.322) (-2154.510) (-2154.549) -- 0:02:27
205000 -- (-2153.737) (-2151.447) [-2154.218] (-2158.145) * (-2150.703) [-2152.027] (-2153.404) (-2157.489) -- 0:02:27
Average standard deviation of split frequencies: 0.001144
205500 -- (-2153.690) [-2150.950] (-2158.461) (-2159.727) * (-2148.806) [-2152.339] (-2150.946) (-2152.854) -- 0:02:26
206000 -- [-2150.556] (-2150.215) (-2154.740) (-2156.216) * (-2151.784) (-2155.645) [-2156.154] (-2151.810) -- 0:02:26
206500 -- (-2158.396) (-2153.109) [-2153.212] (-2159.674) * [-2151.878] (-2152.362) (-2153.996) (-2149.987) -- 0:02:26
207000 -- (-2151.114) [-2151.896] (-2147.292) (-2153.135) * [-2157.948] (-2152.162) (-2155.195) (-2152.041) -- 0:02:25
207500 -- [-2153.453] (-2150.368) (-2156.710) (-2152.070) * (-2155.754) (-2158.591) (-2161.907) [-2155.976] -- 0:02:25
208000 -- (-2153.059) (-2153.825) (-2149.704) [-2149.071] * (-2149.243) (-2150.942) (-2151.580) [-2154.840] -- 0:02:28
208500 -- (-2155.777) [-2155.755] (-2152.723) (-2152.323) * [-2150.088] (-2152.709) (-2155.898) (-2147.900) -- 0:02:28
209000 -- [-2150.281] (-2162.199) (-2149.812) (-2151.150) * (-2157.715) (-2158.705) (-2153.457) [-2151.729] -- 0:02:27
209500 -- (-2156.043) (-2154.392) (-2151.902) [-2153.566] * (-2153.750) [-2150.556] (-2151.402) (-2149.177) -- 0:02:27
210000 -- (-2150.579) (-2154.457) [-2152.775] (-2154.838) * (-2148.284) [-2148.109] (-2152.471) (-2152.663) -- 0:02:26
Average standard deviation of split frequencies: 0.001119
210500 -- (-2151.595) (-2153.862) [-2153.505] (-2150.124) * (-2152.245) (-2155.228) (-2152.947) [-2152.687] -- 0:02:26
211000 -- [-2152.106] (-2149.761) (-2154.437) (-2156.853) * (-2155.560) (-2152.005) [-2152.727] (-2162.450) -- 0:02:25
211500 -- (-2152.329) (-2151.603) [-2149.787] (-2154.965) * (-2149.827) (-2149.827) (-2161.201) [-2151.475] -- 0:02:25
212000 -- (-2150.070) [-2149.851] (-2152.010) (-2150.050) * (-2152.422) (-2147.593) [-2150.978] (-2150.943) -- 0:02:24
212500 -- (-2151.708) (-2155.956) [-2150.340] (-2154.548) * (-2151.845) (-2152.124) [-2152.922] (-2153.656) -- 0:02:24
213000 -- (-2151.439) (-2158.189) (-2152.241) [-2153.303] * (-2152.658) (-2160.971) [-2149.595] (-2155.214) -- 0:02:24
213500 -- (-2151.097) [-2150.290] (-2155.601) (-2153.733) * (-2150.126) (-2151.345) [-2152.509] (-2154.925) -- 0:02:27
214000 -- [-2158.747] (-2155.927) (-2156.353) (-2153.541) * (-2155.056) (-2150.751) (-2152.740) [-2153.912] -- 0:02:26
214500 -- (-2152.408) [-2156.090] (-2150.681) (-2152.924) * (-2152.497) [-2155.012] (-2154.972) (-2162.271) -- 0:02:26
215000 -- [-2149.696] (-2160.637) (-2148.597) (-2150.351) * [-2152.149] (-2148.496) (-2153.663) (-2160.263) -- 0:02:26
Average standard deviation of split frequencies: 0.001091
215500 -- (-2149.727) (-2152.516) [-2152.437] (-2152.367) * (-2151.347) [-2152.962] (-2150.599) (-2152.435) -- 0:02:25
216000 -- (-2158.935) (-2154.042) [-2149.629] (-2153.016) * (-2152.302) (-2154.314) (-2154.688) [-2148.284] -- 0:02:25
216500 -- (-2149.379) [-2148.562] (-2161.703) (-2155.890) * [-2148.621] (-2159.508) (-2158.734) (-2155.172) -- 0:02:24
217000 -- (-2151.152) (-2155.791) (-2164.739) [-2154.045] * (-2153.991) (-2150.062) (-2154.369) [-2149.571] -- 0:02:24
217500 -- (-2153.148) [-2149.390] (-2159.440) (-2158.869) * (-2150.255) [-2151.201] (-2163.525) (-2149.183) -- 0:02:23
218000 -- (-2152.010) (-2150.816) [-2151.238] (-2153.954) * [-2148.732] (-2158.843) (-2157.407) (-2159.346) -- 0:02:23
218500 -- (-2147.195) [-2153.873] (-2150.672) (-2159.331) * (-2149.905) (-2153.942) (-2151.077) [-2154.692] -- 0:02:26
219000 -- [-2151.579] (-2151.914) (-2154.109) (-2153.303) * [-2148.207] (-2153.164) (-2152.019) (-2158.328) -- 0:02:26
219500 -- (-2152.015) (-2152.391) (-2152.291) [-2149.403] * [-2148.042] (-2147.116) (-2149.934) (-2155.904) -- 0:02:25
220000 -- (-2152.072) (-2158.811) [-2151.405] (-2152.533) * (-2154.247) [-2149.177] (-2149.285) (-2155.450) -- 0:02:25
Average standard deviation of split frequencies: 0.001068
220500 -- [-2153.029] (-2150.246) (-2152.136) (-2157.023) * [-2151.692] (-2151.015) (-2153.716) (-2157.651) -- 0:02:24
221000 -- (-2153.740) (-2153.564) (-2149.248) [-2151.247] * (-2149.491) [-2147.598] (-2155.972) (-2156.023) -- 0:02:24
221500 -- [-2148.927] (-2149.338) (-2152.956) (-2151.535) * (-2157.774) (-2148.787) (-2153.367) [-2151.020] -- 0:02:24
222000 -- (-2150.840) [-2154.205] (-2154.261) (-2157.683) * (-2151.039) (-2152.493) (-2156.188) [-2153.206] -- 0:02:23
222500 -- (-2156.600) (-2155.968) [-2151.865] (-2157.362) * (-2152.049) (-2154.436) [-2152.268] (-2151.348) -- 0:02:23
223000 -- (-2155.100) (-2159.059) [-2149.174] (-2157.270) * (-2155.037) [-2152.567] (-2154.345) (-2153.235) -- 0:02:22
223500 -- (-2152.823) (-2153.655) [-2149.936] (-2154.477) * (-2155.003) (-2151.285) (-2163.260) [-2152.081] -- 0:02:22
224000 -- [-2149.895] (-2162.251) (-2150.751) (-2157.893) * [-2154.102] (-2151.461) (-2153.816) (-2161.028) -- 0:02:25
224500 -- (-2156.986) (-2153.401) [-2148.328] (-2151.862) * (-2155.091) [-2153.429] (-2146.491) (-2152.693) -- 0:02:25
225000 -- (-2157.179) [-2149.334] (-2154.095) (-2151.204) * (-2153.574) (-2152.476) [-2156.917] (-2155.716) -- 0:02:24
Average standard deviation of split frequencies: 0.001043
225500 -- (-2151.953) (-2160.151) [-2147.411] (-2154.136) * [-2154.452] (-2153.441) (-2156.075) (-2168.913) -- 0:02:24
226000 -- (-2155.598) (-2158.453) (-2153.179) [-2154.606] * (-2157.557) (-2150.995) [-2147.929] (-2156.765) -- 0:02:23
226500 -- (-2157.642) (-2162.546) [-2148.231] (-2150.194) * (-2158.483) (-2151.298) [-2156.376] (-2149.686) -- 0:02:23
227000 -- (-2150.286) (-2154.961) (-2157.671) [-2148.822] * [-2158.213] (-2155.834) (-2152.722) (-2150.994) -- 0:02:23
227500 -- (-2154.056) [-2153.088] (-2152.118) (-2150.273) * (-2156.541) [-2157.051] (-2155.274) (-2156.933) -- 0:02:22
228000 -- (-2154.129) [-2152.398] (-2154.250) (-2159.393) * (-2161.775) (-2156.384) [-2152.375] (-2154.923) -- 0:02:22
228500 -- (-2156.744) (-2151.782) [-2152.587] (-2157.637) * (-2150.277) (-2154.231) (-2152.130) [-2148.581] -- 0:02:21
229000 -- [-2151.761] (-2159.117) (-2156.749) (-2154.944) * [-2150.976] (-2152.409) (-2148.697) (-2151.112) -- 0:02:21
229500 -- (-2149.084) (-2156.543) [-2153.875] (-2157.468) * (-2155.293) (-2153.885) (-2147.666) [-2151.898] -- 0:02:24
230000 -- [-2156.926] (-2149.313) (-2149.436) (-2152.581) * (-2153.157) [-2155.362] (-2152.315) (-2159.703) -- 0:02:23
Average standard deviation of split frequencies: 0.001022
230500 -- (-2155.818) (-2150.165) [-2153.857] (-2152.291) * (-2156.812) [-2149.368] (-2155.396) (-2151.984) -- 0:02:23
231000 -- (-2150.753) (-2149.356) (-2158.672) [-2147.409] * (-2155.122) [-2147.009] (-2148.819) (-2153.821) -- 0:02:23
231500 -- (-2158.247) [-2149.873] (-2148.954) (-2153.194) * (-2156.374) [-2148.689] (-2156.625) (-2151.550) -- 0:02:22
232000 -- (-2152.534) [-2150.201] (-2159.625) (-2151.110) * [-2153.621] (-2152.635) (-2154.548) (-2152.591) -- 0:02:22
232500 -- (-2153.114) (-2146.840) (-2151.097) [-2152.246] * (-2153.623) [-2153.148] (-2159.227) (-2156.823) -- 0:02:21
233000 -- [-2153.904] (-2149.241) (-2152.567) (-2152.158) * (-2155.791) (-2157.893) (-2150.213) [-2149.439] -- 0:02:21
233500 -- (-2150.902) [-2150.034] (-2158.732) (-2159.007) * (-2155.845) (-2149.257) [-2151.064] (-2153.368) -- 0:02:21
234000 -- (-2156.213) (-2160.553) [-2161.065] (-2150.845) * (-2151.693) (-2156.121) (-2152.346) [-2151.888] -- 0:02:20
234500 -- (-2155.068) (-2156.996) (-2157.546) [-2150.626] * (-2151.470) [-2155.097] (-2152.784) (-2157.970) -- 0:02:20
235000 -- (-2157.406) (-2153.371) (-2158.550) [-2150.123] * [-2149.778] (-2153.999) (-2152.147) (-2150.279) -- 0:02:23
Average standard deviation of split frequencies: 0.000999
235500 -- (-2156.657) (-2156.318) [-2150.602] (-2155.905) * (-2152.021) (-2153.294) (-2154.378) [-2149.698] -- 0:02:22
236000 -- (-2160.010) (-2151.174) [-2150.431] (-2161.732) * (-2155.262) (-2153.765) [-2151.290] (-2146.534) -- 0:02:22
236500 -- [-2160.128] (-2150.110) (-2151.290) (-2153.854) * (-2151.911) (-2153.325) [-2150.651] (-2152.990) -- 0:02:22
237000 -- [-2159.423] (-2155.195) (-2151.509) (-2151.178) * (-2152.146) (-2157.680) (-2155.436) [-2154.861] -- 0:02:21
237500 -- (-2152.652) (-2159.615) (-2152.849) [-2149.240] * [-2150.551] (-2164.442) (-2155.539) (-2154.071) -- 0:02:21
238000 -- (-2155.473) (-2155.910) [-2152.645] (-2153.197) * (-2153.439) (-2161.476) [-2156.331] (-2152.550) -- 0:02:20
238500 -- (-2155.688) (-2162.241) [-2152.085] (-2152.908) * [-2151.084] (-2150.892) (-2158.587) (-2147.635) -- 0:02:20
239000 -- (-2148.682) (-2158.944) (-2148.145) [-2152.411] * [-2147.050] (-2153.813) (-2153.789) (-2158.982) -- 0:02:20
239500 -- [-2148.760] (-2147.910) (-2147.574) (-2155.298) * [-2150.870] (-2157.079) (-2151.700) (-2151.267) -- 0:02:19
240000 -- [-2149.020] (-2152.938) (-2152.208) (-2151.799) * (-2155.795) (-2152.957) (-2158.954) [-2149.673] -- 0:02:19
Average standard deviation of split frequencies: 0.000979
240500 -- (-2161.746) [-2151.379] (-2150.689) (-2149.888) * [-2152.849] (-2157.014) (-2154.183) (-2148.388) -- 0:02:22
241000 -- [-2153.761] (-2154.999) (-2164.996) (-2156.215) * (-2159.582) (-2147.480) (-2151.945) [-2150.496] -- 0:02:21
241500 -- [-2154.436] (-2150.742) (-2152.478) (-2158.056) * (-2152.392) [-2151.683] (-2153.313) (-2151.699) -- 0:02:21
242000 -- (-2153.563) (-2157.410) (-2156.126) [-2150.604] * (-2150.891) (-2154.257) (-2149.034) [-2149.724] -- 0:02:20
242500 -- (-2151.904) (-2152.319) [-2149.677] (-2149.987) * (-2155.779) (-2155.270) [-2157.427] (-2152.845) -- 0:02:20
243000 -- (-2149.608) [-2158.331] (-2150.525) (-2150.713) * (-2156.118) [-2155.822] (-2150.799) (-2153.939) -- 0:02:20
243500 -- [-2152.370] (-2154.568) (-2149.097) (-2154.210) * [-2158.701] (-2154.064) (-2152.839) (-2155.458) -- 0:02:19
244000 -- (-2148.920) (-2152.975) (-2150.140) [-2150.516] * [-2154.143] (-2158.885) (-2146.880) (-2155.271) -- 0:02:19
244500 -- [-2153.721] (-2151.694) (-2155.460) (-2150.062) * (-2154.163) (-2152.507) (-2148.227) [-2156.088] -- 0:02:19
245000 -- (-2154.477) (-2152.289) (-2148.923) [-2151.097] * (-2156.823) (-2157.404) [-2155.178] (-2158.800) -- 0:02:18
Average standard deviation of split frequencies: 0.000958
245500 -- (-2157.742) (-2164.148) [-2151.186] (-2148.462) * (-2150.804) (-2151.413) (-2155.472) [-2156.786] -- 0:02:18
246000 -- (-2165.249) (-2153.008) [-2151.456] (-2158.426) * (-2146.979) (-2152.624) [-2148.255] (-2146.709) -- 0:02:20
246500 -- (-2157.060) [-2154.754] (-2151.162) (-2158.401) * (-2154.208) (-2155.204) (-2149.004) [-2150.309] -- 0:02:20
247000 -- [-2151.753] (-2150.980) (-2156.068) (-2156.204) * (-2154.317) (-2150.802) [-2152.579] (-2150.975) -- 0:02:20
247500 -- [-2149.856] (-2152.379) (-2154.695) (-2154.790) * (-2154.970) [-2154.392] (-2150.053) (-2154.189) -- 0:02:19
248000 -- [-2157.250] (-2154.664) (-2157.399) (-2150.929) * (-2157.886) (-2152.930) (-2156.106) [-2153.822] -- 0:02:19
248500 -- (-2154.400) [-2150.833] (-2153.477) (-2152.946) * (-2153.033) [-2150.379] (-2158.082) (-2158.308) -- 0:02:19
249000 -- (-2153.347) [-2149.263] (-2154.990) (-2159.104) * (-2153.471) [-2148.736] (-2154.260) (-2153.441) -- 0:02:18
249500 -- (-2150.997) (-2150.633) (-2154.014) [-2154.995] * (-2151.032) (-2151.958) [-2151.847] (-2149.770) -- 0:02:18
250000 -- [-2153.333] (-2153.921) (-2152.392) (-2149.761) * (-2153.813) (-2153.399) [-2149.703] (-2154.960) -- 0:02:18
Average standard deviation of split frequencies: 0.000940
250500 -- (-2150.697) (-2158.833) (-2154.577) [-2148.917] * (-2158.072) [-2150.228] (-2153.123) (-2148.233) -- 0:02:17
251000 -- (-2155.118) (-2156.608) (-2152.642) [-2155.767] * (-2156.311) [-2148.676] (-2157.391) (-2148.767) -- 0:02:17
251500 -- (-2159.770) (-2152.143) [-2154.212] (-2150.382) * [-2149.463] (-2154.016) (-2159.949) (-2149.955) -- 0:02:19
252000 -- (-2154.446) (-2147.234) (-2150.048) [-2152.595] * [-2147.912] (-2154.566) (-2151.895) (-2155.331) -- 0:02:19
252500 -- (-2151.250) [-2148.146] (-2149.028) (-2154.408) * [-2148.539] (-2152.378) (-2157.453) (-2151.769) -- 0:02:19
253000 -- (-2149.907) [-2148.828] (-2151.479) (-2152.779) * (-2155.292) (-2155.910) [-2151.225] (-2150.186) -- 0:02:18
253500 -- (-2155.101) (-2152.328) (-2150.995) [-2154.331] * (-2152.392) [-2150.659] (-2155.105) (-2150.541) -- 0:02:18
254000 -- (-2149.408) (-2156.166) (-2151.202) [-2154.426] * (-2149.076) (-2145.529) [-2154.452] (-2152.714) -- 0:02:18
254500 -- [-2150.261] (-2155.300) (-2155.831) (-2153.536) * (-2154.556) [-2149.626] (-2155.490) (-2150.142) -- 0:02:17
255000 -- (-2150.709) (-2148.030) [-2151.620] (-2153.473) * (-2154.653) (-2150.880) [-2152.692] (-2153.232) -- 0:02:17
Average standard deviation of split frequencies: 0.000921
255500 -- (-2154.156) (-2152.351) [-2157.264] (-2149.440) * (-2154.812) (-2163.687) [-2154.992] (-2155.564) -- 0:02:16
256000 -- (-2153.778) [-2147.804] (-2151.176) (-2151.482) * (-2159.588) (-2153.933) [-2153.752] (-2150.628) -- 0:02:16
256500 -- (-2152.024) [-2151.215] (-2153.969) (-2151.187) * (-2165.803) (-2148.510) [-2150.847] (-2154.453) -- 0:02:19
257000 -- [-2155.163] (-2151.153) (-2153.129) (-2151.559) * [-2158.548] (-2151.692) (-2153.138) (-2152.853) -- 0:02:18
257500 -- [-2154.832] (-2152.468) (-2151.152) (-2152.813) * (-2157.624) (-2151.258) [-2155.109] (-2154.765) -- 0:02:18
258000 -- (-2155.627) (-2153.072) [-2150.957] (-2153.445) * (-2154.430) [-2155.553] (-2149.920) (-2158.998) -- 0:02:18
258500 -- (-2152.649) (-2156.580) [-2154.555] (-2153.441) * (-2152.136) [-2155.528] (-2155.543) (-2154.478) -- 0:02:17
259000 -- (-2160.351) (-2152.337) [-2151.619] (-2153.396) * [-2150.467] (-2157.545) (-2153.468) (-2152.889) -- 0:02:17
259500 -- (-2148.786) [-2153.213] (-2152.371) (-2152.467) * [-2153.326] (-2153.889) (-2148.395) (-2152.752) -- 0:02:16
260000 -- (-2149.313) [-2153.914] (-2148.876) (-2151.137) * (-2150.720) (-2154.084) (-2153.259) [-2149.381] -- 0:02:16
Average standard deviation of split frequencies: 0.000904
260500 -- (-2151.470) (-2149.146) [-2152.247] (-2157.652) * (-2150.615) (-2163.466) (-2154.393) [-2149.563] -- 0:02:16
261000 -- (-2154.017) [-2149.293] (-2151.712) (-2151.796) * (-2151.585) (-2149.039) [-2157.121] (-2153.152) -- 0:02:15
261500 -- (-2158.362) (-2148.346) [-2147.976] (-2152.036) * (-2149.254) [-2158.618] (-2152.389) (-2152.419) -- 0:02:15
262000 -- [-2150.822] (-2152.443) (-2154.722) (-2155.714) * [-2152.668] (-2162.131) (-2156.465) (-2150.549) -- 0:02:18
262500 -- (-2148.195) (-2152.698) [-2153.870] (-2153.061) * (-2149.981) (-2155.345) (-2156.674) [-2149.532] -- 0:02:17
263000 -- (-2153.910) (-2150.404) [-2156.157] (-2158.091) * (-2154.412) (-2157.127) [-2151.889] (-2153.589) -- 0:02:17
263500 -- (-2147.733) (-2157.815) [-2149.015] (-2161.795) * (-2149.269) [-2150.288] (-2156.636) (-2152.041) -- 0:02:16
264000 -- (-2155.698) [-2149.824] (-2152.976) (-2156.103) * [-2148.681] (-2149.765) (-2153.453) (-2152.763) -- 0:02:16
264500 -- (-2162.175) [-2153.646] (-2148.394) (-2160.399) * [-2147.493] (-2151.986) (-2152.548) (-2161.172) -- 0:02:16
265000 -- [-2155.618] (-2157.201) (-2152.818) (-2156.323) * (-2153.279) [-2152.681] (-2152.557) (-2157.569) -- 0:02:15
Average standard deviation of split frequencies: 0.000886
265500 -- (-2156.152) (-2153.680) [-2155.744] (-2155.690) * [-2153.631] (-2155.146) (-2153.405) (-2159.400) -- 0:02:15
266000 -- [-2152.759] (-2155.542) (-2150.873) (-2150.143) * [-2155.710] (-2149.499) (-2151.107) (-2156.480) -- 0:02:15
266500 -- (-2152.874) (-2148.835) (-2149.499) [-2153.285] * (-2156.600) (-2147.620) [-2148.692] (-2157.831) -- 0:02:14
267000 -- [-2147.846] (-2151.661) (-2154.402) (-2149.990) * [-2153.808] (-2148.824) (-2162.027) (-2159.514) -- 0:02:14
267500 -- [-2148.646] (-2151.266) (-2151.171) (-2156.522) * (-2155.487) [-2149.231] (-2151.415) (-2166.760) -- 0:02:16
268000 -- [-2150.625] (-2155.278) (-2159.999) (-2151.299) * [-2152.303] (-2153.756) (-2152.708) (-2154.626) -- 0:02:16
268500 -- (-2151.447) (-2150.253) [-2156.377] (-2147.763) * (-2152.142) [-2150.275] (-2153.097) (-2155.199) -- 0:02:16
269000 -- (-2156.471) (-2155.833) (-2156.135) [-2148.584] * (-2152.521) [-2151.416] (-2155.535) (-2150.807) -- 0:02:15
269500 -- [-2148.515] (-2157.356) (-2156.570) (-2151.994) * (-2153.801) [-2151.987] (-2149.133) (-2153.086) -- 0:02:15
270000 -- [-2151.988] (-2149.711) (-2152.452) (-2153.062) * (-2150.620) [-2150.991] (-2161.492) (-2158.718) -- 0:02:15
Average standard deviation of split frequencies: 0.000871
270500 -- (-2154.753) (-2151.790) (-2153.599) [-2150.966] * (-2157.726) (-2148.893) [-2156.724] (-2153.196) -- 0:02:14
271000 -- (-2151.774) [-2151.611] (-2154.659) (-2158.655) * [-2149.576] (-2150.457) (-2150.541) (-2158.737) -- 0:02:14
271500 -- (-2154.297) (-2152.929) (-2161.453) [-2149.041] * (-2149.334) (-2154.752) [-2152.804] (-2151.053) -- 0:02:14
272000 -- [-2156.766] (-2160.463) (-2151.402) (-2152.709) * [-2149.867] (-2157.507) (-2149.750) (-2154.424) -- 0:02:13
272500 -- (-2153.600) (-2153.322) (-2158.209) [-2153.009] * (-2151.386) (-2153.610) (-2155.567) [-2152.736] -- 0:02:13
273000 -- (-2153.149) [-2151.230] (-2152.995) (-2150.306) * [-2149.932] (-2156.939) (-2155.121) (-2151.138) -- 0:02:15
273500 -- (-2159.073) (-2148.909) [-2150.027] (-2157.207) * [-2154.988] (-2151.944) (-2154.530) (-2149.214) -- 0:02:15
274000 -- [-2150.483] (-2155.585) (-2155.404) (-2151.600) * (-2155.507) (-2152.934) (-2151.999) [-2150.590] -- 0:02:15
274500 -- (-2151.376) (-2151.078) [-2149.949] (-2148.436) * [-2152.221] (-2160.025) (-2156.059) (-2154.651) -- 0:02:14
275000 -- [-2147.814] (-2154.942) (-2147.925) (-2151.079) * (-2156.795) (-2157.165) (-2152.495) [-2155.220] -- 0:02:14
Average standard deviation of split frequencies: 0.000854
275500 -- (-2151.244) [-2155.891] (-2150.593) (-2152.354) * (-2162.245) (-2156.557) [-2148.616] (-2153.263) -- 0:02:14
276000 -- (-2155.829) (-2151.416) (-2150.570) [-2150.122] * (-2162.314) (-2158.442) (-2158.981) [-2153.751] -- 0:02:13
276500 -- (-2159.913) [-2152.299] (-2150.704) (-2150.356) * (-2152.516) (-2151.232) [-2152.879] (-2155.140) -- 0:02:13
277000 -- [-2153.102] (-2161.017) (-2157.459) (-2153.422) * [-2153.526] (-2154.078) (-2154.650) (-2154.991) -- 0:02:13
277500 -- (-2150.827) [-2155.779] (-2151.644) (-2149.844) * (-2156.543) (-2150.135) (-2156.441) [-2151.217] -- 0:02:12
278000 -- (-2151.818) (-2154.059) (-2152.396) [-2149.989] * (-2154.161) [-2155.594] (-2152.946) (-2153.963) -- 0:02:12
278500 -- [-2150.429] (-2154.453) (-2160.066) (-2153.635) * (-2157.446) (-2153.748) (-2153.298) [-2150.086] -- 0:02:14
279000 -- [-2151.734] (-2158.049) (-2150.177) (-2155.066) * [-2156.116] (-2155.673) (-2156.742) (-2156.391) -- 0:02:14
279500 -- [-2150.875] (-2157.106) (-2149.523) (-2150.698) * (-2151.151) (-2153.797) (-2154.507) [-2153.114] -- 0:02:14
280000 -- [-2151.588] (-2155.574) (-2159.204) (-2150.651) * (-2160.330) (-2151.976) [-2153.417] (-2151.916) -- 0:02:13
Average standard deviation of split frequencies: 0.000840
280500 -- [-2150.918] (-2160.323) (-2152.117) (-2159.963) * (-2155.596) [-2149.020] (-2146.774) (-2155.284) -- 0:02:13
281000 -- (-2151.419) (-2168.513) [-2149.577] (-2158.563) * (-2155.793) [-2160.040] (-2156.417) (-2156.933) -- 0:02:13
281500 -- (-2155.319) (-2158.131) [-2151.141] (-2157.615) * (-2150.316) (-2152.535) [-2155.401] (-2153.704) -- 0:02:12
282000 -- (-2157.015) (-2150.057) (-2153.824) [-2149.575] * (-2149.105) (-2152.196) [-2150.618] (-2152.484) -- 0:02:12
282500 -- (-2151.335) (-2147.918) [-2151.612] (-2156.976) * (-2149.881) [-2157.154] (-2150.549) (-2155.185) -- 0:02:12
283000 -- (-2151.299) (-2152.098) (-2149.434) [-2148.989] * [-2146.417] (-2155.838) (-2150.896) (-2153.195) -- 0:02:11
283500 -- (-2150.776) (-2152.555) [-2154.386] (-2153.178) * [-2151.798] (-2153.355) (-2152.393) (-2156.264) -- 0:02:11
284000 -- (-2148.849) (-2157.580) [-2153.679] (-2155.890) * (-2154.779) [-2149.266] (-2153.658) (-2150.383) -- 0:02:13
284500 -- (-2151.230) (-2153.291) [-2153.832] (-2149.444) * (-2152.512) (-2157.627) [-2154.571] (-2152.276) -- 0:02:13
285000 -- (-2150.048) (-2152.580) (-2155.773) [-2151.886] * [-2151.385] (-2157.463) (-2148.963) (-2152.548) -- 0:02:12
Average standard deviation of split frequencies: 0.000824
285500 -- [-2153.272] (-2155.742) (-2155.493) (-2149.646) * (-2150.510) (-2161.173) [-2152.595] (-2153.307) -- 0:02:12
286000 -- [-2149.717] (-2149.864) (-2153.749) (-2153.470) * [-2150.316] (-2155.096) (-2157.144) (-2153.183) -- 0:02:12
286500 -- [-2147.380] (-2152.485) (-2165.067) (-2150.951) * [-2149.985] (-2165.911) (-2149.700) (-2157.066) -- 0:02:11
287000 -- [-2148.925] (-2149.449) (-2157.577) (-2152.012) * [-2152.385] (-2150.837) (-2153.829) (-2155.266) -- 0:02:11
287500 -- (-2159.904) (-2159.827) (-2150.848) [-2150.578] * (-2153.193) [-2151.248] (-2151.864) (-2156.090) -- 0:02:11
288000 -- (-2151.858) [-2152.881] (-2156.373) (-2152.998) * (-2149.472) (-2154.442) [-2149.117] (-2157.272) -- 0:02:11
288500 -- (-2149.318) [-2152.513] (-2159.443) (-2161.398) * [-2149.961] (-2151.786) (-2153.236) (-2155.862) -- 0:02:10
289000 -- (-2153.319) [-2149.687] (-2154.636) (-2155.805) * (-2152.215) (-2155.112) (-2151.906) [-2150.428] -- 0:02:10
289500 -- [-2149.434] (-2164.510) (-2149.150) (-2160.743) * (-2152.173) (-2152.979) (-2152.341) [-2153.073] -- 0:02:12
290000 -- (-2153.571) [-2149.196] (-2150.860) (-2156.903) * (-2155.137) [-2157.321] (-2154.628) (-2162.020) -- 0:02:12
Average standard deviation of split frequencies: 0.000811
290500 -- (-2153.826) (-2153.490) [-2149.099] (-2153.909) * (-2160.162) [-2153.422] (-2152.028) (-2156.336) -- 0:02:11
291000 -- (-2156.958) [-2150.163] (-2152.440) (-2159.043) * (-2151.434) (-2151.247) [-2150.917] (-2155.008) -- 0:02:11
291500 -- (-2159.079) [-2150.011] (-2152.236) (-2154.074) * (-2152.766) (-2149.970) (-2152.892) [-2153.166] -- 0:02:11
292000 -- [-2155.021] (-2154.374) (-2156.974) (-2155.926) * (-2154.417) (-2157.719) [-2150.609] (-2154.385) -- 0:02:10
292500 -- [-2151.957] (-2154.281) (-2151.513) (-2148.934) * (-2152.099) (-2153.544) (-2151.356) [-2152.648] -- 0:02:10
293000 -- (-2153.200) [-2152.799] (-2156.767) (-2151.689) * (-2149.429) (-2160.164) [-2151.348] (-2154.868) -- 0:02:10
293500 -- [-2151.608] (-2161.078) (-2155.907) (-2152.344) * (-2149.817) (-2151.884) (-2155.146) [-2152.605] -- 0:02:09
294000 -- (-2157.939) (-2162.641) (-2149.700) [-2154.030] * (-2150.163) [-2149.707] (-2156.791) (-2152.482) -- 0:02:09
294500 -- (-2153.420) [-2156.553] (-2152.223) (-2148.855) * [-2154.438] (-2155.686) (-2154.081) (-2153.724) -- 0:02:11
295000 -- [-2149.852] (-2154.409) (-2157.417) (-2151.340) * (-2155.663) [-2154.537] (-2152.589) (-2152.137) -- 0:02:11
Average standard deviation of split frequencies: 0.000796
295500 -- [-2147.647] (-2154.317) (-2150.397) (-2157.079) * [-2161.184] (-2153.660) (-2151.071) (-2152.056) -- 0:02:11
296000 -- (-2153.741) [-2154.948] (-2149.915) (-2158.095) * (-2150.296) (-2152.749) [-2152.356] (-2147.523) -- 0:02:10
296500 -- [-2147.749] (-2150.674) (-2152.852) (-2149.754) * (-2152.345) (-2151.473) (-2146.660) [-2151.981] -- 0:02:10
297000 -- [-2150.507] (-2159.454) (-2151.171) (-2146.831) * [-2154.086] (-2152.424) (-2152.228) (-2160.361) -- 0:02:10
297500 -- (-2157.518) [-2152.120] (-2156.309) (-2152.958) * (-2152.759) (-2147.628) [-2149.526] (-2155.533) -- 0:02:09
298000 -- [-2150.102] (-2153.323) (-2154.865) (-2154.037) * (-2151.225) (-2152.240) [-2148.360] (-2158.784) -- 0:02:09
298500 -- (-2152.971) (-2151.386) [-2157.705] (-2151.901) * (-2153.416) (-2150.876) [-2153.795] (-2154.965) -- 0:02:09
299000 -- (-2151.599) [-2149.844] (-2153.858) (-2154.547) * (-2150.216) (-2150.606) [-2153.883] (-2154.022) -- 0:02:08
299500 -- [-2148.622] (-2153.348) (-2153.969) (-2150.164) * (-2154.010) [-2157.445] (-2154.364) (-2157.115) -- 0:02:08
300000 -- [-2149.906] (-2157.706) (-2164.574) (-2150.488) * (-2151.208) (-2152.034) (-2156.774) [-2157.853] -- 0:02:10
Average standard deviation of split frequencies: 0.000000
300500 -- (-2155.669) (-2151.606) [-2150.924] (-2155.993) * (-2156.007) (-2151.172) [-2150.291] (-2159.659) -- 0:02:10
301000 -- [-2151.015] (-2159.624) (-2152.391) (-2156.984) * (-2158.878) (-2149.990) (-2153.375) [-2160.903] -- 0:02:10
301500 -- [-2152.089] (-2152.094) (-2154.798) (-2156.262) * (-2151.995) [-2147.545] (-2157.781) (-2155.785) -- 0:02:09
302000 -- (-2150.297) [-2158.963] (-2151.401) (-2154.724) * (-2148.046) (-2156.102) (-2157.620) [-2153.675] -- 0:02:09
302500 -- (-2151.096) [-2158.079] (-2148.718) (-2154.556) * (-2154.339) (-2152.276) (-2156.103) [-2150.940] -- 0:02:09
303000 -- (-2162.378) (-2158.703) (-2151.138) [-2153.878] * [-2149.687] (-2156.064) (-2158.655) (-2153.307) -- 0:02:08
303500 -- (-2150.492) (-2160.880) (-2158.452) [-2148.793] * [-2152.320] (-2153.842) (-2162.618) (-2150.104) -- 0:02:08
304000 -- (-2150.279) (-2152.895) (-2147.286) [-2150.836] * [-2151.462] (-2150.708) (-2159.304) (-2151.487) -- 0:02:08
304500 -- (-2150.148) (-2159.439) (-2151.408) [-2153.891] * (-2147.173) [-2148.898] (-2158.634) (-2156.948) -- 0:02:07
305000 -- (-2151.222) (-2152.844) [-2151.077] (-2154.595) * (-2152.989) (-2152.669) (-2161.894) [-2162.182] -- 0:02:07
Average standard deviation of split frequencies: 0.000000
305500 -- (-2153.928) [-2151.374] (-2155.966) (-2155.951) * [-2149.523] (-2155.731) (-2153.951) (-2153.953) -- 0:02:09
306000 -- [-2151.188] (-2155.311) (-2149.816) (-2153.192) * [-2151.636] (-2153.600) (-2152.944) (-2149.131) -- 0:02:09
306500 -- (-2148.255) (-2156.639) [-2151.869] (-2150.212) * (-2151.245) (-2154.866) (-2155.561) [-2149.258] -- 0:02:08
307000 -- (-2150.839) (-2154.801) (-2149.545) [-2150.098] * (-2158.596) (-2157.097) [-2150.503] (-2150.534) -- 0:02:08
307500 -- (-2155.596) (-2150.558) (-2150.505) [-2153.729] * (-2156.732) [-2151.406] (-2151.631) (-2155.804) -- 0:02:08
308000 -- (-2157.334) (-2150.609) (-2151.709) [-2153.013] * (-2156.686) (-2154.368) (-2158.101) [-2147.231] -- 0:02:08
308500 -- (-2154.077) [-2151.196] (-2156.916) (-2153.667) * (-2155.273) (-2158.394) [-2150.608] (-2148.981) -- 0:02:07
309000 -- (-2154.988) (-2154.051) [-2150.760] (-2158.903) * (-2157.707) (-2155.626) (-2147.454) [-2146.917] -- 0:02:07
309500 -- (-2157.654) [-2150.859] (-2151.418) (-2161.469) * (-2158.397) [-2151.991] (-2153.250) (-2154.297) -- 0:02:07
310000 -- (-2165.723) [-2152.596] (-2153.109) (-2159.726) * [-2149.155] (-2168.592) (-2157.451) (-2152.780) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
310500 -- (-2156.826) (-2153.741) (-2154.456) [-2151.384] * [-2151.097] (-2157.260) (-2148.045) (-2152.321) -- 0:02:06
311000 -- (-2152.991) (-2151.253) (-2157.361) [-2149.950] * (-2150.807) [-2156.741] (-2153.726) (-2154.529) -- 0:02:08
311500 -- (-2148.643) (-2157.825) [-2152.738] (-2147.878) * (-2152.400) (-2156.686) (-2155.342) [-2149.767] -- 0:02:08
312000 -- [-2161.349] (-2149.880) (-2159.112) (-2148.552) * [-2155.987] (-2152.083) (-2153.146) (-2148.706) -- 0:02:07
312500 -- (-2153.833) (-2150.208) (-2150.903) [-2151.485] * (-2148.963) (-2154.588) (-2157.010) [-2152.441] -- 0:02:07
313000 -- (-2150.128) [-2150.984] (-2147.781) (-2150.761) * (-2153.453) [-2153.860] (-2151.534) (-2151.488) -- 0:02:07
313500 -- [-2146.793] (-2152.258) (-2151.388) (-2151.104) * (-2156.134) (-2153.126) (-2151.633) [-2151.839] -- 0:02:07
314000 -- (-2149.721) (-2154.064) [-2147.012] (-2149.534) * [-2154.121] (-2148.049) (-2153.307) (-2152.617) -- 0:02:06
314500 -- (-2154.266) (-2152.241) (-2151.256) [-2150.265] * [-2149.367] (-2149.322) (-2149.649) (-2151.164) -- 0:02:06
315000 -- [-2156.194] (-2154.404) (-2152.896) (-2157.495) * (-2152.841) [-2153.131] (-2155.942) (-2151.696) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
315500 -- (-2155.641) (-2151.748) (-2154.001) [-2155.277] * [-2147.630] (-2150.147) (-2156.345) (-2154.010) -- 0:02:05
316000 -- (-2159.220) (-2153.607) [-2159.916] (-2155.876) * (-2154.308) (-2158.752) (-2152.902) [-2156.305] -- 0:02:05
316500 -- [-2149.109] (-2156.895) (-2153.828) (-2153.570) * (-2148.168) (-2152.388) [-2150.232] (-2157.012) -- 0:02:07
317000 -- (-2156.414) (-2156.691) (-2151.831) [-2151.188] * (-2153.227) [-2151.206] (-2159.126) (-2152.409) -- 0:02:07
317500 -- (-2153.794) [-2156.778] (-2161.609) (-2154.360) * (-2152.233) (-2156.615) (-2151.052) [-2156.309] -- 0:02:06
318000 -- [-2153.464] (-2154.612) (-2155.983) (-2149.161) * (-2154.648) [-2149.007] (-2151.555) (-2158.447) -- 0:02:06
318500 -- (-2152.589) [-2151.616] (-2154.454) (-2151.507) * [-2155.729] (-2148.069) (-2152.997) (-2157.202) -- 0:02:06
319000 -- [-2150.845] (-2151.486) (-2158.577) (-2153.555) * (-2155.348) [-2155.970] (-2152.928) (-2159.919) -- 0:02:05
319500 -- [-2151.320] (-2154.773) (-2159.128) (-2150.399) * [-2152.008] (-2156.059) (-2151.167) (-2156.128) -- 0:02:05
320000 -- [-2148.893] (-2159.394) (-2156.274) (-2150.829) * (-2157.097) (-2157.397) [-2155.145] (-2150.575) -- 0:02:05
Average standard deviation of split frequencies: 0.000000
320500 -- (-2149.951) (-2152.977) [-2152.446] (-2151.622) * (-2161.324) [-2152.151] (-2154.937) (-2160.546) -- 0:02:05
321000 -- (-2149.052) (-2156.523) [-2148.937] (-2147.511) * (-2151.009) (-2152.060) (-2158.784) [-2154.450] -- 0:02:04
321500 -- [-2155.761] (-2152.910) (-2148.787) (-2152.159) * [-2150.772] (-2151.711) (-2151.396) (-2149.221) -- 0:02:04
322000 -- (-2151.887) [-2155.978] (-2149.340) (-2153.681) * (-2148.177) (-2154.906) (-2150.367) [-2147.594] -- 0:02:06
322500 -- (-2154.244) [-2151.753] (-2157.030) (-2149.403) * (-2152.920) [-2155.266] (-2151.000) (-2154.742) -- 0:02:06
323000 -- [-2160.600] (-2150.264) (-2155.507) (-2149.136) * (-2152.492) (-2156.489) (-2151.379) [-2151.013] -- 0:02:05
323500 -- (-2154.281) (-2152.093) [-2159.326] (-2149.198) * [-2154.627] (-2155.872) (-2155.155) (-2146.412) -- 0:02:05
324000 -- (-2150.327) (-2151.871) [-2152.177] (-2150.627) * [-2146.562] (-2151.653) (-2157.908) (-2149.155) -- 0:02:05
324500 -- (-2154.335) [-2149.293] (-2158.228) (-2152.467) * (-2149.840) [-2152.858] (-2152.069) (-2156.356) -- 0:02:04
325000 -- (-2154.418) (-2152.899) (-2159.642) [-2154.937] * (-2154.749) (-2152.617) (-2154.295) [-2151.576] -- 0:02:04
Average standard deviation of split frequencies: 0.000723
325500 -- [-2149.235] (-2147.772) (-2155.614) (-2155.434) * [-2157.577] (-2151.841) (-2153.419) (-2153.437) -- 0:02:04
326000 -- (-2150.146) [-2150.878] (-2154.287) (-2154.506) * (-2155.051) (-2155.490) (-2154.274) [-2155.753] -- 0:02:04
326500 -- (-2151.391) (-2156.300) [-2152.595] (-2153.430) * (-2156.491) (-2151.056) (-2154.353) [-2151.561] -- 0:02:03
327000 -- (-2153.735) (-2156.122) (-2152.356) [-2154.157] * [-2151.285] (-2150.007) (-2148.696) (-2154.049) -- 0:02:05
327500 -- (-2155.410) [-2152.681] (-2162.097) (-2150.185) * (-2154.657) (-2153.836) [-2155.642] (-2151.681) -- 0:02:05
328000 -- [-2150.029] (-2165.672) (-2152.721) (-2158.305) * (-2152.113) [-2151.618] (-2154.598) (-2157.748) -- 0:02:04
328500 -- [-2150.423] (-2157.849) (-2161.308) (-2157.957) * (-2156.410) (-2154.325) [-2153.005] (-2152.360) -- 0:02:04
329000 -- (-2150.475) (-2154.324) (-2156.090) [-2150.476] * (-2149.067) (-2155.368) [-2151.894] (-2160.001) -- 0:02:04
329500 -- (-2149.553) (-2148.069) [-2154.664] (-2152.687) * [-2148.332] (-2156.393) (-2155.370) (-2152.898) -- 0:02:04
330000 -- (-2150.974) (-2151.651) (-2153.286) [-2150.082] * [-2149.738] (-2149.474) (-2151.745) (-2148.596) -- 0:02:03
Average standard deviation of split frequencies: 0.000713
330500 -- (-2154.327) (-2152.482) [-2152.214] (-2154.225) * (-2154.618) [-2153.860] (-2152.109) (-2156.861) -- 0:02:03
331000 -- [-2149.483] (-2159.266) (-2152.522) (-2151.379) * (-2153.903) (-2147.262) (-2156.106) [-2152.099] -- 0:02:03
331500 -- (-2149.166) (-2156.862) (-2153.515) [-2156.760] * (-2149.879) [-2154.542] (-2153.538) (-2154.791) -- 0:02:03
332000 -- (-2150.847) (-2161.342) [-2155.332] (-2148.593) * (-2154.556) [-2152.827] (-2152.093) (-2152.657) -- 0:02:02
332500 -- (-2155.472) (-2152.287) [-2154.320] (-2150.016) * (-2153.090) [-2151.367] (-2156.646) (-2150.215) -- 0:02:04
333000 -- [-2152.166] (-2161.829) (-2154.342) (-2160.214) * (-2153.045) (-2154.771) (-2162.844) [-2158.740] -- 0:02:04
333500 -- (-2150.804) (-2157.750) [-2146.957] (-2153.654) * (-2158.882) (-2155.130) [-2154.387] (-2156.866) -- 0:02:03
334000 -- [-2150.531] (-2158.768) (-2153.632) (-2152.419) * (-2153.485) (-2152.981) (-2154.505) [-2153.534] -- 0:02:03
334500 -- (-2151.745) (-2154.371) (-2154.315) [-2160.594] * [-2154.972] (-2151.638) (-2152.463) (-2155.938) -- 0:02:03
335000 -- (-2155.749) (-2155.956) [-2147.950] (-2156.930) * [-2151.360] (-2153.336) (-2153.111) (-2153.880) -- 0:02:03
Average standard deviation of split frequencies: 0.000701
335500 -- [-2153.495] (-2151.926) (-2152.952) (-2160.723) * (-2148.148) (-2149.437) (-2153.530) [-2155.031] -- 0:02:02
336000 -- (-2160.061) (-2159.566) (-2154.525) [-2152.066] * [-2152.801] (-2161.603) (-2151.605) (-2155.355) -- 0:02:02
336500 -- (-2153.618) (-2155.200) (-2159.966) [-2153.334] * (-2156.307) (-2150.886) [-2148.140] (-2152.366) -- 0:02:02
337000 -- [-2151.613] (-2156.389) (-2154.987) (-2149.739) * [-2152.669] (-2150.944) (-2154.617) (-2154.484) -- 0:02:01
337500 -- (-2153.311) (-2150.991) [-2153.235] (-2152.716) * (-2152.238) [-2153.257] (-2148.923) (-2158.578) -- 0:02:01
338000 -- [-2150.854] (-2149.347) (-2152.427) (-2151.941) * (-2152.385) [-2148.160] (-2160.909) (-2156.825) -- 0:02:03
338500 -- (-2156.395) (-2153.847) [-2150.829] (-2151.456) * (-2157.882) (-2155.444) (-2161.309) [-2157.157] -- 0:02:03
339000 -- (-2152.374) (-2155.262) [-2151.359] (-2150.134) * (-2156.823) (-2155.329) (-2156.569) [-2162.636] -- 0:02:02
339500 -- (-2152.394) (-2153.678) (-2151.969) [-2150.891] * [-2156.058] (-2161.712) (-2151.468) (-2153.376) -- 0:02:02
340000 -- (-2159.459) (-2151.776) (-2151.163) [-2153.770] * (-2152.942) (-2156.611) [-2150.572] (-2150.263) -- 0:02:02
Average standard deviation of split frequencies: 0.000692
340500 -- (-2153.667) (-2151.571) [-2151.212] (-2155.843) * (-2167.303) (-2156.585) [-2154.875] (-2152.375) -- 0:02:02
341000 -- [-2153.361] (-2151.255) (-2150.610) (-2166.478) * (-2151.154) (-2152.401) [-2155.600] (-2153.673) -- 0:02:01
341500 -- (-2158.505) (-2153.121) [-2147.693] (-2159.228) * [-2152.743] (-2152.322) (-2158.166) (-2158.981) -- 0:02:01
342000 -- (-2153.493) [-2161.225] (-2151.549) (-2148.901) * (-2149.288) [-2150.525] (-2162.491) (-2151.678) -- 0:02:01
342500 -- (-2150.403) [-2153.836] (-2156.956) (-2152.607) * [-2148.841] (-2149.581) (-2159.723) (-2152.384) -- 0:02:00
343000 -- (-2153.712) (-2157.575) (-2154.531) [-2158.599] * (-2148.306) (-2158.359) (-2154.658) [-2154.110] -- 0:02:00
343500 -- (-2152.331) [-2152.070] (-2155.151) (-2151.288) * [-2152.615] (-2168.424) (-2153.726) (-2156.249) -- 0:02:02
344000 -- [-2158.583] (-2154.696) (-2159.037) (-2151.734) * (-2155.138) (-2156.313) [-2153.978] (-2151.057) -- 0:02:02
344500 -- (-2154.776) (-2152.858) [-2162.397] (-2152.860) * (-2152.398) (-2154.358) [-2147.763] (-2150.078) -- 0:02:01
345000 -- (-2155.621) (-2158.668) [-2150.069] (-2153.645) * [-2149.578] (-2153.897) (-2149.178) (-2153.917) -- 0:02:01
Average standard deviation of split frequencies: 0.000681
345500 -- (-2153.878) (-2151.876) [-2150.221] (-2154.864) * (-2156.218) (-2151.195) [-2152.289] (-2156.799) -- 0:02:01
346000 -- [-2158.272] (-2152.628) (-2152.129) (-2157.847) * [-2152.142] (-2149.408) (-2152.516) (-2154.227) -- 0:02:00
346500 -- (-2159.850) (-2157.401) (-2154.160) [-2151.896] * (-2149.778) (-2149.395) (-2148.902) [-2151.781] -- 0:02:00
347000 -- (-2148.575) (-2154.544) [-2156.643] (-2149.662) * (-2148.652) (-2152.052) [-2154.209] (-2152.739) -- 0:02:00
347500 -- (-2146.996) (-2166.479) (-2153.455) [-2158.937] * (-2152.866) (-2155.486) (-2157.600) [-2153.779] -- 0:02:00
348000 -- (-2152.289) (-2155.277) (-2159.838) [-2155.157] * (-2150.586) [-2147.007] (-2154.880) (-2155.179) -- 0:01:59
348500 -- (-2152.711) (-2150.334) (-2160.720) [-2153.522] * [-2152.650] (-2162.417) (-2154.203) (-2154.559) -- 0:01:59
349000 -- (-2148.866) (-2160.030) [-2153.938] (-2151.796) * (-2150.238) [-2153.315] (-2159.183) (-2149.855) -- 0:02:01
349500 -- (-2153.968) (-2155.235) [-2152.037] (-2156.047) * (-2156.651) [-2151.876] (-2155.182) (-2157.039) -- 0:02:00
350000 -- [-2151.812] (-2152.305) (-2151.650) (-2155.913) * (-2158.111) [-2150.823] (-2160.236) (-2154.581) -- 0:02:00
Average standard deviation of split frequencies: 0.000672
350500 -- (-2150.199) [-2151.015] (-2149.689) (-2159.635) * [-2147.610] (-2158.767) (-2159.617) (-2151.226) -- 0:02:00
351000 -- (-2153.352) (-2150.953) [-2150.682] (-2158.465) * (-2153.469) (-2153.495) (-2158.425) [-2151.377] -- 0:02:00
351500 -- (-2150.386) [-2152.518] (-2158.060) (-2155.944) * (-2152.173) [-2152.093] (-2156.339) (-2154.563) -- 0:01:59
352000 -- (-2151.294) (-2159.066) [-2149.912] (-2151.549) * (-2154.741) (-2162.415) (-2161.182) [-2150.712] -- 0:01:59
352500 -- (-2157.765) (-2156.851) [-2154.863] (-2157.202) * (-2154.878) (-2160.163) (-2153.308) [-2151.570] -- 0:01:59
353000 -- (-2153.632) [-2160.379] (-2152.859) (-2151.978) * (-2158.163) [-2157.644] (-2154.993) (-2151.268) -- 0:01:59
353500 -- [-2148.080] (-2155.233) (-2154.745) (-2149.785) * (-2158.228) [-2147.852] (-2153.996) (-2154.980) -- 0:01:58
354000 -- [-2147.707] (-2150.307) (-2158.598) (-2153.268) * (-2157.625) (-2150.808) (-2160.980) [-2149.620] -- 0:01:58
354500 -- (-2151.023) [-2149.105] (-2151.876) (-2151.869) * (-2158.296) (-2154.988) (-2156.691) [-2157.184] -- 0:02:00
355000 -- [-2152.212] (-2153.236) (-2156.466) (-2154.392) * (-2155.370) (-2153.365) (-2153.565) [-2151.124] -- 0:01:59
Average standard deviation of split frequencies: 0.000662
355500 -- [-2153.334] (-2154.328) (-2150.411) (-2152.563) * (-2153.264) [-2152.338] (-2158.221) (-2151.161) -- 0:01:59
356000 -- (-2156.073) (-2152.250) [-2147.901] (-2150.516) * (-2157.291) (-2149.056) (-2165.416) [-2153.838] -- 0:01:59
356500 -- [-2155.739] (-2156.159) (-2154.937) (-2147.901) * (-2164.388) (-2150.931) (-2159.025) [-2154.146] -- 0:01:59
357000 -- [-2150.816] (-2153.305) (-2150.738) (-2153.873) * [-2154.653] (-2156.946) (-2171.375) (-2152.936) -- 0:01:58
357500 -- (-2152.723) (-2150.487) (-2149.987) [-2153.186] * (-2159.014) (-2149.586) (-2164.457) [-2147.801] -- 0:01:58
358000 -- [-2152.383] (-2150.635) (-2153.224) (-2149.702) * [-2151.098] (-2159.321) (-2154.299) (-2155.471) -- 0:01:58
358500 -- (-2148.723) (-2150.269) [-2153.316] (-2155.460) * [-2151.317] (-2152.298) (-2155.566) (-2152.988) -- 0:01:58
359000 -- (-2150.551) [-2156.336] (-2150.720) (-2157.805) * (-2155.419) (-2154.291) [-2152.812] (-2153.007) -- 0:01:57
359500 -- (-2149.085) [-2155.195] (-2149.909) (-2155.023) * (-2156.878) (-2155.082) (-2150.163) [-2147.543] -- 0:01:57
360000 -- (-2154.795) [-2149.358] (-2149.166) (-2148.334) * (-2154.873) (-2150.430) [-2155.458] (-2148.835) -- 0:01:59
Average standard deviation of split frequencies: 0.000654
360500 -- (-2152.950) (-2158.384) (-2152.289) [-2150.080] * (-2152.895) [-2149.889] (-2152.050) (-2151.204) -- 0:01:58
361000 -- (-2153.910) (-2165.529) [-2150.692] (-2149.719) * [-2151.390] (-2150.701) (-2150.854) (-2153.956) -- 0:01:58
361500 -- (-2149.779) [-2147.076] (-2156.603) (-2151.975) * (-2151.959) [-2148.635] (-2151.865) (-2150.174) -- 0:01:58
362000 -- (-2156.842) [-2151.686] (-2151.381) (-2150.731) * (-2155.177) (-2152.525) [-2150.853] (-2148.604) -- 0:01:58
362500 -- (-2156.636) (-2147.604) [-2147.560] (-2149.554) * (-2153.111) (-2152.624) (-2149.973) [-2157.817] -- 0:01:57
363000 -- (-2151.756) (-2148.788) [-2151.329] (-2151.560) * (-2148.894) (-2153.998) [-2155.321] (-2151.358) -- 0:01:57
363500 -- (-2147.719) [-2150.741] (-2151.791) (-2150.934) * (-2148.310) (-2154.756) [-2150.634] (-2152.210) -- 0:01:57
364000 -- (-2159.613) (-2154.455) (-2150.939) [-2151.557] * (-2153.925) (-2156.541) (-2153.084) [-2152.463] -- 0:01:57
364500 -- [-2150.048] (-2156.832) (-2148.898) (-2152.531) * (-2156.280) (-2164.420) (-2158.478) [-2152.526] -- 0:01:56
365000 -- (-2156.315) (-2157.983) (-2155.466) [-2153.664] * [-2152.487] (-2159.768) (-2161.401) (-2152.247) -- 0:01:56
Average standard deviation of split frequencies: 0.000644
365500 -- (-2154.911) [-2154.760] (-2152.917) (-2149.803) * (-2162.097) (-2156.096) (-2149.696) [-2150.347] -- 0:01:58
366000 -- [-2151.774] (-2155.359) (-2150.339) (-2153.561) * (-2159.115) (-2160.727) [-2149.240] (-2151.198) -- 0:01:57
366500 -- (-2158.861) (-2151.624) [-2153.345] (-2156.203) * [-2150.517] (-2156.702) (-2152.551) (-2165.003) -- 0:01:57
367000 -- [-2149.740] (-2157.373) (-2150.541) (-2152.029) * (-2152.326) [-2149.775] (-2152.562) (-2158.418) -- 0:01:57
367500 -- (-2149.927) [-2158.520] (-2148.436) (-2154.367) * [-2154.316] (-2153.568) (-2155.058) (-2154.383) -- 0:01:57
368000 -- (-2150.033) (-2150.664) (-2151.505) [-2149.418] * [-2152.690] (-2157.133) (-2155.706) (-2152.262) -- 0:01:56
368500 -- (-2150.907) (-2157.417) (-2151.442) [-2150.801] * (-2152.320) (-2151.486) [-2153.420] (-2151.240) -- 0:01:56
369000 -- (-2154.126) (-2151.805) (-2146.058) [-2150.951] * (-2150.730) (-2149.911) [-2148.455] (-2158.774) -- 0:01:56
369500 -- [-2160.233] (-2153.393) (-2152.285) (-2153.136) * (-2156.350) [-2154.102] (-2149.600) (-2150.863) -- 0:01:56
370000 -- (-2158.318) (-2149.588) (-2149.587) [-2151.433] * (-2149.630) (-2154.796) [-2152.529] (-2151.372) -- 0:01:55
Average standard deviation of split frequencies: 0.000636
370500 -- (-2152.020) (-2151.447) (-2152.894) [-2157.177] * (-2156.114) (-2154.341) [-2148.859] (-2151.688) -- 0:01:57
371000 -- (-2160.272) (-2150.720) [-2151.953] (-2149.223) * (-2155.112) (-2156.188) (-2150.466) [-2154.032] -- 0:01:56
371500 -- (-2155.478) (-2152.806) (-2156.147) [-2146.982] * (-2152.870) (-2156.723) [-2154.736] (-2151.498) -- 0:01:56
372000 -- (-2152.167) (-2149.417) (-2149.821) [-2150.698] * (-2153.943) (-2155.927) (-2150.813) [-2152.095] -- 0:01:56
372500 -- (-2155.089) (-2151.195) (-2152.460) [-2154.765] * (-2150.157) (-2155.085) (-2150.519) [-2150.803] -- 0:01:56
373000 -- (-2155.874) (-2148.880) (-2153.851) [-2149.795] * [-2155.021] (-2153.887) (-2149.862) (-2152.701) -- 0:01:55
373500 -- (-2153.096) (-2155.508) (-2151.675) [-2151.639] * [-2147.432] (-2151.735) (-2155.479) (-2155.791) -- 0:01:55
374000 -- (-2157.179) (-2153.514) (-2151.085) [-2152.962] * [-2153.022] (-2152.627) (-2157.803) (-2150.611) -- 0:01:55
374500 -- (-2160.585) (-2151.601) (-2152.376) [-2155.836] * [-2153.684] (-2157.616) (-2151.015) (-2148.953) -- 0:01:55
375000 -- [-2152.234] (-2158.630) (-2154.884) (-2151.226) * (-2156.369) (-2152.808) (-2156.913) [-2149.623] -- 0:01:55
Average standard deviation of split frequencies: 0.000627
375500 -- (-2156.388) [-2153.978] (-2157.133) (-2158.224) * (-2158.424) (-2153.124) (-2160.222) [-2152.279] -- 0:01:54
376000 -- (-2155.753) (-2153.246) (-2153.984) [-2151.916] * (-2155.371) (-2156.861) (-2157.678) [-2151.327] -- 0:01:56
376500 -- (-2159.297) (-2147.026) (-2152.900) [-2153.869] * (-2157.673) [-2149.287] (-2156.259) (-2163.740) -- 0:01:55
377000 -- (-2157.150) (-2158.149) (-2155.219) [-2158.524] * [-2157.582] (-2154.637) (-2156.138) (-2151.473) -- 0:01:55
377500 -- (-2152.138) [-2147.931] (-2161.373) (-2156.609) * (-2155.007) [-2150.728] (-2154.909) (-2154.473) -- 0:01:55
378000 -- (-2149.972) (-2146.323) (-2161.413) [-2152.527] * (-2154.212) [-2148.931] (-2153.417) (-2156.615) -- 0:01:55
378500 -- (-2151.337) (-2153.852) (-2157.949) [-2153.498] * (-2164.939) [-2149.924] (-2149.741) (-2156.759) -- 0:01:54
379000 -- (-2156.218) (-2155.555) (-2159.620) [-2152.997] * (-2165.567) [-2148.868] (-2149.852) (-2154.610) -- 0:01:54
379500 -- (-2150.353) [-2151.451] (-2158.176) (-2158.287) * (-2161.279) [-2152.288] (-2151.437) (-2152.811) -- 0:01:54
380000 -- (-2148.021) (-2155.070) (-2151.008) [-2150.469] * (-2153.139) (-2152.210) (-2151.606) [-2152.388] -- 0:01:54
Average standard deviation of split frequencies: 0.000619
380500 -- (-2151.041) [-2153.830] (-2154.470) (-2153.062) * (-2146.772) (-2154.873) (-2149.676) [-2152.625] -- 0:01:53
381000 -- (-2156.807) [-2147.494] (-2153.073) (-2151.339) * [-2152.229] (-2153.910) (-2149.607) (-2155.286) -- 0:01:53
381500 -- [-2151.519] (-2150.078) (-2148.258) (-2154.095) * (-2152.203) [-2153.914] (-2159.837) (-2153.784) -- 0:01:55
382000 -- (-2151.267) (-2149.207) (-2158.704) [-2153.587] * [-2152.567] (-2154.788) (-2153.814) (-2166.093) -- 0:01:54
382500 -- (-2153.567) (-2154.743) [-2147.962] (-2151.726) * (-2159.049) (-2150.220) (-2155.247) [-2156.580] -- 0:01:54
383000 -- (-2153.968) (-2152.067) [-2153.269] (-2154.337) * (-2154.875) [-2150.741] (-2156.872) (-2153.338) -- 0:01:54
383500 -- (-2150.030) [-2151.959] (-2153.821) (-2151.452) * (-2149.363) [-2153.885] (-2149.785) (-2153.258) -- 0:01:54
384000 -- (-2149.587) (-2156.120) [-2151.021] (-2152.978) * (-2152.657) (-2151.047) [-2153.372] (-2154.339) -- 0:01:53
384500 -- (-2149.709) (-2153.658) [-2151.005] (-2152.889) * (-2148.251) (-2152.216) [-2150.201] (-2158.716) -- 0:01:53
385000 -- (-2156.647) [-2152.295] (-2154.061) (-2152.902) * [-2149.945] (-2151.818) (-2149.296) (-2151.651) -- 0:01:53
Average standard deviation of split frequencies: 0.000611
385500 -- [-2149.813] (-2159.112) (-2153.197) (-2150.394) * (-2151.970) [-2154.482] (-2153.285) (-2158.186) -- 0:01:53
386000 -- [-2149.991] (-2156.365) (-2149.355) (-2154.057) * [-2149.365] (-2155.377) (-2152.073) (-2158.221) -- 0:01:52
386500 -- (-2151.839) (-2157.704) (-2152.496) [-2152.636] * (-2153.136) (-2157.448) (-2153.631) [-2154.368] -- 0:01:52
387000 -- (-2149.878) (-2148.928) [-2155.479] (-2159.213) * [-2156.605] (-2158.308) (-2155.640) (-2150.823) -- 0:01:54
387500 -- (-2149.324) (-2160.118) [-2151.366] (-2150.821) * (-2149.292) (-2159.962) (-2151.969) [-2149.948] -- 0:01:53
388000 -- (-2151.842) (-2161.822) (-2155.502) [-2149.200] * (-2156.830) [-2154.169] (-2155.466) (-2154.645) -- 0:01:53
388500 -- [-2149.493] (-2158.415) (-2149.775) (-2152.211) * (-2153.703) (-2154.583) [-2148.143] (-2152.244) -- 0:01:53
389000 -- (-2159.772) (-2150.525) [-2157.262] (-2150.260) * (-2149.606) [-2149.304] (-2157.356) (-2149.999) -- 0:01:53
389500 -- (-2153.686) (-2156.521) (-2151.752) [-2149.606] * [-2149.142] (-2150.489) (-2153.365) (-2156.393) -- 0:01:52
390000 -- [-2149.312] (-2147.928) (-2151.999) (-2155.353) * [-2155.984] (-2147.676) (-2148.342) (-2150.355) -- 0:01:52
Average standard deviation of split frequencies: 0.000603
390500 -- (-2158.969) (-2155.006) (-2151.377) [-2159.111] * (-2153.557) (-2157.210) [-2155.503] (-2149.918) -- 0:01:52
391000 -- (-2155.729) (-2163.948) [-2152.633] (-2153.314) * (-2154.863) (-2158.953) (-2158.637) [-2149.609] -- 0:01:52
391500 -- (-2161.603) (-2156.245) (-2156.939) [-2152.452] * (-2151.057) (-2153.359) (-2160.118) [-2149.569] -- 0:01:51
392000 -- (-2161.975) (-2156.196) (-2158.688) [-2156.397] * (-2154.623) (-2153.936) (-2156.528) [-2150.581] -- 0:01:51
392500 -- (-2157.661) (-2153.612) [-2158.861] (-2151.281) * (-2151.472) (-2151.994) [-2152.767] (-2152.338) -- 0:01:52
393000 -- (-2156.244) (-2154.629) (-2163.661) [-2147.764] * (-2152.867) [-2147.752] (-2156.480) (-2151.129) -- 0:01:52
393500 -- (-2157.769) (-2156.107) (-2159.494) [-2149.792] * (-2152.776) (-2148.803) [-2157.117] (-2151.215) -- 0:01:52
394000 -- (-2153.424) (-2149.621) [-2152.588] (-2151.023) * (-2150.674) (-2153.502) (-2157.989) [-2152.618] -- 0:01:52
394500 -- (-2150.574) (-2149.125) [-2154.498] (-2159.218) * (-2147.880) (-2151.426) [-2156.178] (-2150.736) -- 0:01:52
395000 -- (-2159.067) [-2149.073] (-2155.515) (-2150.848) * (-2149.998) (-2152.611) [-2150.550] (-2153.024) -- 0:01:51
Average standard deviation of split frequencies: 0.000595
395500 -- [-2152.360] (-2151.047) (-2152.173) (-2147.100) * (-2153.698) (-2153.758) [-2156.874] (-2152.339) -- 0:01:51
396000 -- [-2151.795] (-2160.418) (-2147.748) (-2149.571) * (-2150.125) [-2150.002] (-2151.951) (-2156.239) -- 0:01:51
396500 -- (-2147.778) (-2154.363) (-2159.352) [-2152.143] * (-2151.469) [-2154.461] (-2149.569) (-2155.262) -- 0:01:51
397000 -- (-2154.421) (-2151.743) (-2156.930) [-2152.305] * (-2153.262) (-2150.163) [-2149.745] (-2156.263) -- 0:01:50
397500 -- (-2151.284) (-2157.970) (-2158.222) [-2154.686] * (-2151.541) (-2155.880) [-2149.738] (-2149.661) -- 0:01:50
398000 -- (-2149.924) (-2158.243) (-2151.829) [-2154.215] * (-2153.259) (-2152.895) (-2153.078) [-2149.179] -- 0:01:51
398500 -- (-2151.057) (-2155.911) (-2153.774) [-2150.722] * [-2153.820] (-2153.045) (-2153.740) (-2152.418) -- 0:01:51
399000 -- (-2154.870) (-2155.462) [-2151.250] (-2154.947) * (-2148.914) [-2152.399] (-2155.726) (-2151.673) -- 0:01:51
399500 -- (-2150.953) [-2155.490] (-2153.597) (-2158.404) * (-2153.936) (-2152.922) (-2150.077) [-2152.172] -- 0:01:51
400000 -- (-2157.459) (-2157.557) (-2157.132) [-2151.291] * [-2148.136] (-2156.769) (-2152.841) (-2154.074) -- 0:01:51
Average standard deviation of split frequencies: 0.000588
400500 -- [-2150.074] (-2153.958) (-2152.248) (-2158.615) * [-2150.788] (-2153.720) (-2152.934) (-2150.571) -- 0:01:50
401000 -- (-2151.135) (-2161.849) [-2155.405] (-2154.948) * [-2151.104] (-2160.356) (-2156.947) (-2153.470) -- 0:01:50
401500 -- (-2150.283) [-2154.389] (-2150.789) (-2153.852) * (-2155.068) (-2160.362) [-2152.267] (-2152.061) -- 0:01:50
402000 -- (-2155.940) (-2153.336) (-2149.871) [-2155.484] * (-2151.928) (-2149.653) (-2153.146) [-2155.494] -- 0:01:50
402500 -- (-2152.138) (-2152.258) (-2152.616) [-2151.928] * [-2152.281] (-2151.373) (-2153.396) (-2152.893) -- 0:01:49
403000 -- (-2155.301) [-2152.167] (-2154.158) (-2159.871) * [-2149.649] (-2150.058) (-2152.134) (-2153.937) -- 0:01:51
403500 -- [-2150.673] (-2152.929) (-2151.051) (-2152.437) * (-2152.143) [-2151.000] (-2148.538) (-2151.341) -- 0:01:50
404000 -- (-2160.395) (-2157.001) (-2157.123) [-2155.944] * [-2148.150] (-2152.538) (-2154.351) (-2153.216) -- 0:01:50
404500 -- (-2155.199) (-2153.879) [-2152.744] (-2155.941) * (-2150.424) [-2149.389] (-2156.991) (-2154.777) -- 0:01:50
405000 -- (-2159.169) (-2152.315) (-2158.291) [-2152.451] * (-2160.498) (-2153.567) (-2149.168) [-2153.132] -- 0:01:50
Average standard deviation of split frequencies: 0.000581
405500 -- (-2159.378) (-2149.287) [-2152.296] (-2156.479) * (-2152.788) (-2152.952) (-2169.546) [-2150.074] -- 0:01:49
406000 -- (-2153.642) [-2148.374] (-2152.936) (-2156.507) * [-2150.922] (-2150.212) (-2157.411) (-2155.809) -- 0:01:49
406500 -- (-2152.891) [-2150.743] (-2154.666) (-2151.888) * (-2151.024) (-2149.748) (-2154.686) [-2150.967] -- 0:01:49
407000 -- (-2151.802) (-2153.692) (-2152.698) [-2151.280] * (-2148.196) (-2147.560) (-2156.917) [-2147.137] -- 0:01:49
407500 -- (-2160.248) (-2147.813) [-2153.067] (-2151.910) * (-2152.644) (-2153.885) (-2148.235) [-2154.230] -- 0:01:49
408000 -- (-2155.357) (-2157.991) (-2152.770) [-2157.471] * (-2153.001) (-2153.696) (-2158.614) [-2153.498] -- 0:01:48
408500 -- (-2157.517) [-2153.739] (-2156.023) (-2152.595) * [-2161.242] (-2149.813) (-2158.940) (-2155.999) -- 0:01:50
409000 -- (-2154.017) (-2156.743) (-2153.774) [-2152.703] * (-2169.172) [-2150.469] (-2154.073) (-2151.449) -- 0:01:49
409500 -- (-2154.139) (-2149.334) [-2157.589] (-2159.211) * (-2154.713) (-2150.267) (-2154.496) [-2151.056] -- 0:01:49
410000 -- (-2160.689) [-2151.513] (-2158.722) (-2164.511) * (-2157.612) [-2153.287] (-2154.446) (-2153.617) -- 0:01:49
Average standard deviation of split frequencies: 0.000574
410500 -- (-2163.446) [-2152.486] (-2154.457) (-2164.241) * (-2153.200) (-2155.422) (-2153.868) [-2151.581] -- 0:01:49
411000 -- (-2156.829) [-2150.997] (-2152.798) (-2154.109) * (-2155.819) [-2149.737] (-2154.738) (-2154.777) -- 0:01:48
411500 -- [-2148.938] (-2160.505) (-2155.026) (-2154.132) * (-2158.626) (-2147.670) (-2153.645) [-2153.917] -- 0:01:48
412000 -- (-2152.261) (-2152.862) (-2152.062) [-2154.633] * (-2159.272) [-2156.965] (-2158.819) (-2159.007) -- 0:01:48
412500 -- (-2149.466) (-2157.809) [-2152.421] (-2148.592) * (-2161.172) (-2154.867) [-2156.079] (-2154.891) -- 0:01:48
413000 -- [-2157.097] (-2150.546) (-2154.962) (-2156.480) * (-2159.274) (-2158.969) [-2147.943] (-2158.051) -- 0:01:48
413500 -- (-2154.267) (-2151.203) [-2148.521] (-2148.835) * [-2155.782] (-2156.010) (-2153.063) (-2151.296) -- 0:01:47
414000 -- (-2149.231) [-2152.757] (-2154.623) (-2149.663) * (-2151.683) (-2152.586) [-2151.478] (-2155.976) -- 0:01:48
414500 -- (-2156.773) (-2151.836) [-2150.511] (-2151.285) * (-2154.921) (-2154.809) (-2148.605) [-2149.064] -- 0:01:48
415000 -- (-2162.574) (-2150.654) [-2154.479] (-2150.819) * [-2147.342] (-2154.580) (-2152.408) (-2156.279) -- 0:01:48
Average standard deviation of split frequencies: 0.000567
415500 -- (-2151.179) [-2146.961] (-2153.805) (-2151.954) * (-2150.866) [-2151.861] (-2153.166) (-2154.224) -- 0:01:48
416000 -- (-2154.141) (-2147.331) (-2154.635) [-2156.403] * [-2151.981] (-2150.249) (-2152.871) (-2148.807) -- 0:01:48
416500 -- [-2148.654] (-2151.673) (-2155.519) (-2155.834) * (-2152.942) (-2158.404) [-2153.795] (-2149.503) -- 0:01:47
417000 -- (-2151.257) (-2152.106) [-2151.683] (-2153.133) * (-2156.229) [-2161.787] (-2150.126) (-2162.466) -- 0:01:47
417500 -- (-2152.234) (-2152.712) [-2153.782] (-2154.660) * (-2164.454) [-2154.868] (-2147.190) (-2154.468) -- 0:01:47
418000 -- (-2155.180) (-2148.500) (-2153.040) [-2151.101] * (-2158.494) (-2158.080) [-2152.780] (-2158.158) -- 0:01:47
418500 -- (-2158.747) (-2149.367) (-2152.454) [-2152.883] * (-2154.792) [-2155.099] (-2149.232) (-2156.081) -- 0:01:46
419000 -- (-2153.665) (-2157.933) [-2154.057] (-2152.864) * (-2155.476) (-2159.596) [-2156.153] (-2157.907) -- 0:01:46
419500 -- (-2156.356) (-2150.633) [-2151.364] (-2150.464) * (-2155.281) (-2163.420) [-2149.266] (-2161.353) -- 0:01:47
420000 -- (-2150.073) [-2149.951] (-2151.976) (-2153.648) * (-2150.848) (-2156.528) (-2152.546) [-2149.722] -- 0:01:47
Average standard deviation of split frequencies: 0.000560
420500 -- [-2152.551] (-2152.102) (-2157.723) (-2152.545) * [-2151.293] (-2155.468) (-2156.687) (-2157.072) -- 0:01:47
421000 -- [-2151.910] (-2157.464) (-2150.046) (-2154.578) * (-2153.211) [-2150.625] (-2154.614) (-2152.340) -- 0:01:47
421500 -- (-2154.717) (-2157.403) (-2146.763) [-2161.091] * (-2148.573) [-2154.484] (-2152.522) (-2152.293) -- 0:01:47
422000 -- [-2150.395] (-2156.821) (-2152.628) (-2152.230) * (-2151.678) (-2153.819) [-2152.061] (-2153.397) -- 0:01:46
422500 -- (-2151.682) [-2150.039] (-2152.298) (-2159.143) * [-2147.317] (-2153.429) (-2158.613) (-2157.398) -- 0:01:46
423000 -- (-2149.566) [-2149.970] (-2152.549) (-2154.134) * (-2154.156) [-2155.331] (-2153.961) (-2160.773) -- 0:01:46
423500 -- (-2150.570) [-2150.699] (-2160.774) (-2150.539) * (-2151.843) (-2150.509) (-2150.897) [-2156.159] -- 0:01:46
424000 -- (-2153.098) (-2154.310) [-2148.568] (-2150.797) * (-2148.257) (-2155.151) [-2153.371] (-2164.449) -- 0:01:45
424500 -- (-2157.811) (-2160.032) (-2146.668) [-2151.206] * (-2148.946) [-2149.788] (-2152.687) (-2151.802) -- 0:01:45
425000 -- (-2157.551) (-2153.191) (-2146.944) [-2154.622] * [-2150.897] (-2161.084) (-2150.927) (-2147.084) -- 0:01:46
Average standard deviation of split frequencies: 0.000553
425500 -- (-2153.937) [-2152.056] (-2152.118) (-2149.900) * (-2150.444) (-2155.115) (-2154.938) [-2147.052] -- 0:01:46
426000 -- (-2155.126) (-2162.166) [-2152.202] (-2149.731) * (-2155.348) (-2153.333) [-2151.384] (-2153.736) -- 0:01:46
426500 -- (-2153.782) (-2156.786) [-2154.355] (-2155.553) * (-2156.592) (-2155.831) (-2153.956) [-2149.550] -- 0:01:46
427000 -- [-2151.301] (-2156.456) (-2156.545) (-2158.253) * [-2150.351] (-2149.235) (-2151.096) (-2148.825) -- 0:01:46
427500 -- (-2149.465) (-2151.859) (-2153.436) [-2151.359] * [-2154.649] (-2152.886) (-2155.500) (-2152.636) -- 0:01:45
428000 -- (-2150.776) (-2160.032) [-2154.132] (-2153.031) * [-2150.794] (-2160.242) (-2154.715) (-2154.166) -- 0:01:45
428500 -- [-2156.475] (-2153.804) (-2157.345) (-2148.894) * (-2150.137) (-2155.878) [-2150.472] (-2151.889) -- 0:01:45
429000 -- (-2148.825) (-2158.150) (-2156.514) [-2151.318] * [-2151.586] (-2157.621) (-2151.331) (-2160.785) -- 0:01:45
429500 -- (-2152.681) (-2149.294) [-2156.710] (-2156.771) * (-2149.422) (-2166.991) (-2152.265) [-2155.259] -- 0:01:44
430000 -- [-2151.038] (-2152.576) (-2154.309) (-2150.710) * (-2148.838) [-2161.156] (-2150.985) (-2160.565) -- 0:01:44
Average standard deviation of split frequencies: 0.000547
430500 -- (-2154.777) [-2150.808] (-2148.049) (-2155.049) * (-2149.593) (-2163.068) [-2158.458] (-2154.997) -- 0:01:45
431000 -- (-2166.800) (-2156.989) (-2154.568) [-2151.622] * (-2155.450) (-2159.433) (-2166.473) [-2150.559] -- 0:01:45
431500 -- (-2153.110) (-2150.725) [-2154.417] (-2161.199) * [-2152.802] (-2149.627) (-2156.095) (-2145.313) -- 0:01:45
432000 -- (-2157.123) [-2150.002] (-2152.090) (-2152.718) * [-2147.379] (-2150.190) (-2148.058) (-2153.562) -- 0:01:45
432500 -- (-2149.992) [-2146.445] (-2152.999) (-2152.284) * (-2147.331) (-2154.022) [-2151.648] (-2150.214) -- 0:01:44
433000 -- [-2149.880] (-2149.627) (-2156.045) (-2151.926) * (-2155.549) (-2149.041) [-2150.490] (-2149.741) -- 0:01:44
433500 -- (-2150.739) (-2155.618) [-2149.119] (-2158.889) * (-2154.963) [-2149.521] (-2154.537) (-2160.231) -- 0:01:44
434000 -- (-2152.562) (-2154.913) (-2162.368) [-2152.247] * (-2152.479) (-2149.894) (-2156.751) [-2155.038] -- 0:01:44
434500 -- (-2153.722) (-2158.333) (-2158.565) [-2147.517] * (-2148.793) (-2147.080) [-2154.671] (-2149.963) -- 0:01:44
435000 -- (-2150.941) (-2163.964) (-2152.880) [-2150.867] * (-2152.366) [-2147.123] (-2153.649) (-2151.301) -- 0:01:43
Average standard deviation of split frequencies: 0.000541
435500 -- [-2154.068] (-2153.500) (-2155.419) (-2151.694) * (-2157.080) [-2154.425] (-2162.598) (-2149.970) -- 0:01:43
436000 -- (-2150.655) (-2151.657) [-2159.898] (-2148.643) * [-2154.864] (-2156.580) (-2157.978) (-2154.978) -- 0:01:44
436500 -- (-2151.367) (-2152.106) (-2156.375) [-2151.856] * (-2149.161) [-2154.392] (-2161.438) (-2151.282) -- 0:01:44
437000 -- (-2151.986) (-2149.357) (-2158.657) [-2154.361] * (-2158.288) (-2156.168) (-2156.239) [-2152.843] -- 0:01:44
437500 -- (-2156.047) (-2152.593) [-2149.451] (-2152.926) * (-2152.365) (-2148.717) (-2162.433) [-2154.752] -- 0:01:44
438000 -- [-2153.473] (-2153.008) (-2158.932) (-2160.074) * (-2149.331) (-2150.762) [-2154.403] (-2162.287) -- 0:01:43
438500 -- (-2154.921) (-2153.302) (-2153.439) [-2153.191] * (-2151.304) (-2151.463) [-2152.949] (-2155.207) -- 0:01:43
439000 -- (-2150.086) (-2154.478) (-2151.905) [-2154.216] * (-2155.981) [-2152.485] (-2150.670) (-2153.424) -- 0:01:43
439500 -- (-2153.968) (-2153.877) [-2149.666] (-2158.148) * (-2158.113) (-2152.186) [-2155.001] (-2160.884) -- 0:01:43
440000 -- (-2158.234) [-2154.597] (-2151.342) (-2151.946) * [-2152.000] (-2159.668) (-2157.474) (-2155.381) -- 0:01:43
Average standard deviation of split frequencies: 0.000535
440500 -- (-2154.035) [-2150.207] (-2151.476) (-2149.713) * (-2149.749) (-2159.480) [-2152.464] (-2153.464) -- 0:01:42
441000 -- (-2148.041) [-2153.621] (-2152.523) (-2148.027) * (-2157.964) (-2153.590) [-2153.013] (-2153.116) -- 0:01:42
441500 -- (-2148.315) [-2152.169] (-2157.297) (-2153.830) * [-2153.294] (-2151.440) (-2150.255) (-2155.683) -- 0:01:43
442000 -- [-2148.424] (-2161.372) (-2157.581) (-2154.963) * [-2150.813] (-2155.332) (-2155.264) (-2149.658) -- 0:01:43
442500 -- (-2153.132) [-2148.373] (-2149.439) (-2154.738) * (-2155.344) (-2148.695) (-2152.605) [-2150.751] -- 0:01:43
443000 -- [-2152.789] (-2148.884) (-2151.098) (-2151.205) * (-2156.989) (-2147.848) [-2164.677] (-2151.336) -- 0:01:43
443500 -- (-2152.731) (-2158.831) (-2155.102) [-2153.717] * (-2151.491) (-2151.613) (-2159.774) [-2150.669] -- 0:01:42
444000 -- (-2151.733) (-2150.509) [-2156.144] (-2151.808) * (-2154.441) [-2154.958] (-2153.170) (-2149.080) -- 0:01:42
444500 -- (-2150.636) (-2151.324) [-2152.302] (-2147.800) * (-2154.423) (-2152.765) (-2161.191) [-2157.316] -- 0:01:42
445000 -- (-2153.221) (-2151.698) (-2155.192) [-2148.454] * (-2154.547) (-2154.560) [-2153.808] (-2151.012) -- 0:01:42
Average standard deviation of split frequencies: 0.000528
445500 -- (-2151.944) [-2150.933] (-2152.877) (-2148.850) * (-2153.083) (-2152.028) [-2152.438] (-2151.685) -- 0:01:42
446000 -- [-2153.498] (-2153.868) (-2160.212) (-2156.601) * (-2156.570) (-2155.411) (-2153.587) [-2149.133] -- 0:01:41
446500 -- (-2157.818) (-2153.941) (-2154.037) [-2157.943] * [-2151.497] (-2151.141) (-2147.788) (-2154.291) -- 0:01:42
447000 -- (-2149.860) (-2152.016) (-2149.691) [-2152.375] * (-2152.281) [-2150.399] (-2151.917) (-2161.916) -- 0:01:42
447500 -- (-2151.785) (-2150.701) [-2150.416] (-2149.144) * (-2150.744) (-2150.342) (-2150.481) [-2153.656] -- 0:01:42
448000 -- (-2151.887) (-2149.907) (-2152.717) [-2154.933] * (-2152.484) [-2148.829] (-2160.008) (-2156.029) -- 0:01:42
448500 -- (-2150.253) (-2153.573) [-2148.596] (-2154.509) * [-2151.353] (-2156.812) (-2151.469) (-2150.975) -- 0:01:42
449000 -- [-2159.261] (-2147.249) (-2156.666) (-2153.038) * (-2155.752) (-2154.649) (-2155.902) [-2148.927] -- 0:01:41
449500 -- [-2152.451] (-2153.969) (-2156.889) (-2151.837) * (-2156.056) (-2150.793) (-2155.382) [-2147.362] -- 0:01:41
450000 -- (-2156.918) (-2150.560) (-2155.942) [-2149.651] * (-2152.491) (-2150.864) [-2153.667] (-2156.456) -- 0:01:41
Average standard deviation of split frequencies: 0.000523
450500 -- [-2149.910] (-2155.987) (-2153.298) (-2150.885) * [-2152.150] (-2150.117) (-2147.066) (-2148.975) -- 0:01:41
451000 -- (-2154.641) (-2158.138) (-2153.318) [-2149.043] * [-2154.530] (-2150.939) (-2160.758) (-2148.969) -- 0:01:41
451500 -- (-2151.943) [-2149.724] (-2161.064) (-2155.320) * (-2157.791) (-2154.226) [-2154.406] (-2151.206) -- 0:01:40
452000 -- [-2155.502] (-2148.707) (-2154.014) (-2150.470) * (-2158.308) (-2154.011) (-2154.127) [-2156.193] -- 0:01:41
452500 -- (-2162.010) [-2156.403] (-2154.586) (-2150.356) * (-2158.057) (-2150.291) [-2157.512] (-2152.318) -- 0:01:41
453000 -- (-2159.440) (-2156.956) [-2152.261] (-2155.189) * (-2161.532) (-2151.400) [-2155.631] (-2152.085) -- 0:01:41
453500 -- (-2152.751) [-2150.786] (-2151.499) (-2154.403) * (-2157.418) [-2151.201] (-2152.920) (-2150.319) -- 0:01:41
454000 -- (-2159.373) [-2154.666] (-2153.440) (-2151.773) * (-2151.842) (-2151.207) (-2153.963) [-2155.965] -- 0:01:41
454500 -- [-2153.269] (-2153.365) (-2162.049) (-2158.016) * (-2160.961) [-2147.353] (-2156.497) (-2159.985) -- 0:01:40
455000 -- (-2152.783) [-2155.078] (-2151.802) (-2149.117) * (-2156.819) [-2151.978] (-2155.581) (-2158.728) -- 0:01:40
Average standard deviation of split frequencies: 0.000517
455500 -- [-2147.871] (-2149.038) (-2148.377) (-2155.147) * (-2149.935) (-2154.612) (-2149.703) [-2155.670] -- 0:01:40
456000 -- (-2151.695) (-2156.394) [-2150.965] (-2152.662) * (-2146.795) (-2157.598) (-2150.383) [-2153.306] -- 0:01:40
456500 -- (-2150.151) (-2163.198) [-2151.541] (-2156.881) * [-2155.905] (-2158.547) (-2149.209) (-2157.475) -- 0:01:40
457000 -- [-2151.552] (-2151.732) (-2146.969) (-2154.701) * (-2151.133) (-2147.835) (-2151.754) [-2152.540] -- 0:01:39
457500 -- (-2155.892) (-2155.008) (-2154.017) [-2151.240] * (-2159.732) [-2148.286] (-2160.799) (-2159.884) -- 0:01:40
458000 -- (-2154.707) [-2151.937] (-2147.743) (-2159.801) * (-2153.914) [-2157.066] (-2153.227) (-2154.148) -- 0:01:40
458500 -- [-2152.023] (-2152.764) (-2150.772) (-2155.954) * (-2156.557) (-2156.092) (-2155.333) [-2156.127] -- 0:01:40
459000 -- (-2156.282) (-2152.871) [-2148.381] (-2153.199) * (-2155.383) (-2151.620) (-2160.102) [-2151.845] -- 0:01:40
459500 -- [-2156.019] (-2152.663) (-2154.638) (-2153.142) * (-2153.735) (-2159.633) [-2154.381] (-2162.638) -- 0:01:39
460000 -- (-2152.112) (-2156.560) (-2151.977) [-2150.422] * [-2152.148] (-2159.437) (-2150.540) (-2155.111) -- 0:01:39
Average standard deviation of split frequencies: 0.000512
460500 -- (-2165.291) (-2148.114) [-2152.805] (-2154.531) * (-2154.847) (-2154.251) (-2159.858) [-2151.141] -- 0:01:39
461000 -- (-2164.463) [-2149.127] (-2151.320) (-2161.480) * (-2149.425) (-2153.229) (-2152.202) [-2151.991] -- 0:01:39
461500 -- (-2156.962) (-2152.186) [-2151.175] (-2155.721) * (-2150.209) [-2151.570] (-2154.691) (-2152.299) -- 0:01:39
462000 -- [-2153.859] (-2150.284) (-2153.023) (-2153.495) * (-2150.782) (-2161.863) (-2153.124) [-2156.972] -- 0:01:38
462500 -- (-2160.771) (-2151.405) (-2153.954) [-2147.697] * [-2148.186] (-2154.702) (-2152.555) (-2154.845) -- 0:01:38
463000 -- (-2152.066) (-2155.796) (-2161.735) [-2152.626] * [-2156.253] (-2152.984) (-2162.433) (-2151.588) -- 0:01:39
463500 -- (-2151.496) (-2155.928) [-2153.072] (-2157.715) * (-2155.659) (-2154.178) (-2153.299) [-2155.656] -- 0:01:39
464000 -- (-2154.142) [-2149.905] (-2153.913) (-2156.178) * [-2147.566] (-2160.093) (-2154.497) (-2153.235) -- 0:01:39
464500 -- (-2152.384) (-2150.673) [-2149.990] (-2152.252) * (-2149.901) (-2151.786) [-2153.720] (-2155.355) -- 0:01:39
465000 -- (-2154.191) (-2152.822) [-2150.018] (-2151.535) * [-2148.574] (-2147.597) (-2150.544) (-2157.326) -- 0:01:38
Average standard deviation of split frequencies: 0.000506
465500 -- (-2154.578) (-2157.285) (-2149.025) [-2151.078] * (-2150.572) [-2153.412] (-2159.556) (-2160.643) -- 0:01:38
466000 -- (-2156.681) (-2159.185) (-2155.398) [-2150.768] * (-2153.601) [-2151.831] (-2154.515) (-2154.450) -- 0:01:38
466500 -- [-2154.731] (-2150.430) (-2149.459) (-2150.596) * [-2151.598] (-2158.638) (-2152.517) (-2156.475) -- 0:01:38
467000 -- (-2157.118) (-2150.926) [-2153.777] (-2149.176) * (-2154.363) [-2153.612] (-2154.640) (-2159.833) -- 0:01:38
467500 -- (-2152.963) [-2150.258] (-2153.415) (-2148.179) * (-2153.770) (-2152.074) [-2151.122] (-2148.570) -- 0:01:37
468000 -- [-2151.483] (-2150.708) (-2157.841) (-2158.636) * (-2151.408) (-2148.904) (-2154.235) [-2149.406] -- 0:01:38
468500 -- [-2156.368] (-2151.090) (-2164.002) (-2156.700) * [-2151.992] (-2154.069) (-2152.401) (-2150.186) -- 0:01:38
469000 -- (-2152.376) [-2152.786] (-2153.048) (-2155.386) * (-2148.122) [-2149.131] (-2161.308) (-2149.552) -- 0:01:38
469500 -- [-2153.165] (-2154.486) (-2156.879) (-2154.059) * (-2150.825) (-2156.416) (-2155.378) [-2151.093] -- 0:01:38
470000 -- (-2155.107) (-2155.847) (-2154.349) [-2153.745] * (-2153.177) [-2152.976] (-2154.248) (-2156.613) -- 0:01:38
Average standard deviation of split frequencies: 0.000501
470500 -- (-2156.614) [-2154.530] (-2161.162) (-2153.082) * (-2154.044) (-2154.525) [-2153.761] (-2161.744) -- 0:01:37
471000 -- [-2158.669] (-2152.502) (-2157.811) (-2153.608) * (-2150.021) (-2154.912) [-2155.544] (-2154.445) -- 0:01:37
471500 -- [-2157.571] (-2149.499) (-2153.776) (-2154.956) * (-2152.682) [-2157.676] (-2152.975) (-2156.572) -- 0:01:37
472000 -- [-2158.796] (-2152.770) (-2156.701) (-2147.761) * (-2153.768) (-2152.940) [-2153.065] (-2159.768) -- 0:01:37
472500 -- (-2153.476) (-2150.104) [-2153.153] (-2155.582) * (-2157.763) [-2154.288] (-2155.003) (-2154.847) -- 0:01:37
473000 -- (-2156.279) [-2151.542] (-2158.302) (-2153.478) * (-2158.086) [-2149.414] (-2150.028) (-2149.491) -- 0:01:36
473500 -- (-2156.322) [-2150.313] (-2149.707) (-2155.089) * (-2154.729) [-2156.996] (-2150.330) (-2156.959) -- 0:01:37
474000 -- [-2157.158] (-2151.710) (-2149.309) (-2153.247) * [-2156.733] (-2155.093) (-2149.883) (-2154.258) -- 0:01:37
474500 -- (-2152.725) (-2149.287) [-2151.084] (-2150.491) * (-2148.098) [-2159.451] (-2150.629) (-2156.970) -- 0:01:37
475000 -- [-2150.565] (-2151.928) (-2149.328) (-2146.275) * (-2151.852) (-2149.167) [-2153.080] (-2153.099) -- 0:01:37
Average standard deviation of split frequencies: 0.000495
475500 -- (-2152.043) (-2153.532) (-2157.226) [-2147.140] * [-2149.590] (-2154.702) (-2155.334) (-2149.291) -- 0:01:37
476000 -- [-2148.441] (-2148.094) (-2152.553) (-2153.576) * (-2150.785) (-2151.467) [-2149.041] (-2154.814) -- 0:01:36
476500 -- (-2155.397) [-2146.244] (-2159.404) (-2154.365) * (-2152.075) (-2154.980) [-2154.003] (-2152.098) -- 0:01:36
477000 -- (-2153.223) (-2154.704) [-2150.390] (-2153.176) * (-2155.528) [-2153.865] (-2158.441) (-2151.149) -- 0:01:36
477500 -- (-2147.669) (-2149.327) (-2152.419) [-2155.989] * [-2152.321] (-2157.660) (-2155.827) (-2152.469) -- 0:01:36
478000 -- [-2150.357] (-2154.571) (-2153.518) (-2154.797) * (-2152.122) (-2159.942) [-2148.591] (-2149.726) -- 0:01:36
478500 -- [-2147.774] (-2150.688) (-2159.448) (-2152.061) * [-2157.727] (-2155.107) (-2149.637) (-2152.634) -- 0:01:35
479000 -- (-2153.979) (-2153.110) [-2154.358] (-2153.117) * (-2152.167) (-2156.043) (-2149.876) [-2149.883] -- 0:01:36
479500 -- (-2149.271) (-2156.733) [-2153.151] (-2153.740) * [-2150.035] (-2153.632) (-2150.594) (-2160.818) -- 0:01:36
480000 -- (-2151.434) [-2149.414] (-2154.025) (-2158.031) * (-2152.355) (-2147.510) (-2151.610) [-2157.246] -- 0:01:36
Average standard deviation of split frequencies: 0.000490
480500 -- (-2151.022) [-2154.384] (-2150.904) (-2162.361) * (-2159.735) (-2149.283) (-2154.564) [-2154.033] -- 0:01:36
481000 -- (-2156.901) [-2158.999] (-2158.791) (-2160.676) * (-2160.700) (-2153.827) (-2156.376) [-2153.037] -- 0:01:36
481500 -- (-2149.573) (-2159.214) [-2155.464] (-2155.657) * (-2158.924) (-2151.062) [-2160.320] (-2156.887) -- 0:01:35
482000 -- (-2149.069) (-2147.889) (-2151.158) [-2161.048] * (-2159.341) (-2155.629) [-2156.334] (-2150.644) -- 0:01:35
482500 -- [-2162.698] (-2152.516) (-2149.581) (-2154.601) * (-2157.040) [-2152.396] (-2149.666) (-2151.882) -- 0:01:35
483000 -- [-2151.692] (-2150.583) (-2149.116) (-2149.034) * (-2150.619) (-2157.828) [-2149.337] (-2149.642) -- 0:01:35
483500 -- (-2152.809) (-2157.730) [-2152.028] (-2150.545) * (-2158.278) (-2157.060) [-2152.922] (-2150.280) -- 0:01:35
484000 -- (-2150.828) [-2152.084] (-2153.877) (-2157.617) * (-2153.755) (-2152.387) [-2149.561] (-2162.053) -- 0:01:34
484500 -- (-2151.676) [-2147.933] (-2146.358) (-2153.127) * [-2149.954] (-2151.876) (-2149.752) (-2148.813) -- 0:01:35
485000 -- [-2148.840] (-2150.277) (-2159.410) (-2148.422) * [-2152.126] (-2154.779) (-2153.485) (-2154.219) -- 0:01:35
Average standard deviation of split frequencies: 0.000485
485500 -- (-2157.015) [-2148.535] (-2157.218) (-2155.942) * (-2154.801) (-2162.184) [-2154.871] (-2162.125) -- 0:01:35
486000 -- (-2153.819) (-2156.395) [-2155.284] (-2150.933) * (-2159.808) [-2147.765] (-2154.340) (-2158.897) -- 0:01:35
486500 -- (-2152.009) (-2156.683) (-2158.590) [-2151.990] * (-2154.419) [-2152.369] (-2155.046) (-2152.586) -- 0:01:34
487000 -- (-2154.515) (-2154.251) (-2149.059) [-2150.512] * (-2154.068) (-2153.726) [-2152.611] (-2152.894) -- 0:01:34
487500 -- (-2153.276) [-2152.984] (-2152.367) (-2151.760) * (-2153.935) (-2154.747) [-2147.390] (-2148.362) -- 0:01:34
488000 -- [-2151.457] (-2151.046) (-2152.500) (-2152.830) * [-2151.628] (-2156.590) (-2158.460) (-2152.977) -- 0:01:34
488500 -- [-2152.595] (-2160.515) (-2151.930) (-2157.555) * (-2149.675) [-2156.105] (-2151.674) (-2151.445) -- 0:01:34
489000 -- [-2149.964] (-2156.581) (-2159.455) (-2150.531) * (-2150.255) (-2160.202) [-2149.311] (-2153.900) -- 0:01:34
489500 -- (-2153.546) (-2155.935) [-2155.591] (-2151.399) * (-2151.735) (-2150.321) (-2151.270) [-2151.806] -- 0:01:33
490000 -- [-2153.470] (-2158.770) (-2156.038) (-2150.749) * (-2153.455) (-2151.461) (-2149.550) [-2152.155] -- 0:01:34
Average standard deviation of split frequencies: 0.000480
490500 -- (-2150.670) [-2149.148] (-2150.778) (-2152.736) * (-2159.586) (-2152.947) (-2156.966) [-2152.927] -- 0:01:34
491000 -- [-2150.215] (-2154.828) (-2147.109) (-2152.426) * (-2151.846) (-2153.131) [-2155.349] (-2155.738) -- 0:01:34
491500 -- (-2153.988) (-2158.106) [-2152.451] (-2153.626) * (-2151.630) [-2151.890] (-2157.273) (-2161.871) -- 0:01:34
492000 -- [-2156.886] (-2153.136) (-2156.963) (-2156.348) * (-2150.711) (-2155.026) [-2154.581] (-2151.190) -- 0:01:33
492500 -- (-2154.254) [-2157.574] (-2148.914) (-2148.536) * [-2151.179] (-2152.212) (-2154.371) (-2154.119) -- 0:01:33
493000 -- [-2152.862] (-2148.454) (-2153.657) (-2152.565) * (-2153.323) [-2157.262] (-2153.803) (-2159.386) -- 0:01:33
493500 -- (-2148.654) [-2148.980] (-2152.590) (-2159.938) * (-2154.244) (-2156.365) (-2151.861) [-2156.682] -- 0:01:33
494000 -- (-2148.861) [-2152.017] (-2150.760) (-2163.763) * (-2155.410) (-2153.992) [-2153.968] (-2161.560) -- 0:01:33
494500 -- [-2149.694] (-2154.899) (-2151.589) (-2160.656) * (-2154.037) (-2151.491) (-2155.360) [-2150.332] -- 0:01:33
495000 -- (-2150.613) (-2150.973) (-2150.147) [-2152.279] * [-2153.175] (-2153.096) (-2152.258) (-2152.765) -- 0:01:32
Average standard deviation of split frequencies: 0.000475
495500 -- [-2153.517] (-2153.921) (-2150.768) (-2150.994) * (-2152.279) [-2153.699] (-2158.267) (-2147.264) -- 0:01:33
496000 -- [-2150.453] (-2155.148) (-2155.623) (-2151.684) * (-2152.380) (-2159.204) [-2154.525] (-2150.518) -- 0:01:33
496500 -- (-2160.140) (-2151.260) [-2155.738] (-2149.752) * (-2154.818) (-2160.589) (-2155.984) [-2157.747] -- 0:01:33
497000 -- (-2148.720) (-2152.380) (-2150.224) [-2148.642] * (-2150.114) (-2156.424) (-2153.054) [-2152.791] -- 0:01:33
497500 -- (-2154.121) (-2151.592) [-2151.614] (-2152.040) * [-2157.178] (-2157.150) (-2149.312) (-2151.038) -- 0:01:32
498000 -- (-2153.485) (-2155.078) [-2153.728] (-2151.567) * (-2148.154) [-2152.678] (-2150.225) (-2150.064) -- 0:01:32
498500 -- [-2155.331] (-2156.204) (-2154.768) (-2155.475) * (-2153.188) (-2148.868) [-2153.343] (-2154.108) -- 0:01:32
499000 -- (-2154.256) (-2159.091) [-2152.937] (-2154.064) * (-2152.530) (-2153.996) (-2154.845) [-2151.261] -- 0:01:32
499500 -- (-2151.916) (-2162.484) (-2159.213) [-2151.868] * [-2151.517] (-2158.411) (-2153.437) (-2151.934) -- 0:01:32
500000 -- (-2153.124) (-2156.252) [-2154.024] (-2151.510) * (-2156.147) (-2152.420) (-2151.326) [-2155.003] -- 0:01:32
Average standard deviation of split frequencies: 0.000471
500500 -- (-2152.428) [-2149.404] (-2162.310) (-2153.487) * (-2159.562) [-2150.555] (-2149.554) (-2150.059) -- 0:01:31
501000 -- (-2149.728) [-2152.011] (-2156.701) (-2152.001) * (-2151.098) (-2154.374) [-2157.855] (-2157.376) -- 0:01:32
501500 -- (-2150.809) (-2148.188) (-2154.971) [-2151.346] * (-2154.249) [-2150.361] (-2155.664) (-2153.295) -- 0:01:32
502000 -- (-2156.180) (-2153.377) [-2150.954] (-2149.567) * (-2153.565) (-2153.310) (-2154.825) [-2156.204] -- 0:01:32
502500 -- [-2153.821] (-2152.552) (-2157.173) (-2152.656) * (-2160.555) (-2150.596) (-2160.380) [-2151.224] -- 0:01:32
503000 -- (-2148.407) (-2155.760) (-2153.659) [-2156.800] * (-2157.155) [-2152.541] (-2152.898) (-2151.801) -- 0:01:31
503500 -- (-2153.611) (-2155.966) (-2153.372) [-2151.283] * [-2156.198] (-2155.842) (-2154.668) (-2155.767) -- 0:01:31
504000 -- (-2158.465) [-2152.602] (-2150.649) (-2150.946) * [-2149.510] (-2152.487) (-2152.955) (-2156.711) -- 0:01:31
504500 -- (-2156.258) [-2155.597] (-2151.841) (-2151.569) * (-2159.502) (-2155.686) [-2153.504] (-2155.018) -- 0:01:31
505000 -- (-2155.671) (-2150.475) (-2153.569) [-2152.154] * (-2163.114) (-2148.627) [-2152.366] (-2149.658) -- 0:01:31
Average standard deviation of split frequencies: 0.000466
505500 -- (-2147.727) (-2152.311) (-2156.288) [-2151.473] * (-2153.080) (-2150.145) [-2153.261] (-2153.062) -- 0:01:30
506000 -- [-2150.843] (-2158.685) (-2158.878) (-2149.499) * [-2151.162] (-2154.265) (-2160.316) (-2151.701) -- 0:01:30
506500 -- (-2156.069) (-2158.006) (-2159.520) [-2152.734] * (-2148.147) (-2154.442) (-2156.375) [-2159.590] -- 0:01:31
507000 -- (-2151.492) (-2161.178) (-2158.429) [-2154.588] * (-2150.398) [-2152.258] (-2154.529) (-2153.360) -- 0:01:31
507500 -- (-2154.225) (-2156.855) [-2158.670] (-2148.290) * [-2153.831] (-2155.191) (-2155.717) (-2147.438) -- 0:01:31
508000 -- [-2148.199] (-2155.597) (-2159.565) (-2150.107) * (-2152.499) (-2156.591) (-2152.432) [-2152.379] -- 0:01:31
508500 -- (-2156.674) [-2154.380] (-2155.986) (-2162.394) * (-2155.527) (-2153.779) (-2150.770) [-2148.893] -- 0:01:30
509000 -- (-2154.707) (-2155.180) [-2149.805] (-2153.753) * (-2156.470) (-2153.984) [-2155.974] (-2159.677) -- 0:01:30
509500 -- [-2158.106] (-2151.321) (-2151.089) (-2151.285) * [-2152.061] (-2161.956) (-2154.753) (-2151.914) -- 0:01:30
510000 -- (-2159.167) (-2150.440) (-2152.985) [-2156.266] * [-2149.329] (-2149.337) (-2152.824) (-2151.854) -- 0:01:30
Average standard deviation of split frequencies: 0.000462
510500 -- (-2149.454) (-2154.240) [-2150.246] (-2152.914) * (-2151.046) [-2149.961] (-2149.741) (-2153.921) -- 0:01:30
511000 -- (-2151.606) (-2151.487) [-2149.370] (-2153.433) * [-2155.630] (-2151.194) (-2153.384) (-2152.188) -- 0:01:29
511500 -- (-2149.950) (-2154.237) (-2149.749) [-2156.429] * (-2153.113) (-2157.202) [-2150.233] (-2156.167) -- 0:01:29
512000 -- (-2152.629) (-2154.560) [-2151.260] (-2152.706) * (-2151.663) [-2150.769] (-2152.214) (-2160.256) -- 0:01:30
512500 -- (-2149.215) (-2150.205) [-2155.129] (-2156.583) * (-2157.612) [-2150.009] (-2156.754) (-2156.807) -- 0:01:30
513000 -- (-2160.768) (-2157.878) (-2152.486) [-2155.209] * (-2153.595) [-2153.614] (-2151.508) (-2155.999) -- 0:01:30
513500 -- (-2150.651) (-2158.238) (-2148.923) [-2152.209] * (-2147.276) (-2156.548) (-2147.819) [-2151.984] -- 0:01:30
514000 -- (-2148.420) (-2154.957) (-2155.517) [-2152.864] * (-2155.453) [-2148.539] (-2155.195) (-2150.559) -- 0:01:29
514500 -- (-2155.239) (-2150.171) (-2154.463) [-2152.637] * [-2147.847] (-2150.323) (-2153.586) (-2149.339) -- 0:01:29
515000 -- (-2152.067) [-2149.044] (-2150.695) (-2154.381) * [-2149.983] (-2155.059) (-2155.310) (-2154.166) -- 0:01:29
Average standard deviation of split frequencies: 0.000457
515500 -- [-2149.641] (-2157.353) (-2152.305) (-2157.168) * [-2151.184] (-2153.884) (-2150.677) (-2158.624) -- 0:01:29
516000 -- (-2153.358) [-2162.905] (-2156.023) (-2150.343) * (-2151.325) [-2156.677] (-2158.454) (-2162.353) -- 0:01:29
516500 -- (-2158.244) (-2157.640) [-2158.951] (-2153.575) * (-2149.684) [-2152.296] (-2156.729) (-2159.107) -- 0:01:28
517000 -- (-2153.584) (-2149.511) (-2157.082) [-2155.572] * (-2157.027) (-2153.093) (-2150.807) [-2163.082] -- 0:01:29
517500 -- [-2155.063] (-2152.695) (-2152.323) (-2149.056) * (-2152.280) (-2159.887) [-2152.349] (-2156.933) -- 0:01:29
518000 -- (-2158.843) [-2150.382] (-2147.917) (-2152.274) * (-2153.804) (-2152.906) [-2153.028] (-2158.548) -- 0:01:29
518500 -- (-2156.278) [-2153.226] (-2149.498) (-2149.865) * (-2151.645) (-2153.209) (-2157.142) [-2155.470] -- 0:01:29
519000 -- (-2160.618) (-2150.255) [-2154.290] (-2153.623) * (-2152.039) (-2153.864) [-2159.799] (-2150.373) -- 0:01:28
519500 -- (-2158.964) [-2150.725] (-2154.353) (-2157.613) * (-2151.300) [-2151.614] (-2153.670) (-2150.364) -- 0:01:28
520000 -- (-2156.932) [-2152.895] (-2153.053) (-2153.134) * (-2151.885) [-2148.820] (-2155.360) (-2154.767) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
520500 -- [-2153.589] (-2156.498) (-2152.198) (-2158.141) * (-2148.691) (-2150.169) [-2158.880] (-2156.883) -- 0:01:28
521000 -- (-2150.080) (-2162.221) [-2150.277] (-2147.357) * (-2154.377) (-2149.206) (-2156.846) [-2150.346] -- 0:01:28
521500 -- (-2148.653) (-2158.909) [-2149.585] (-2151.311) * (-2153.217) (-2154.013) (-2161.200) [-2148.175] -- 0:01:28
522000 -- (-2153.118) (-2154.228) (-2163.342) [-2147.916] * [-2151.051] (-2153.122) (-2159.562) (-2158.755) -- 0:01:27
522500 -- [-2151.002] (-2155.014) (-2155.591) (-2157.728) * (-2153.602) [-2149.643] (-2152.754) (-2151.524) -- 0:01:28
523000 -- (-2154.989) (-2152.019) (-2155.100) [-2157.916] * (-2150.798) (-2158.062) (-2155.282) [-2151.196] -- 0:01:28
523500 -- (-2160.375) (-2150.436) [-2151.026] (-2156.843) * (-2152.678) [-2151.863] (-2158.784) (-2150.038) -- 0:01:28
524000 -- (-2154.520) (-2151.446) (-2153.026) [-2146.874] * (-2151.194) [-2153.236] (-2152.966) (-2153.580) -- 0:01:28
524500 -- (-2149.487) [-2154.202] (-2153.419) (-2156.477) * [-2146.825] (-2154.727) (-2158.447) (-2147.448) -- 0:01:27
525000 -- [-2149.930] (-2154.400) (-2154.179) (-2150.417) * [-2149.486] (-2153.345) (-2154.135) (-2147.619) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
525500 -- (-2161.153) (-2151.941) [-2153.505] (-2148.379) * (-2158.139) [-2152.345] (-2148.276) (-2149.696) -- 0:01:27
526000 -- (-2150.903) [-2151.754] (-2153.409) (-2150.880) * (-2156.215) (-2152.908) (-2147.026) [-2151.534] -- 0:01:27
526500 -- (-2153.779) (-2150.860) (-2154.201) [-2153.764] * (-2148.980) (-2148.770) (-2148.451) [-2149.293] -- 0:01:27
527000 -- (-2151.132) [-2152.910] (-2155.365) (-2148.066) * [-2155.239] (-2153.773) (-2146.588) (-2152.723) -- 0:01:27
527500 -- (-2151.857) (-2155.746) [-2152.555] (-2151.339) * (-2155.146) (-2155.484) (-2151.863) [-2155.749] -- 0:01:26
528000 -- (-2159.247) (-2146.906) (-2149.987) [-2150.346] * (-2157.343) (-2155.844) (-2153.094) [-2149.987] -- 0:01:27
528500 -- (-2157.773) [-2148.266] (-2152.987) (-2148.597) * (-2152.892) (-2163.873) (-2149.779) [-2150.695] -- 0:01:27
529000 -- [-2158.947] (-2153.900) (-2146.853) (-2151.306) * (-2150.542) (-2161.075) [-2155.653] (-2156.820) -- 0:01:27
529500 -- (-2150.011) (-2153.167) [-2155.252] (-2155.492) * (-2156.424) (-2158.642) (-2157.699) [-2152.374] -- 0:01:27
530000 -- [-2151.774] (-2153.316) (-2157.327) (-2150.529) * (-2149.732) (-2152.317) (-2156.929) [-2153.184] -- 0:01:26
Average standard deviation of split frequencies: 0.000000
530500 -- [-2150.714] (-2149.839) (-2156.927) (-2154.033) * (-2152.665) (-2154.518) (-2148.226) [-2155.048] -- 0:01:26
531000 -- [-2154.165] (-2149.147) (-2154.945) (-2153.885) * (-2152.401) [-2152.483] (-2150.614) (-2154.962) -- 0:01:26
531500 -- (-2152.208) [-2151.213] (-2152.890) (-2158.094) * (-2161.343) (-2156.647) [-2148.781] (-2155.258) -- 0:01:26
532000 -- (-2159.724) (-2148.937) (-2158.142) [-2150.601] * (-2151.111) (-2153.869) (-2152.420) [-2159.865] -- 0:01:26
532500 -- (-2154.276) (-2155.394) [-2152.228] (-2151.402) * [-2152.037] (-2150.715) (-2154.376) (-2149.471) -- 0:01:26
533000 -- (-2152.055) (-2150.279) [-2151.237] (-2150.024) * (-2150.442) (-2156.788) [-2149.748] (-2151.955) -- 0:01:25
533500 -- (-2153.066) (-2150.497) [-2147.590] (-2153.736) * (-2150.107) (-2158.326) (-2154.529) [-2157.943] -- 0:01:26
534000 -- (-2155.590) (-2157.460) [-2151.390] (-2156.910) * [-2150.033] (-2149.122) (-2157.177) (-2163.540) -- 0:01:26
534500 -- (-2161.282) [-2150.853] (-2151.186) (-2150.368) * (-2148.852) (-2150.635) [-2149.340] (-2153.208) -- 0:01:26
535000 -- [-2148.080] (-2159.478) (-2149.962) (-2153.135) * (-2150.282) (-2161.995) [-2149.443] (-2153.129) -- 0:01:26
Average standard deviation of split frequencies: 0.000000
535500 -- (-2154.634) (-2162.476) [-2151.618] (-2156.670) * (-2162.522) [-2149.722] (-2151.228) (-2155.471) -- 0:01:25
536000 -- (-2151.056) (-2158.927) (-2148.932) [-2149.508] * (-2164.591) (-2151.683) (-2147.687) [-2149.535] -- 0:01:25
536500 -- [-2150.909] (-2154.628) (-2153.859) (-2156.063) * [-2154.573] (-2152.336) (-2154.558) (-2149.979) -- 0:01:25
537000 -- (-2149.374) [-2153.477] (-2147.809) (-2152.880) * (-2149.770) [-2156.152] (-2154.804) (-2151.464) -- 0:01:25
537500 -- (-2153.318) [-2153.324] (-2156.037) (-2157.689) * [-2152.701] (-2150.187) (-2150.299) (-2155.468) -- 0:01:25
538000 -- (-2151.139) (-2152.157) (-2153.371) [-2152.628] * [-2152.689] (-2150.847) (-2153.690) (-2153.876) -- 0:01:25
538500 -- (-2158.137) (-2155.909) [-2151.088] (-2151.297) * [-2152.793] (-2150.622) (-2157.178) (-2154.425) -- 0:01:24
539000 -- (-2157.403) [-2159.931] (-2151.994) (-2156.214) * (-2148.692) [-2152.693] (-2155.629) (-2149.809) -- 0:01:25
539500 -- (-2152.919) (-2150.780) [-2153.406] (-2164.275) * (-2157.544) (-2156.475) (-2152.762) [-2152.813] -- 0:01:25
540000 -- (-2153.153) [-2158.725] (-2154.903) (-2155.834) * (-2154.649) [-2148.555] (-2161.969) (-2152.438) -- 0:01:25
Average standard deviation of split frequencies: 0.000000
540500 -- [-2155.947] (-2157.761) (-2151.840) (-2154.825) * (-2151.739) (-2155.828) (-2157.248) [-2151.573] -- 0:01:25
541000 -- [-2151.650] (-2158.416) (-2148.821) (-2155.502) * (-2163.428) (-2157.093) (-2153.577) [-2152.396] -- 0:01:24
541500 -- (-2154.898) (-2153.186) (-2156.547) [-2150.060] * [-2158.221] (-2154.808) (-2155.656) (-2154.034) -- 0:01:24
542000 -- [-2151.471] (-2148.317) (-2154.501) (-2151.876) * (-2150.743) (-2149.590) (-2152.372) [-2149.038] -- 0:01:24
542500 -- (-2155.876) [-2159.511] (-2159.273) (-2151.628) * (-2155.447) (-2151.882) [-2153.445] (-2150.624) -- 0:01:24
543000 -- [-2149.411] (-2157.606) (-2151.237) (-2154.783) * (-2161.317) (-2156.920) [-2150.594] (-2163.328) -- 0:01:24
543500 -- (-2154.791) (-2164.748) (-2156.341) [-2148.417] * (-2150.076) [-2151.310] (-2152.520) (-2163.408) -- 0:01:23
544000 -- [-2156.134] (-2152.738) (-2153.653) (-2153.457) * (-2149.064) [-2155.074] (-2147.171) (-2154.696) -- 0:01:23
544500 -- (-2149.828) (-2150.981) [-2150.381] (-2150.848) * (-2152.440) [-2147.516] (-2149.897) (-2158.632) -- 0:01:24
545000 -- (-2147.782) (-2154.664) (-2155.583) [-2152.076] * (-2150.224) [-2153.250] (-2153.314) (-2154.852) -- 0:01:24
Average standard deviation of split frequencies: 0.000000
545500 -- (-2154.221) [-2158.523] (-2152.582) (-2155.728) * (-2152.711) (-2148.246) [-2160.743] (-2151.518) -- 0:01:24
546000 -- (-2150.490) [-2150.638] (-2149.998) (-2159.231) * (-2153.356) (-2153.516) (-2156.276) [-2152.382] -- 0:01:23
546500 -- (-2153.090) [-2147.735] (-2158.059) (-2155.700) * [-2150.932] (-2154.762) (-2154.145) (-2155.992) -- 0:01:23
547000 -- (-2147.903) (-2156.530) [-2152.615] (-2157.345) * [-2152.650] (-2158.837) (-2149.659) (-2159.110) -- 0:01:23
547500 -- (-2147.101) (-2158.272) [-2153.325] (-2151.669) * (-2155.695) (-2154.400) [-2152.176] (-2154.113) -- 0:01:23
548000 -- (-2154.647) (-2153.319) (-2156.702) [-2150.606] * (-2151.724) (-2153.365) [-2153.026] (-2152.461) -- 0:01:23
548500 -- (-2155.483) (-2152.993) (-2150.753) [-2150.773] * (-2154.205) (-2157.569) [-2150.103] (-2157.629) -- 0:01:23
549000 -- (-2152.467) (-2152.250) [-2149.634] (-2150.325) * (-2154.812) (-2153.866) (-2152.556) [-2156.255] -- 0:01:22
549500 -- [-2151.944] (-2154.023) (-2150.427) (-2150.047) * [-2151.007] (-2161.358) (-2148.918) (-2159.574) -- 0:01:22
550000 -- [-2147.849] (-2155.409) (-2155.087) (-2154.284) * (-2152.663) [-2150.566] (-2148.684) (-2155.585) -- 0:01:23
Average standard deviation of split frequencies: 0.000000
550500 -- (-2150.155) (-2153.769) (-2151.094) [-2155.084] * (-2151.180) (-2149.253) [-2147.083] (-2154.254) -- 0:01:23
551000 -- (-2149.553) [-2154.127] (-2149.006) (-2150.607) * (-2148.294) (-2154.428) [-2150.097] (-2156.507) -- 0:01:23
551500 -- [-2149.798] (-2153.808) (-2147.497) (-2150.164) * [-2147.386] (-2155.086) (-2152.019) (-2150.966) -- 0:01:22
552000 -- (-2147.472) (-2154.527) [-2147.487] (-2157.224) * [-2150.694] (-2151.626) (-2150.476) (-2151.043) -- 0:01:22
552500 -- (-2157.266) [-2150.198] (-2152.443) (-2148.510) * (-2156.631) (-2152.259) [-2152.611] (-2149.374) -- 0:01:22
553000 -- (-2162.903) (-2152.137) [-2153.543] (-2157.806) * (-2152.189) (-2153.998) (-2151.520) [-2150.659] -- 0:01:22
553500 -- (-2157.042) [-2154.691] (-2149.999) (-2152.589) * (-2152.330) [-2149.477] (-2152.124) (-2158.006) -- 0:01:22
554000 -- (-2151.753) [-2153.090] (-2152.444) (-2150.681) * [-2150.612] (-2151.723) (-2154.212) (-2157.470) -- 0:01:22
554500 -- (-2151.253) (-2153.269) [-2154.116] (-2149.043) * (-2150.731) (-2152.422) (-2148.902) [-2149.299] -- 0:01:21
555000 -- (-2155.712) [-2155.978] (-2156.719) (-2151.776) * (-2154.591) [-2151.188] (-2156.999) (-2155.009) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
555500 -- (-2162.319) (-2152.981) (-2152.054) [-2150.042] * (-2152.183) (-2150.438) (-2158.644) [-2153.840] -- 0:01:22
556000 -- [-2147.836] (-2164.007) (-2163.407) (-2159.392) * (-2152.891) (-2151.214) (-2155.768) [-2151.485] -- 0:01:22
556500 -- [-2150.967] (-2153.535) (-2155.182) (-2159.859) * (-2151.496) (-2152.558) [-2150.766] (-2153.608) -- 0:01:22
557000 -- (-2149.361) [-2158.622] (-2149.267) (-2161.465) * (-2155.766) (-2156.703) [-2152.621] (-2150.817) -- 0:01:21
557500 -- (-2154.438) (-2152.341) (-2151.309) [-2161.128] * [-2152.678] (-2155.449) (-2157.953) (-2147.445) -- 0:01:21
558000 -- [-2157.419] (-2157.221) (-2156.655) (-2158.361) * [-2156.222] (-2153.141) (-2153.616) (-2154.328) -- 0:01:21
558500 -- (-2154.196) [-2153.542] (-2159.103) (-2155.314) * (-2152.428) (-2156.723) (-2155.713) [-2152.315] -- 0:01:21
559000 -- [-2152.754] (-2154.922) (-2156.749) (-2150.822) * (-2152.254) (-2150.358) (-2151.652) [-2153.390] -- 0:01:21
559500 -- (-2151.123) (-2151.138) [-2153.956] (-2152.012) * (-2149.410) [-2154.961] (-2155.302) (-2161.341) -- 0:01:21
560000 -- [-2160.499] (-2154.239) (-2153.748) (-2150.442) * (-2150.103) [-2154.946] (-2158.190) (-2150.063) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
560500 -- [-2154.858] (-2155.883) (-2155.828) (-2155.286) * (-2163.176) (-2157.533) (-2159.199) [-2150.193] -- 0:01:21
561000 -- [-2151.333] (-2155.955) (-2149.956) (-2152.592) * (-2159.384) (-2155.647) (-2156.884) [-2152.946] -- 0:01:21
561500 -- (-2157.591) (-2153.713) [-2154.858] (-2156.710) * [-2150.452] (-2153.436) (-2163.008) (-2149.187) -- 0:01:21
562000 -- [-2150.434] (-2154.219) (-2153.901) (-2156.940) * [-2157.193] (-2153.834) (-2158.729) (-2151.225) -- 0:01:21
562500 -- (-2150.416) (-2149.745) [-2152.243] (-2157.715) * (-2150.480) (-2153.808) (-2157.613) [-2152.194] -- 0:01:20
563000 -- (-2156.464) (-2151.387) [-2149.929] (-2155.216) * (-2160.509) (-2156.180) (-2160.208) [-2152.704] -- 0:01:20
563500 -- (-2147.179) (-2147.945) (-2154.232) [-2153.405] * (-2154.426) [-2151.132] (-2166.640) (-2151.862) -- 0:01:20
564000 -- (-2150.581) [-2149.999] (-2160.069) (-2163.828) * [-2148.740] (-2150.321) (-2166.650) (-2158.033) -- 0:01:20
564500 -- [-2151.007] (-2145.535) (-2158.406) (-2156.152) * [-2153.734] (-2151.262) (-2161.234) (-2151.295) -- 0:01:20
565000 -- (-2154.075) [-2150.603] (-2159.761) (-2159.894) * (-2150.580) (-2149.357) (-2150.441) [-2147.003] -- 0:01:20
Average standard deviation of split frequencies: 0.000000
565500 -- [-2157.005] (-2151.833) (-2161.770) (-2158.505) * (-2153.588) [-2147.691] (-2150.798) (-2148.759) -- 0:01:19
566000 -- (-2154.409) [-2152.078] (-2166.718) (-2160.838) * (-2153.812) [-2152.875] (-2151.322) (-2156.323) -- 0:01:20
566500 -- (-2150.454) (-2153.591) (-2158.449) [-2152.812] * (-2153.407) (-2150.737) [-2145.618] (-2155.456) -- 0:01:20
567000 -- [-2155.788] (-2150.843) (-2155.776) (-2155.852) * (-2159.018) (-2151.931) [-2151.150] (-2159.174) -- 0:01:20
567500 -- (-2157.875) [-2152.035] (-2157.710) (-2157.234) * (-2150.224) [-2149.190] (-2149.751) (-2152.085) -- 0:01:20
568000 -- (-2160.081) (-2154.875) [-2149.815] (-2159.466) * (-2160.589) [-2150.844] (-2152.140) (-2153.068) -- 0:01:19
568500 -- (-2157.800) [-2147.984] (-2153.849) (-2155.051) * (-2161.622) (-2161.269) [-2156.298] (-2149.420) -- 0:01:19
569000 -- (-2150.517) (-2147.478) [-2157.507] (-2153.061) * (-2150.884) [-2155.333] (-2152.298) (-2156.266) -- 0:01:19
569500 -- (-2155.834) (-2150.728) (-2155.352) [-2149.358] * (-2150.268) (-2153.832) [-2150.222] (-2150.037) -- 0:01:19
570000 -- (-2152.050) [-2150.979] (-2155.786) (-2154.839) * (-2146.877) (-2154.619) (-2151.833) [-2153.798] -- 0:01:19
Average standard deviation of split frequencies: 0.000000
570500 -- (-2150.782) [-2146.591] (-2156.868) (-2154.479) * [-2156.701] (-2155.199) (-2152.639) (-2150.215) -- 0:01:19
571000 -- (-2153.076) (-2160.304) [-2152.655] (-2149.188) * (-2158.206) (-2149.549) [-2148.583] (-2153.709) -- 0:01:18
571500 -- [-2152.413] (-2156.289) (-2150.116) (-2160.073) * [-2151.621] (-2150.869) (-2154.026) (-2152.483) -- 0:01:19
572000 -- (-2151.124) [-2159.160] (-2151.772) (-2156.467) * (-2155.615) (-2164.206) (-2153.672) [-2150.671] -- 0:01:19
572500 -- (-2153.343) (-2157.647) (-2153.869) [-2150.276] * (-2157.049) (-2157.682) (-2156.350) [-2152.594] -- 0:01:19
573000 -- (-2155.514) (-2152.158) (-2154.989) [-2154.100] * (-2160.326) (-2152.964) [-2153.835] (-2153.620) -- 0:01:18
573500 -- (-2155.290) (-2159.408) (-2149.418) [-2153.050] * (-2151.880) [-2151.414] (-2154.941) (-2156.988) -- 0:01:18
574000 -- (-2160.157) (-2154.102) (-2156.160) [-2152.482] * (-2153.112) (-2164.031) [-2151.742] (-2151.528) -- 0:01:18
574500 -- (-2154.323) [-2147.243] (-2166.826) (-2156.207) * [-2159.536] (-2158.169) (-2156.802) (-2150.686) -- 0:01:18
575000 -- (-2151.262) [-2153.441] (-2157.529) (-2155.103) * (-2159.650) (-2153.191) (-2159.004) [-2152.804] -- 0:01:18
Average standard deviation of split frequencies: 0.000000
575500 -- (-2154.204) (-2153.561) (-2164.199) [-2153.900] * (-2153.574) (-2154.036) [-2153.498] (-2150.949) -- 0:01:18
576000 -- [-2157.190] (-2156.866) (-2150.768) (-2159.651) * [-2151.440] (-2152.964) (-2158.242) (-2153.026) -- 0:01:18
576500 -- [-2153.422] (-2154.731) (-2155.795) (-2168.165) * (-2150.853) (-2150.840) [-2151.036] (-2152.719) -- 0:01:17
577000 -- (-2150.848) (-2150.951) (-2153.329) [-2155.227] * (-2152.622) (-2153.169) [-2150.179] (-2151.252) -- 0:01:18
577500 -- [-2154.136] (-2153.751) (-2159.930) (-2149.640) * (-2153.962) (-2151.892) [-2151.752] (-2153.726) -- 0:01:18
578000 -- (-2158.956) [-2150.538] (-2158.503) (-2148.389) * (-2149.276) [-2156.352] (-2154.405) (-2148.171) -- 0:01:18
578500 -- (-2155.589) (-2148.590) [-2157.247] (-2151.353) * (-2150.647) (-2153.195) [-2154.105] (-2148.354) -- 0:01:17
579000 -- (-2157.864) [-2152.017] (-2156.335) (-2154.399) * [-2153.840] (-2155.436) (-2152.001) (-2151.488) -- 0:01:17
579500 -- (-2155.007) (-2156.089) (-2148.919) [-2151.321] * (-2155.477) (-2158.831) [-2151.749] (-2155.207) -- 0:01:17
580000 -- [-2158.248] (-2152.361) (-2156.176) (-2152.638) * [-2150.414] (-2154.607) (-2152.180) (-2150.343) -- 0:01:17
Average standard deviation of split frequencies: 0.000000
580500 -- (-2155.644) [-2157.137] (-2154.640) (-2153.393) * (-2149.776) (-2156.995) [-2151.251] (-2156.635) -- 0:01:17
581000 -- (-2154.435) (-2154.154) (-2154.806) [-2156.042] * [-2157.417] (-2161.592) (-2156.278) (-2156.928) -- 0:01:17
581500 -- [-2160.515] (-2150.188) (-2149.931) (-2150.945) * (-2159.515) [-2156.045] (-2150.814) (-2155.796) -- 0:01:17
582000 -- (-2148.517) (-2147.561) [-2151.676] (-2157.073) * (-2152.719) (-2160.302) [-2150.256] (-2153.544) -- 0:01:16
582500 -- (-2163.809) [-2152.241] (-2153.790) (-2152.587) * (-2149.772) [-2148.658] (-2155.829) (-2150.643) -- 0:01:17
583000 -- (-2155.162) (-2149.400) (-2150.713) [-2146.454] * (-2150.321) [-2153.009] (-2154.655) (-2153.854) -- 0:01:17
583500 -- (-2154.312) [-2152.710] (-2152.985) (-2150.969) * (-2153.469) [-2153.683] (-2152.416) (-2156.469) -- 0:01:17
584000 -- (-2156.702) (-2154.166) [-2155.066] (-2157.985) * [-2153.353] (-2162.861) (-2152.889) (-2152.033) -- 0:01:16
584500 -- (-2155.480) (-2156.025) [-2151.786] (-2148.173) * (-2151.379) (-2149.286) (-2151.039) [-2154.350] -- 0:01:16
585000 -- [-2158.004] (-2159.467) (-2149.546) (-2155.183) * [-2153.479] (-2148.357) (-2159.916) (-2159.582) -- 0:01:16
Average standard deviation of split frequencies: 0.000000
585500 -- [-2155.463] (-2153.700) (-2151.159) (-2154.479) * (-2149.567) [-2150.784] (-2155.398) (-2153.161) -- 0:01:16
586000 -- (-2150.063) [-2154.433] (-2154.094) (-2150.671) * (-2153.304) (-2155.315) (-2152.286) [-2153.003] -- 0:01:16
586500 -- (-2149.843) (-2158.657) (-2151.681) [-2157.295] * (-2148.963) (-2153.019) (-2151.720) [-2151.552] -- 0:01:16
587000 -- [-2147.357] (-2154.991) (-2157.567) (-2159.303) * [-2150.825] (-2155.343) (-2154.514) (-2152.350) -- 0:01:15
587500 -- (-2152.833) (-2158.356) [-2154.111] (-2162.708) * (-2150.197) [-2151.672] (-2153.826) (-2153.177) -- 0:01:15
588000 -- (-2157.194) [-2150.959] (-2151.499) (-2156.346) * [-2154.637] (-2152.995) (-2157.078) (-2150.798) -- 0:01:16
588500 -- (-2154.590) [-2155.068] (-2153.421) (-2159.674) * (-2152.124) (-2153.981) [-2152.949] (-2155.892) -- 0:01:16
589000 -- (-2155.298) (-2147.372) (-2153.801) [-2154.228] * (-2151.742) [-2151.632] (-2150.500) (-2149.185) -- 0:01:16
589500 -- [-2152.981] (-2151.929) (-2156.433) (-2157.438) * (-2150.950) [-2150.496] (-2151.341) (-2153.563) -- 0:01:15
590000 -- (-2151.833) (-2153.207) (-2156.143) [-2155.900] * (-2152.542) (-2164.469) (-2151.192) [-2148.561] -- 0:01:15
Average standard deviation of split frequencies: 0.000000
590500 -- (-2153.382) (-2156.888) (-2149.958) [-2152.757] * [-2152.261] (-2162.834) (-2159.206) (-2147.759) -- 0:01:15
591000 -- [-2149.106] (-2153.007) (-2153.632) (-2152.965) * (-2155.036) (-2150.303) [-2149.132] (-2154.360) -- 0:01:15
591500 -- (-2157.296) [-2154.025] (-2152.804) (-2149.659) * (-2152.681) (-2155.101) (-2153.964) [-2154.219] -- 0:01:15
592000 -- (-2153.371) (-2154.844) (-2162.840) [-2151.456] * (-2150.234) [-2148.141] (-2150.885) (-2151.489) -- 0:01:15
592500 -- (-2157.277) (-2157.342) (-2153.322) [-2146.472] * (-2154.889) (-2150.834) (-2154.404) [-2151.982] -- 0:01:14
593000 -- (-2149.154) (-2157.488) [-2154.193] (-2154.179) * (-2160.401) (-2155.347) (-2149.507) [-2149.777] -- 0:01:15
593500 -- (-2154.982) [-2157.497] (-2151.483) (-2154.270) * (-2156.460) [-2152.553] (-2150.585) (-2153.999) -- 0:01:15
594000 -- (-2150.345) [-2155.008] (-2152.438) (-2152.220) * [-2150.028] (-2157.456) (-2150.743) (-2158.123) -- 0:01:15
594500 -- [-2152.290] (-2151.180) (-2149.895) (-2149.247) * (-2150.617) (-2161.095) (-2151.754) [-2149.548] -- 0:01:15
595000 -- (-2150.325) [-2155.816] (-2154.094) (-2155.374) * (-2156.652) (-2157.246) (-2153.290) [-2156.688] -- 0:01:14
Average standard deviation of split frequencies: 0.000000
595500 -- (-2153.705) [-2154.756] (-2156.540) (-2153.316) * (-2150.511) (-2154.518) (-2151.996) [-2153.799] -- 0:01:14
596000 -- (-2151.401) [-2152.720] (-2154.097) (-2155.363) * (-2155.309) [-2150.432] (-2152.586) (-2151.728) -- 0:01:14
596500 -- [-2150.138] (-2151.165) (-2148.519) (-2157.975) * [-2154.471] (-2150.189) (-2149.217) (-2152.533) -- 0:01:14
597000 -- [-2152.607] (-2154.332) (-2152.669) (-2153.748) * (-2150.996) [-2153.508] (-2150.933) (-2152.812) -- 0:01:14
597500 -- (-2153.633) (-2149.119) (-2152.598) [-2151.728] * (-2161.866) [-2154.584] (-2150.335) (-2158.996) -- 0:01:14
598000 -- [-2150.796] (-2155.178) (-2158.802) (-2155.314) * (-2162.793) (-2154.099) (-2151.499) [-2154.134] -- 0:01:13
598500 -- [-2154.742] (-2152.459) (-2150.444) (-2152.249) * (-2151.701) [-2157.936] (-2155.245) (-2151.336) -- 0:01:14
599000 -- (-2154.705) (-2147.269) [-2151.345] (-2150.316) * (-2151.364) (-2155.659) [-2158.638] (-2157.345) -- 0:01:14
599500 -- (-2164.403) [-2151.216] (-2149.789) (-2151.046) * [-2152.740] (-2153.220) (-2161.975) (-2152.729) -- 0:01:14
600000 -- [-2153.418] (-2150.640) (-2149.943) (-2153.358) * (-2150.495) (-2154.949) [-2153.518] (-2157.484) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
600500 -- (-2152.992) (-2154.972) [-2154.419] (-2152.286) * (-2156.810) (-2155.764) [-2153.408] (-2154.323) -- 0:01:13
601000 -- (-2154.496) (-2150.334) [-2153.677] (-2149.824) * (-2157.667) (-2153.480) [-2155.023] (-2156.262) -- 0:01:13
601500 -- (-2158.810) [-2156.722] (-2154.580) (-2150.633) * (-2157.513) (-2152.263) (-2152.514) [-2146.586] -- 0:01:13
602000 -- (-2156.417) [-2148.721] (-2157.188) (-2155.546) * (-2156.723) (-2149.796) [-2148.652] (-2151.534) -- 0:01:13
602500 -- (-2156.741) [-2151.425] (-2157.674) (-2147.444) * (-2152.111) [-2153.317] (-2150.673) (-2154.561) -- 0:01:13
603000 -- (-2151.190) (-2154.928) [-2151.751] (-2154.038) * (-2148.937) [-2150.180] (-2157.854) (-2151.752) -- 0:01:13
603500 -- [-2149.213] (-2146.323) (-2155.466) (-2151.983) * (-2159.260) (-2157.086) (-2155.829) [-2152.964] -- 0:01:12
604000 -- (-2157.375) (-2147.207) (-2157.491) [-2152.649] * (-2152.989) (-2154.180) (-2163.815) [-2151.859] -- 0:01:13
604500 -- (-2154.730) (-2149.830) [-2157.347] (-2153.407) * [-2153.322] (-2151.218) (-2159.177) (-2156.028) -- 0:01:13
605000 -- [-2150.076] (-2153.422) (-2156.450) (-2154.490) * (-2158.893) [-2157.818] (-2157.469) (-2151.332) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
605500 -- [-2154.065] (-2151.695) (-2160.531) (-2153.462) * [-2153.712] (-2151.052) (-2149.852) (-2153.282) -- 0:01:12
606000 -- (-2152.885) [-2154.344] (-2156.583) (-2151.566) * [-2146.993] (-2149.264) (-2157.623) (-2153.016) -- 0:01:12
606500 -- (-2165.028) (-2149.455) [-2153.411] (-2151.982) * [-2149.885] (-2150.603) (-2149.375) (-2147.928) -- 0:01:12
607000 -- (-2150.889) [-2150.929] (-2148.870) (-2151.138) * (-2156.613) [-2147.627] (-2149.571) (-2154.959) -- 0:01:12
607500 -- (-2146.697) [-2149.058] (-2150.338) (-2156.830) * [-2151.748] (-2161.112) (-2157.250) (-2151.653) -- 0:01:12
608000 -- (-2153.020) (-2153.002) [-2151.532] (-2154.837) * (-2161.393) (-2156.094) (-2151.067) [-2145.976] -- 0:01:12
608500 -- (-2156.700) (-2154.513) (-2148.058) [-2154.695] * (-2153.901) (-2152.340) [-2151.324] (-2149.591) -- 0:01:12
609000 -- (-2151.530) (-2152.509) (-2154.916) [-2151.321] * [-2147.165] (-2150.006) (-2152.106) (-2150.012) -- 0:01:11
609500 -- (-2150.210) (-2159.328) [-2148.919] (-2151.706) * (-2153.991) (-2147.665) (-2147.714) [-2152.245] -- 0:01:12
610000 -- (-2157.435) [-2149.637] (-2149.755) (-2152.348) * (-2159.973) [-2154.827] (-2154.553) (-2155.052) -- 0:01:12
Average standard deviation of split frequencies: 0.000000
610500 -- (-2153.552) (-2148.748) [-2150.172] (-2152.449) * (-2154.601) (-2154.997) (-2153.274) [-2151.461] -- 0:01:12
611000 -- (-2148.481) [-2149.971] (-2154.171) (-2152.258) * (-2151.190) (-2155.948) [-2150.658] (-2156.590) -- 0:01:11
611500 -- (-2149.660) (-2153.399) [-2149.991] (-2152.897) * [-2152.929] (-2153.088) (-2151.396) (-2150.959) -- 0:01:11
612000 -- (-2154.949) (-2150.897) [-2156.233] (-2151.074) * (-2150.600) (-2151.228) [-2150.882] (-2155.350) -- 0:01:11
612500 -- (-2149.325) (-2150.799) (-2152.952) [-2151.027] * (-2156.225) (-2156.589) (-2148.236) [-2149.160] -- 0:01:11
613000 -- (-2155.866) (-2152.081) (-2154.434) [-2152.590] * [-2157.020] (-2148.959) (-2151.657) (-2150.717) -- 0:01:11
613500 -- [-2153.360] (-2150.921) (-2153.986) (-2156.723) * (-2158.177) [-2148.527] (-2148.668) (-2148.453) -- 0:01:11
614000 -- (-2158.061) (-2149.415) [-2154.225] (-2155.540) * (-2153.468) [-2153.277] (-2159.531) (-2149.379) -- 0:01:11
614500 -- (-2148.620) [-2151.906] (-2151.975) (-2162.244) * (-2160.685) (-2151.993) (-2153.368) [-2156.317] -- 0:01:10
615000 -- (-2153.920) (-2149.801) [-2153.305] (-2153.270) * (-2150.696) (-2157.207) [-2150.810] (-2158.872) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
615500 -- (-2149.463) [-2151.417] (-2154.382) (-2154.529) * (-2149.870) [-2151.200] (-2151.901) (-2150.980) -- 0:01:11
616000 -- (-2152.579) [-2147.388] (-2150.976) (-2154.432) * [-2154.551] (-2152.631) (-2151.779) (-2148.415) -- 0:01:11
616500 -- (-2153.970) (-2155.446) [-2153.037] (-2157.232) * [-2158.317] (-2153.590) (-2149.262) (-2153.831) -- 0:01:10
617000 -- (-2152.944) (-2158.456) [-2156.676] (-2154.447) * (-2151.664) (-2153.299) [-2152.931] (-2150.888) -- 0:01:10
617500 -- (-2150.001) (-2155.438) [-2152.453] (-2152.111) * (-2153.669) (-2150.209) (-2156.051) [-2146.350] -- 0:01:10
618000 -- [-2152.677] (-2152.561) (-2157.932) (-2149.936) * (-2153.522) (-2149.302) [-2155.697] (-2148.721) -- 0:01:10
618500 -- (-2153.332) (-2156.680) (-2152.406) [-2154.091] * (-2150.437) [-2150.689] (-2152.087) (-2150.749) -- 0:01:10
619000 -- (-2161.144) (-2149.333) (-2148.162) [-2148.689] * [-2152.313] (-2153.865) (-2153.430) (-2155.390) -- 0:01:10
619500 -- (-2149.444) (-2153.872) [-2150.498] (-2152.029) * [-2151.197] (-2151.717) (-2154.028) (-2160.409) -- 0:01:10
620000 -- [-2147.617] (-2155.061) (-2159.222) (-2159.046) * (-2148.592) (-2153.766) [-2157.399] (-2154.855) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
620500 -- (-2154.368) (-2152.667) [-2152.900] (-2171.728) * (-2146.361) (-2153.461) [-2150.475] (-2155.376) -- 0:01:10
621000 -- (-2153.604) [-2154.769] (-2150.301) (-2151.225) * (-2151.225) (-2153.932) [-2149.624] (-2159.119) -- 0:01:10
621500 -- [-2152.292] (-2154.302) (-2157.182) (-2151.072) * [-2154.336] (-2145.971) (-2147.708) (-2153.719) -- 0:01:10
622000 -- (-2153.211) (-2151.393) [-2157.974] (-2151.689) * (-2155.909) [-2152.815] (-2148.502) (-2156.677) -- 0:01:09
622500 -- [-2149.037] (-2154.300) (-2161.527) (-2154.035) * (-2156.563) (-2155.336) [-2149.424] (-2148.462) -- 0:01:09
623000 -- [-2153.539] (-2154.485) (-2150.970) (-2153.229) * (-2154.526) (-2153.448) [-2151.191] (-2153.750) -- 0:01:09
623500 -- (-2150.315) (-2159.989) [-2151.097] (-2153.328) * (-2149.439) [-2152.054] (-2157.647) (-2147.633) -- 0:01:09
624000 -- [-2147.003] (-2153.813) (-2154.031) (-2155.602) * [-2153.945] (-2155.278) (-2152.960) (-2152.132) -- 0:01:09
624500 -- (-2151.350) (-2153.651) (-2155.515) [-2154.652] * (-2150.057) [-2151.676] (-2159.215) (-2151.643) -- 0:01:09
625000 -- (-2157.508) [-2155.113] (-2149.343) (-2154.170) * (-2151.795) (-2153.153) [-2156.902] (-2148.981) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
625500 -- (-2163.813) (-2160.274) (-2154.385) [-2152.003] * (-2150.349) [-2152.698] (-2152.349) (-2146.993) -- 0:01:08
626000 -- (-2161.801) (-2146.843) [-2154.123] (-2155.679) * [-2153.734] (-2154.940) (-2158.222) (-2153.348) -- 0:01:09
626500 -- (-2156.608) [-2148.626] (-2152.162) (-2151.765) * (-2152.304) (-2149.005) [-2157.953] (-2150.926) -- 0:01:09
627000 -- (-2157.991) (-2150.166) [-2154.644] (-2150.992) * (-2154.852) [-2154.467] (-2151.747) (-2150.815) -- 0:01:09
627500 -- [-2151.166] (-2148.999) (-2151.578) (-2151.425) * (-2152.358) (-2149.718) [-2155.066] (-2157.414) -- 0:01:08
628000 -- [-2153.866] (-2153.725) (-2151.000) (-2145.961) * (-2155.005) (-2149.101) (-2159.838) [-2148.926] -- 0:01:08
628500 -- (-2151.788) [-2149.682] (-2151.202) (-2151.811) * (-2157.079) (-2153.097) [-2153.506] (-2154.986) -- 0:01:08
629000 -- (-2153.744) (-2155.041) (-2153.223) [-2154.906] * [-2152.062] (-2153.514) (-2155.225) (-2154.207) -- 0:01:08
629500 -- (-2152.361) (-2152.032) (-2158.220) [-2154.636] * (-2152.758) (-2154.029) (-2156.418) [-2149.556] -- 0:01:08
630000 -- (-2152.703) (-2155.817) (-2150.076) [-2152.605] * (-2149.823) (-2150.870) [-2151.962] (-2148.987) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
630500 -- (-2149.447) (-2163.068) [-2150.437] (-2151.109) * (-2155.390) (-2151.211) (-2147.924) [-2156.562] -- 0:01:07
631000 -- (-2149.837) [-2154.160] (-2153.164) (-2153.268) * (-2156.365) [-2149.385] (-2156.030) (-2149.330) -- 0:01:07
631500 -- (-2156.139) [-2154.568] (-2156.851) (-2155.036) * (-2152.962) [-2150.383] (-2164.748) (-2160.150) -- 0:01:08
632000 -- (-2154.568) (-2159.788) (-2154.158) [-2149.157] * [-2149.602] (-2159.224) (-2154.477) (-2156.762) -- 0:01:08
632500 -- [-2151.558] (-2152.874) (-2152.266) (-2154.858) * [-2154.376] (-2149.234) (-2155.148) (-2152.683) -- 0:01:07
633000 -- (-2148.545) (-2154.683) [-2149.830] (-2147.959) * (-2151.887) [-2156.046] (-2150.525) (-2157.954) -- 0:01:07
633500 -- (-2156.656) (-2151.033) [-2150.928] (-2152.365) * (-2159.652) (-2154.043) [-2150.146] (-2152.373) -- 0:01:07
634000 -- (-2157.355) [-2148.698] (-2152.995) (-2153.784) * (-2164.199) (-2158.594) (-2150.422) [-2153.955] -- 0:01:07
634500 -- (-2152.905) [-2151.299] (-2150.704) (-2153.785) * (-2153.655) (-2165.507) [-2151.547] (-2160.724) -- 0:01:07
635000 -- [-2153.259] (-2154.219) (-2155.285) (-2158.271) * (-2152.967) (-2153.553) [-2152.543] (-2157.735) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
635500 -- (-2150.134) [-2149.402] (-2155.359) (-2159.392) * [-2154.311] (-2150.335) (-2150.760) (-2160.206) -- 0:01:07
636000 -- (-2159.213) (-2159.043) (-2148.567) [-2152.177] * [-2154.817] (-2157.178) (-2157.982) (-2154.762) -- 0:01:06
636500 -- (-2155.697) (-2149.908) (-2149.999) [-2150.139] * (-2150.310) (-2156.471) [-2153.498] (-2162.341) -- 0:01:07
637000 -- (-2150.698) (-2151.769) (-2151.744) [-2154.884] * (-2154.612) (-2150.099) (-2151.610) [-2159.590] -- 0:01:07
637500 -- [-2151.664] (-2149.620) (-2150.630) (-2155.112) * [-2152.085] (-2151.436) (-2150.946) (-2157.314) -- 0:01:07
638000 -- (-2155.539) (-2155.484) [-2155.449] (-2155.705) * (-2149.610) [-2149.290] (-2157.491) (-2156.495) -- 0:01:06
638500 -- (-2155.677) [-2153.186] (-2155.126) (-2154.291) * (-2148.859) (-2150.285) [-2152.506] (-2150.617) -- 0:01:06
639000 -- (-2152.823) (-2155.404) (-2158.781) [-2150.343] * (-2152.004) [-2151.628] (-2148.040) (-2151.949) -- 0:01:06
639500 -- (-2154.981) [-2150.718] (-2153.906) (-2155.372) * [-2146.243] (-2148.826) (-2155.493) (-2151.771) -- 0:01:06
640000 -- (-2154.017) (-2149.006) [-2150.015] (-2152.828) * (-2154.612) [-2147.663] (-2150.959) (-2157.433) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
640500 -- (-2150.929) (-2149.811) (-2148.782) [-2151.744] * (-2155.718) (-2153.785) (-2148.737) [-2150.221] -- 0:01:06
641000 -- (-2150.146) [-2149.013] (-2158.308) (-2160.648) * (-2152.566) (-2153.157) (-2148.942) [-2149.793] -- 0:01:06
641500 -- [-2154.251] (-2150.515) (-2158.494) (-2150.153) * (-2152.786) (-2154.549) (-2152.158) [-2148.517] -- 0:01:05
642000 -- [-2152.280] (-2153.688) (-2154.055) (-2151.056) * [-2150.954] (-2154.875) (-2153.133) (-2154.114) -- 0:01:06
642500 -- (-2154.816) (-2151.082) [-2147.595] (-2149.458) * (-2159.293) (-2151.568) [-2148.823] (-2148.325) -- 0:01:06
643000 -- (-2155.991) (-2157.187) (-2151.238) [-2151.226] * (-2151.777) (-2153.545) [-2150.567] (-2156.279) -- 0:01:06
643500 -- (-2153.130) (-2149.539) (-2167.046) [-2153.082] * (-2157.609) [-2152.379] (-2150.583) (-2156.555) -- 0:01:05
644000 -- (-2155.544) (-2148.948) [-2153.425] (-2154.167) * (-2151.536) (-2150.423) [-2150.330] (-2150.991) -- 0:01:05
644500 -- [-2154.950] (-2150.737) (-2153.679) (-2152.100) * [-2149.469] (-2155.462) (-2149.192) (-2150.238) -- 0:01:05
645000 -- (-2154.642) (-2155.122) [-2154.262] (-2157.693) * (-2152.363) [-2150.238] (-2155.658) (-2154.340) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
645500 -- [-2147.977] (-2153.062) (-2156.143) (-2154.279) * [-2153.113] (-2151.045) (-2154.384) (-2153.183) -- 0:01:05
646000 -- (-2150.178) (-2155.130) [-2150.085] (-2154.533) * [-2147.647] (-2156.614) (-2152.138) (-2150.331) -- 0:01:05
646500 -- (-2151.014) [-2153.222] (-2153.665) (-2152.974) * (-2150.506) (-2151.709) (-2153.043) [-2156.296] -- 0:01:05
647000 -- [-2149.989] (-2149.024) (-2152.714) (-2151.202) * (-2158.214) (-2152.486) (-2150.827) [-2149.368] -- 0:01:04
647500 -- (-2151.198) [-2149.891] (-2153.211) (-2154.062) * (-2153.897) (-2152.774) [-2157.818] (-2155.769) -- 0:01:05
648000 -- (-2149.211) (-2151.603) (-2151.672) [-2161.912] * [-2157.169] (-2151.232) (-2163.283) (-2150.064) -- 0:01:05
648500 -- (-2153.228) (-2154.826) [-2145.841] (-2150.036) * [-2155.136] (-2152.758) (-2155.585) (-2153.834) -- 0:01:05
649000 -- [-2147.815] (-2152.046) (-2147.869) (-2146.990) * (-2150.390) (-2155.625) (-2154.154) [-2150.509] -- 0:01:04
649500 -- (-2150.170) (-2153.872) [-2151.566] (-2154.265) * [-2149.434] (-2149.599) (-2152.086) (-2150.790) -- 0:01:04
650000 -- [-2148.313] (-2156.581) (-2147.961) (-2153.701) * (-2153.191) [-2152.540] (-2153.304) (-2151.952) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
650500 -- (-2151.500) (-2156.163) (-2157.851) [-2155.458] * [-2151.915] (-2153.693) (-2157.694) (-2148.320) -- 0:01:04
651000 -- (-2154.540) (-2153.120) (-2160.142) [-2155.806] * (-2156.000) (-2154.864) [-2156.353] (-2154.821) -- 0:01:04
651500 -- (-2154.978) [-2156.073] (-2150.831) (-2154.168) * [-2156.603] (-2153.339) (-2155.945) (-2154.758) -- 0:01:04
652000 -- (-2152.822) (-2151.370) (-2150.755) [-2149.915] * (-2151.876) (-2149.474) (-2156.270) [-2146.518] -- 0:01:04
652500 -- [-2154.346] (-2147.203) (-2155.453) (-2154.955) * (-2157.312) (-2153.458) [-2160.072] (-2153.398) -- 0:01:03
653000 -- [-2147.725] (-2151.090) (-2152.173) (-2153.185) * (-2152.698) (-2151.585) [-2148.812] (-2149.344) -- 0:01:04
653500 -- [-2147.637] (-2158.235) (-2154.743) (-2155.510) * (-2154.116) (-2153.006) [-2149.291] (-2153.592) -- 0:01:04
654000 -- (-2153.697) (-2154.070) (-2152.825) [-2153.455] * (-2159.249) (-2148.923) (-2152.861) [-2149.477] -- 0:01:04
654500 -- [-2150.487] (-2159.294) (-2150.466) (-2150.029) * (-2156.772) (-2157.094) [-2149.149] (-2152.494) -- 0:01:03
655000 -- (-2155.170) (-2157.072) (-2154.022) [-2151.531] * (-2152.223) [-2152.024] (-2157.429) (-2157.153) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
655500 -- (-2155.403) (-2149.715) (-2154.169) [-2150.733] * (-2154.734) [-2147.610] (-2153.276) (-2154.424) -- 0:01:03
656000 -- (-2155.382) (-2154.489) [-2150.520] (-2150.868) * (-2150.098) (-2153.230) (-2150.315) [-2157.522] -- 0:01:03
656500 -- (-2155.704) [-2153.568] (-2149.812) (-2152.592) * (-2150.592) [-2149.827] (-2162.419) (-2156.335) -- 0:01:03
657000 -- (-2154.934) (-2155.353) (-2149.207) [-2151.876] * (-2149.716) (-2157.599) [-2155.115] (-2154.245) -- 0:01:03
657500 -- [-2150.584] (-2151.832) (-2156.499) (-2155.338) * [-2148.765] (-2149.373) (-2153.260) (-2155.016) -- 0:01:03
658000 -- (-2155.171) (-2156.863) (-2154.904) [-2149.750] * (-2147.709) (-2152.390) [-2148.957] (-2153.415) -- 0:01:02
658500 -- (-2149.194) (-2154.902) (-2152.009) [-2155.622] * (-2151.380) (-2148.647) [-2151.732] (-2151.844) -- 0:01:03
659000 -- (-2155.356) (-2150.944) (-2150.739) [-2151.338] * [-2147.710] (-2151.768) (-2150.151) (-2149.364) -- 0:01:03
659500 -- (-2155.738) (-2154.066) (-2158.129) [-2152.669] * (-2149.533) (-2151.039) [-2152.804] (-2150.998) -- 0:01:02
660000 -- [-2155.669] (-2151.350) (-2156.338) (-2158.882) * (-2149.899) [-2149.463] (-2154.484) (-2155.918) -- 0:01:02
Average standard deviation of split frequencies: 0.000000
660500 -- (-2153.021) [-2154.020] (-2152.934) (-2153.588) * (-2151.534) (-2150.668) [-2150.662] (-2153.343) -- 0:01:02
661000 -- (-2157.889) (-2155.065) [-2151.058] (-2156.026) * (-2150.652) [-2156.842] (-2153.041) (-2149.965) -- 0:01:02
661500 -- (-2157.228) (-2154.944) (-2148.597) [-2152.628] * (-2154.911) (-2150.544) [-2154.565] (-2154.592) -- 0:01:02
662000 -- (-2158.236) (-2152.091) [-2148.899] (-2146.425) * (-2151.504) (-2155.987) (-2153.347) [-2152.717] -- 0:01:02
662500 -- [-2147.717] (-2160.202) (-2150.100) (-2153.644) * (-2148.724) (-2152.804) [-2154.361] (-2161.424) -- 0:01:02
663000 -- (-2156.764) [-2147.778] (-2155.008) (-2159.939) * (-2156.388) [-2152.808] (-2152.967) (-2155.450) -- 0:01:02
663500 -- [-2152.868] (-2154.018) (-2152.718) (-2158.352) * (-2148.781) [-2149.285] (-2148.700) (-2155.922) -- 0:01:01
664000 -- (-2153.741) (-2160.124) (-2152.778) [-2158.912] * (-2153.029) (-2160.474) [-2151.626] (-2155.862) -- 0:01:02
664500 -- [-2156.272] (-2159.821) (-2151.648) (-2154.031) * (-2160.249) (-2163.575) (-2152.356) [-2147.832] -- 0:01:02
665000 -- (-2157.931) (-2154.219) (-2152.146) [-2155.472] * (-2152.682) [-2152.398] (-2153.947) (-2148.524) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
665500 -- (-2153.417) (-2153.136) [-2150.777] (-2155.903) * (-2153.221) [-2152.230] (-2152.043) (-2155.049) -- 0:01:01
666000 -- (-2158.286) (-2150.262) [-2148.326] (-2155.553) * (-2150.665) [-2157.964] (-2155.366) (-2159.130) -- 0:01:01
666500 -- (-2156.546) (-2154.653) (-2150.408) [-2151.133] * (-2152.352) (-2157.157) (-2164.381) [-2156.242] -- 0:01:01
667000 -- (-2151.908) (-2151.280) [-2148.927] (-2154.106) * (-2155.709) (-2150.091) [-2152.948] (-2155.181) -- 0:01:01
667500 -- [-2155.111] (-2151.992) (-2152.410) (-2152.882) * [-2153.924] (-2152.934) (-2151.785) (-2153.971) -- 0:01:01
668000 -- [-2152.848] (-2159.050) (-2153.856) (-2157.219) * (-2153.723) [-2151.349] (-2153.304) (-2154.176) -- 0:01:01
668500 -- (-2157.026) [-2155.460] (-2157.676) (-2152.665) * [-2150.853] (-2158.048) (-2155.342) (-2152.047) -- 0:01:00
669000 -- (-2151.928) [-2149.869] (-2156.450) (-2153.946) * (-2163.068) (-2160.739) (-2164.741) [-2147.899] -- 0:01:00
669500 -- (-2160.423) (-2154.713) [-2156.598] (-2151.903) * (-2161.971) (-2150.836) (-2153.266) [-2149.247] -- 0:01:01
670000 -- [-2151.887] (-2152.464) (-2156.721) (-2151.362) * (-2157.482) (-2150.145) [-2152.542] (-2152.097) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
670500 -- (-2155.186) (-2159.967) (-2167.189) [-2156.164] * (-2157.678) (-2154.405) (-2151.857) [-2151.427] -- 0:01:00
671000 -- (-2151.072) (-2155.969) (-2156.135) [-2151.109] * (-2153.628) (-2150.240) (-2156.051) [-2152.051] -- 0:01:00
671500 -- (-2152.424) [-2150.512] (-2155.469) (-2151.837) * (-2153.971) (-2150.639) [-2147.288] (-2147.744) -- 0:01:00
672000 -- (-2151.333) [-2153.742] (-2153.454) (-2152.615) * [-2152.056] (-2149.382) (-2156.173) (-2153.797) -- 0:01:00
672500 -- (-2155.047) (-2153.750) (-2152.090) [-2156.568] * (-2150.375) [-2155.583] (-2155.799) (-2154.838) -- 0:01:00
673000 -- [-2148.298] (-2150.843) (-2150.612) (-2158.488) * (-2148.551) (-2151.213) (-2149.284) [-2149.279] -- 0:01:00
673500 -- [-2151.052] (-2151.828) (-2154.075) (-2154.191) * (-2149.765) (-2151.654) (-2152.922) [-2148.270] -- 0:01:00
674000 -- (-2152.083) [-2147.750] (-2152.626) (-2149.615) * (-2149.827) [-2147.410] (-2152.981) (-2147.039) -- 0:00:59
674500 -- (-2156.498) [-2152.084] (-2149.293) (-2154.097) * (-2163.239) (-2154.680) (-2150.664) [-2148.925] -- 0:00:59
675000 -- (-2148.331) [-2154.960] (-2160.901) (-2156.280) * [-2152.188] (-2158.776) (-2152.724) (-2154.665) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
675500 -- [-2151.317] (-2150.627) (-2156.817) (-2154.203) * (-2150.573) (-2152.668) [-2149.984] (-2156.269) -- 0:01:00
676000 -- (-2147.205) (-2150.093) (-2157.680) [-2154.933] * (-2154.305) [-2152.400] (-2153.108) (-2154.987) -- 0:00:59
676500 -- (-2155.306) [-2152.421] (-2150.027) (-2154.511) * [-2149.461] (-2164.229) (-2151.531) (-2152.699) -- 0:00:59
677000 -- (-2153.005) (-2151.890) (-2156.107) [-2151.971] * (-2152.988) [-2152.477] (-2149.955) (-2147.594) -- 0:00:59
677500 -- (-2152.575) (-2157.651) [-2149.645] (-2152.284) * (-2158.592) (-2151.939) [-2151.729] (-2156.127) -- 0:00:59
678000 -- (-2160.002) (-2150.802) [-2156.902] (-2152.610) * (-2154.669) (-2151.144) [-2149.111] (-2154.908) -- 0:00:59
678500 -- (-2156.569) (-2153.463) (-2149.626) [-2149.880] * (-2149.985) [-2150.165] (-2151.709) (-2160.170) -- 0:00:59
679000 -- (-2166.610) (-2157.137) [-2151.434] (-2149.652) * (-2150.492) [-2150.206] (-2153.448) (-2149.205) -- 0:00:59
679500 -- (-2161.520) [-2154.610] (-2148.767) (-2153.406) * [-2149.954] (-2156.127) (-2151.235) (-2153.752) -- 0:00:58
680000 -- [-2149.982] (-2152.854) (-2160.734) (-2157.275) * [-2152.000] (-2152.374) (-2155.574) (-2151.617) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
680500 -- [-2154.783] (-2156.946) (-2154.414) (-2152.451) * (-2149.233) (-2149.721) [-2152.829] (-2149.258) -- 0:00:59
681000 -- (-2154.535) (-2154.435) [-2155.595] (-2154.332) * (-2156.283) (-2149.512) (-2153.964) [-2149.224] -- 0:00:59
681500 -- [-2156.429] (-2155.432) (-2148.138) (-2147.788) * (-2157.250) [-2151.024] (-2150.706) (-2156.864) -- 0:00:58
682000 -- (-2150.893) [-2153.209] (-2150.267) (-2154.103) * (-2157.880) [-2151.516] (-2156.948) (-2151.276) -- 0:00:58
682500 -- (-2149.998) (-2150.461) [-2148.103] (-2149.865) * (-2159.226) [-2153.117] (-2156.024) (-2151.357) -- 0:00:58
683000 -- (-2149.445) (-2150.406) [-2151.032] (-2158.677) * (-2154.667) (-2149.546) [-2151.157] (-2150.695) -- 0:00:58
683500 -- (-2148.334) (-2163.300) [-2150.654] (-2153.043) * [-2146.877] (-2154.318) (-2149.936) (-2149.549) -- 0:00:58
684000 -- (-2152.075) (-2155.580) (-2150.003) [-2148.832] * [-2156.143] (-2155.056) (-2154.115) (-2151.928) -- 0:00:58
684500 -- [-2148.752] (-2153.848) (-2152.204) (-2154.227) * (-2147.256) [-2157.247] (-2155.749) (-2149.955) -- 0:00:58
685000 -- (-2153.469) [-2154.250] (-2153.453) (-2149.251) * (-2153.880) (-2154.557) (-2155.229) [-2149.564] -- 0:00:57
Average standard deviation of split frequencies: 0.000000
685500 -- [-2154.959] (-2158.841) (-2148.521) (-2156.544) * (-2152.881) [-2152.179] (-2159.199) (-2152.905) -- 0:00:58
686000 -- (-2160.769) (-2154.121) [-2149.027] (-2149.650) * (-2151.603) [-2150.018] (-2153.063) (-2161.544) -- 0:00:58
686500 -- [-2161.155] (-2155.606) (-2151.260) (-2155.570) * [-2152.256] (-2157.294) (-2150.208) (-2159.426) -- 0:00:57
687000 -- (-2155.580) (-2160.415) [-2150.229] (-2160.757) * (-2150.941) [-2151.340] (-2155.368) (-2150.963) -- 0:00:57
687500 -- (-2158.110) [-2153.363] (-2151.111) (-2157.816) * (-2149.914) (-2149.701) [-2150.989] (-2155.469) -- 0:00:57
688000 -- [-2153.273] (-2155.758) (-2151.627) (-2156.442) * (-2148.566) (-2155.060) (-2156.216) [-2155.996] -- 0:00:57
688500 -- (-2152.349) (-2156.701) (-2153.059) [-2154.151] * (-2149.652) [-2152.380] (-2157.555) (-2157.542) -- 0:00:57
689000 -- (-2153.778) [-2152.961] (-2154.267) (-2159.065) * (-2152.584) (-2152.825) (-2151.148) [-2148.135] -- 0:00:57
689500 -- (-2148.998) [-2160.469] (-2153.828) (-2155.099) * (-2159.573) (-2150.538) (-2158.942) [-2148.557] -- 0:00:57
690000 -- (-2160.193) (-2154.738) [-2157.224] (-2153.737) * (-2155.135) (-2158.749) [-2150.463] (-2161.384) -- 0:00:57
Average standard deviation of split frequencies: 0.000000
690500 -- (-2152.964) [-2150.010] (-2149.622) (-2156.094) * (-2158.647) (-2151.293) [-2149.801] (-2154.094) -- 0:00:56
691000 -- [-2148.623] (-2152.172) (-2158.496) (-2152.553) * (-2158.037) (-2150.269) (-2153.405) [-2155.238] -- 0:00:57
691500 -- (-2152.459) [-2149.491] (-2162.003) (-2161.525) * (-2154.339) [-2155.696] (-2157.108) (-2149.913) -- 0:00:57
692000 -- (-2150.989) (-2152.862) (-2154.783) [-2149.215] * (-2164.092) (-2149.796) (-2148.605) [-2151.457] -- 0:00:56
692500 -- (-2154.497) (-2151.854) [-2146.291] (-2155.362) * [-2153.043] (-2154.264) (-2154.508) (-2151.308) -- 0:00:56
693000 -- (-2166.547) (-2151.132) [-2152.987] (-2151.968) * (-2155.122) (-2151.651) [-2150.336] (-2152.064) -- 0:00:56
693500 -- (-2157.060) (-2152.685) [-2155.933] (-2152.389) * (-2154.096) (-2153.608) (-2157.190) [-2149.919] -- 0:00:56
694000 -- (-2153.753) (-2152.878) (-2158.371) [-2154.199] * (-2160.293) (-2157.828) [-2152.846] (-2152.178) -- 0:00:56
694500 -- (-2147.372) (-2153.530) [-2150.560] (-2153.560) * [-2153.272] (-2158.333) (-2157.370) (-2151.338) -- 0:00:56
695000 -- (-2151.497) [-2152.080] (-2150.299) (-2164.253) * (-2150.218) [-2153.319] (-2149.402) (-2151.581) -- 0:00:56
Average standard deviation of split frequencies: 0.000000
695500 -- (-2149.016) (-2147.641) (-2147.423) [-2157.177] * [-2149.112] (-2152.042) (-2154.347) (-2149.250) -- 0:00:56
696000 -- (-2154.332) [-2150.717] (-2152.105) (-2158.168) * (-2150.093) (-2153.775) [-2149.393] (-2150.156) -- 0:00:55
696500 -- [-2149.523] (-2149.163) (-2154.535) (-2161.213) * (-2158.745) (-2152.672) (-2153.471) [-2148.742] -- 0:00:56
697000 -- (-2150.874) (-2154.776) (-2159.293) [-2151.250] * (-2151.526) (-2154.742) [-2155.613] (-2157.898) -- 0:00:56
697500 -- (-2155.339) (-2155.504) [-2155.393] (-2155.383) * (-2150.991) (-2153.517) (-2154.094) [-2155.341] -- 0:00:55
698000 -- (-2147.948) (-2147.772) [-2153.616] (-2152.743) * (-2151.758) (-2151.683) (-2151.586) [-2150.862] -- 0:00:55
698500 -- (-2151.520) [-2150.840] (-2151.936) (-2151.101) * [-2154.372] (-2162.196) (-2147.710) (-2157.086) -- 0:00:55
699000 -- (-2155.104) (-2150.763) (-2152.917) [-2150.558] * (-2156.957) (-2155.301) [-2153.096] (-2153.544) -- 0:00:55
699500 -- (-2153.401) [-2152.321] (-2154.720) (-2151.257) * (-2156.793) [-2148.711] (-2149.786) (-2155.952) -- 0:00:55
700000 -- (-2153.578) (-2161.045) (-2155.464) [-2151.848] * (-2151.982) (-2159.844) [-2149.841] (-2154.010) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
700500 -- (-2155.400) (-2156.207) [-2155.689] (-2148.415) * (-2153.761) (-2159.059) (-2160.186) [-2153.987] -- 0:00:55
701000 -- (-2157.243) (-2153.191) (-2151.278) [-2155.249] * (-2148.808) (-2154.866) [-2155.138] (-2153.510) -- 0:00:55
701500 -- (-2151.668) (-2149.100) (-2165.165) [-2152.015] * (-2151.073) (-2151.881) [-2153.626] (-2157.718) -- 0:00:54
702000 -- (-2150.086) [-2149.885] (-2155.730) (-2151.120) * (-2153.884) (-2150.511) (-2157.233) [-2155.329] -- 0:00:55
702500 -- (-2154.108) (-2156.443) (-2161.373) [-2154.989] * (-2149.349) (-2154.690) (-2158.600) [-2163.527] -- 0:00:55
703000 -- (-2156.472) [-2151.559] (-2154.697) (-2155.392) * (-2149.751) (-2156.696) (-2148.541) [-2157.310] -- 0:00:54
703500 -- (-2154.856) [-2151.234] (-2154.782) (-2151.734) * (-2159.770) (-2152.054) [-2154.713] (-2150.215) -- 0:00:54
704000 -- [-2151.630] (-2151.288) (-2158.191) (-2155.453) * [-2159.555] (-2153.001) (-2154.086) (-2152.609) -- 0:00:54
704500 -- [-2152.673] (-2155.453) (-2152.156) (-2149.152) * (-2154.751) (-2155.534) [-2155.570] (-2148.589) -- 0:00:54
705000 -- (-2150.528) (-2151.251) (-2153.400) [-2158.441] * (-2153.721) [-2149.297] (-2156.451) (-2151.145) -- 0:00:54
Average standard deviation of split frequencies: 0.000000
705500 -- [-2151.401] (-2153.851) (-2149.065) (-2150.260) * (-2153.660) (-2151.407) [-2149.399] (-2154.096) -- 0:00:54
706000 -- (-2155.043) (-2160.736) [-2155.477] (-2150.613) * [-2154.741] (-2149.588) (-2154.789) (-2148.610) -- 0:00:54
706500 -- (-2156.578) [-2153.044] (-2152.547) (-2156.653) * (-2155.454) [-2155.866] (-2150.388) (-2154.692) -- 0:00:54
707000 -- (-2154.246) [-2148.797] (-2152.577) (-2153.492) * (-2156.129) (-2157.829) [-2150.355] (-2156.791) -- 0:00:53
707500 -- (-2151.218) (-2154.526) (-2156.291) [-2153.491] * (-2157.860) (-2151.094) (-2149.456) [-2150.482] -- 0:00:54
708000 -- (-2151.520) [-2150.194] (-2154.633) (-2152.526) * [-2151.172] (-2153.046) (-2148.859) (-2150.772) -- 0:00:54
708500 -- [-2150.797] (-2157.172) (-2148.633) (-2150.282) * [-2153.238] (-2157.945) (-2153.091) (-2147.832) -- 0:00:53
709000 -- [-2152.480] (-2153.070) (-2150.650) (-2154.761) * [-2156.938] (-2154.761) (-2154.851) (-2156.577) -- 0:00:53
709500 -- [-2152.716] (-2154.973) (-2152.270) (-2155.070) * (-2154.055) (-2158.401) [-2152.389] (-2153.035) -- 0:00:53
710000 -- (-2160.829) (-2159.242) (-2155.028) [-2162.146] * (-2157.151) (-2151.022) (-2154.038) [-2159.354] -- 0:00:53
Average standard deviation of split frequencies: 0.000000
710500 -- (-2150.333) [-2152.551] (-2156.205) (-2154.583) * (-2152.356) (-2152.471) [-2153.242] (-2155.859) -- 0:00:53
711000 -- [-2151.381] (-2156.355) (-2150.129) (-2154.682) * (-2154.796) (-2150.821) [-2150.815] (-2153.056) -- 0:00:53
711500 -- (-2157.843) (-2151.855) [-2153.368] (-2152.334) * (-2152.304) [-2147.123] (-2153.973) (-2154.089) -- 0:00:53
712000 -- (-2155.860) (-2152.306) (-2156.451) [-2155.656] * (-2161.380) [-2155.804] (-2150.290) (-2159.290) -- 0:00:52
712500 -- [-2160.551] (-2160.781) (-2152.108) (-2152.727) * [-2151.785] (-2150.099) (-2151.833) (-2159.978) -- 0:00:52
713000 -- (-2155.871) (-2157.032) [-2148.612] (-2162.351) * [-2150.083] (-2161.315) (-2149.713) (-2152.995) -- 0:00:53
713500 -- (-2156.415) (-2160.679) (-2149.836) [-2152.679] * (-2154.020) (-2152.685) [-2148.939] (-2150.306) -- 0:00:53
714000 -- (-2166.143) (-2157.473) (-2155.465) [-2152.759] * (-2155.802) [-2149.105] (-2155.021) (-2154.444) -- 0:00:52
714500 -- (-2154.099) [-2152.234] (-2151.124) (-2153.001) * (-2149.848) (-2151.183) [-2149.890] (-2153.844) -- 0:00:52
715000 -- [-2161.809] (-2160.628) (-2148.790) (-2150.996) * (-2149.305) (-2152.148) [-2151.666] (-2148.556) -- 0:00:52
Average standard deviation of split frequencies: 0.000000
715500 -- (-2153.716) (-2153.472) (-2150.919) [-2152.920] * (-2151.335) (-2153.788) [-2146.896] (-2153.798) -- 0:00:52
716000 -- (-2158.001) (-2154.685) [-2153.656] (-2154.798) * (-2151.524) (-2159.365) [-2148.528] (-2164.749) -- 0:00:52
716500 -- (-2154.185) [-2148.763] (-2150.512) (-2150.129) * (-2151.718) (-2157.991) [-2156.902] (-2151.046) -- 0:00:52
717000 -- (-2156.422) [-2149.452] (-2155.206) (-2152.521) * (-2155.071) (-2157.370) [-2146.369] (-2154.110) -- 0:00:52
717500 -- (-2156.345) [-2150.061] (-2152.774) (-2158.083) * (-2156.367) [-2154.496] (-2152.055) (-2151.263) -- 0:00:51
718000 -- (-2150.960) [-2152.793] (-2156.463) (-2152.215) * (-2162.550) (-2158.402) [-2149.767] (-2152.483) -- 0:00:51
718500 -- (-2153.387) (-2150.914) (-2153.935) [-2158.449] * (-2158.588) [-2151.426] (-2151.144) (-2152.285) -- 0:00:52
719000 -- [-2149.936] (-2149.366) (-2151.546) (-2155.110) * (-2159.554) (-2155.097) [-2151.100] (-2155.460) -- 0:00:51
719500 -- (-2164.331) (-2149.658) (-2153.237) [-2151.518] * [-2164.490] (-2157.350) (-2150.348) (-2147.248) -- 0:00:51
720000 -- (-2154.805) (-2152.139) [-2154.056] (-2151.819) * (-2158.461) (-2154.299) [-2151.275] (-2149.629) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
720500 -- (-2153.090) (-2155.201) (-2157.292) [-2152.843] * [-2157.552] (-2147.969) (-2155.733) (-2148.438) -- 0:00:51
721000 -- [-2150.772] (-2151.950) (-2149.567) (-2148.100) * [-2148.725] (-2150.206) (-2153.048) (-2151.271) -- 0:00:51
721500 -- (-2155.547) (-2154.491) (-2148.054) [-2154.704] * (-2150.666) (-2164.025) [-2156.304] (-2158.415) -- 0:00:51
722000 -- (-2151.692) [-2152.984] (-2151.640) (-2163.122) * (-2157.946) (-2151.038) [-2153.563] (-2150.780) -- 0:00:51
722500 -- (-2159.430) (-2152.351) (-2152.718) [-2149.172] * [-2156.929] (-2147.136) (-2159.615) (-2154.789) -- 0:00:51
723000 -- (-2155.350) (-2157.729) (-2155.342) [-2155.342] * (-2157.586) (-2148.020) (-2163.405) [-2156.158] -- 0:00:50
723500 -- [-2152.462] (-2151.828) (-2158.300) (-2149.172) * (-2150.471) (-2147.940) [-2156.597] (-2158.822) -- 0:00:50
724000 -- (-2158.333) (-2152.219) (-2151.570) [-2154.433] * (-2149.742) (-2151.778) [-2155.375] (-2155.227) -- 0:00:51
724500 -- [-2155.044] (-2158.092) (-2149.578) (-2155.491) * [-2148.228] (-2156.973) (-2158.691) (-2151.834) -- 0:00:50
725000 -- (-2150.876) [-2157.027] (-2158.355) (-2149.679) * (-2149.328) (-2147.495) (-2150.201) [-2149.642] -- 0:00:50
Average standard deviation of split frequencies: 0.000000
725500 -- (-2153.523) (-2150.092) (-2150.291) [-2152.816] * (-2153.127) [-2152.860] (-2159.182) (-2154.303) -- 0:00:50
726000 -- (-2154.383) (-2157.946) (-2149.403) [-2147.991] * (-2150.291) [-2152.589] (-2151.774) (-2158.577) -- 0:00:50
726500 -- [-2148.684] (-2154.600) (-2154.326) (-2164.987) * (-2150.091) (-2150.066) [-2150.032] (-2153.716) -- 0:00:50
727000 -- (-2153.786) (-2152.334) [-2155.669] (-2164.772) * (-2155.280) (-2152.349) [-2149.780] (-2158.176) -- 0:00:50
727500 -- [-2146.915] (-2153.494) (-2150.224) (-2148.453) * (-2151.511) [-2152.421] (-2151.044) (-2152.460) -- 0:00:50
728000 -- (-2159.890) (-2154.622) (-2155.226) [-2147.112] * (-2156.755) [-2152.979] (-2156.343) (-2150.936) -- 0:00:50
728500 -- [-2150.965] (-2151.734) (-2154.915) (-2154.600) * (-2151.381) [-2158.349] (-2153.711) (-2152.133) -- 0:00:49
729000 -- (-2148.187) (-2153.479) (-2153.685) [-2151.546] * (-2156.336) (-2161.545) (-2147.689) [-2151.916] -- 0:00:50
729500 -- (-2152.803) (-2162.453) [-2155.437] (-2147.714) * [-2159.347] (-2152.942) (-2149.722) (-2153.774) -- 0:00:50
730000 -- (-2163.423) (-2161.370) (-2160.056) [-2158.440] * [-2152.078] (-2153.937) (-2157.448) (-2156.578) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
730500 -- (-2155.846) (-2152.165) (-2158.296) [-2155.412] * (-2158.483) [-2150.472] (-2154.463) (-2159.446) -- 0:00:49
731000 -- [-2152.100] (-2154.474) (-2152.665) (-2149.220) * [-2154.757] (-2157.157) (-2149.022) (-2155.386) -- 0:00:49
731500 -- (-2154.530) (-2156.677) (-2151.726) [-2154.833] * (-2154.353) [-2149.707] (-2164.778) (-2153.106) -- 0:00:49
732000 -- (-2151.274) [-2154.155] (-2157.047) (-2154.758) * [-2157.387] (-2154.029) (-2159.856) (-2150.252) -- 0:00:49
732500 -- (-2155.935) (-2152.664) [-2148.429] (-2153.301) * (-2158.587) [-2151.325] (-2154.467) (-2153.022) -- 0:00:49
733000 -- (-2151.737) (-2152.800) (-2151.728) [-2154.144] * (-2151.868) (-2158.283) (-2156.802) [-2152.429] -- 0:00:49
733500 -- (-2155.807) (-2153.700) (-2150.600) [-2150.312] * (-2160.114) [-2150.676] (-2152.962) (-2151.787) -- 0:00:49
734000 -- (-2150.681) (-2157.103) (-2150.698) [-2158.292] * (-2155.903) [-2151.325] (-2150.997) (-2149.771) -- 0:00:48
734500 -- (-2154.453) (-2156.014) (-2156.138) [-2156.804] * (-2152.470) [-2152.255] (-2158.060) (-2154.903) -- 0:00:49
735000 -- (-2152.665) [-2154.251] (-2155.021) (-2150.201) * [-2153.272] (-2150.998) (-2152.154) (-2152.863) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
735500 -- (-2150.199) [-2150.886] (-2151.456) (-2151.040) * (-2155.004) (-2149.272) [-2147.288] (-2156.454) -- 0:00:48
736000 -- (-2153.806) (-2156.435) (-2160.538) [-2148.325] * (-2155.629) (-2152.768) [-2151.951] (-2149.778) -- 0:00:48
736500 -- (-2154.854) (-2158.522) [-2150.818] (-2153.239) * [-2150.417] (-2151.015) (-2157.976) (-2151.096) -- 0:00:48
737000 -- (-2156.487) (-2149.573) (-2149.384) [-2150.435] * (-2148.989) (-2150.025) [-2155.030] (-2150.578) -- 0:00:48
737500 -- (-2152.996) (-2151.734) (-2159.366) [-2147.409] * (-2152.887) (-2150.268) (-2155.717) [-2154.443] -- 0:00:48
738000 -- (-2153.282) (-2153.381) (-2153.780) [-2151.489] * [-2150.929] (-2150.096) (-2156.782) (-2158.550) -- 0:00:48
738500 -- (-2150.033) (-2157.793) [-2150.568] (-2154.694) * [-2153.516] (-2154.533) (-2151.549) (-2157.958) -- 0:00:48
739000 -- (-2152.760) [-2153.034] (-2153.164) (-2151.039) * (-2149.239) (-2159.268) [-2155.531] (-2158.753) -- 0:00:48
739500 -- (-2153.492) [-2149.805] (-2155.515) (-2150.210) * [-2155.683] (-2151.395) (-2152.390) (-2155.577) -- 0:00:47
740000 -- [-2149.973] (-2157.554) (-2156.669) (-2151.484) * (-2155.691) [-2153.750] (-2149.360) (-2159.483) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
740500 -- [-2157.425] (-2152.670) (-2158.857) (-2152.315) * (-2148.092) (-2154.695) (-2153.068) [-2154.619] -- 0:00:48
741000 -- (-2150.373) [-2149.405] (-2157.491) (-2150.056) * [-2147.118] (-2151.410) (-2151.769) (-2153.776) -- 0:00:47
741500 -- [-2149.715] (-2151.711) (-2152.603) (-2154.998) * [-2148.149] (-2150.816) (-2150.084) (-2155.164) -- 0:00:47
742000 -- [-2151.641] (-2155.255) (-2153.021) (-2161.231) * [-2151.023] (-2152.740) (-2149.870) (-2147.134) -- 0:00:47
742500 -- (-2165.093) [-2149.716] (-2154.035) (-2155.078) * (-2154.044) [-2149.864] (-2149.590) (-2154.532) -- 0:00:47
743000 -- (-2162.106) (-2156.488) [-2150.545] (-2153.971) * [-2152.693] (-2157.061) (-2152.004) (-2151.114) -- 0:00:47
743500 -- (-2154.212) [-2156.632] (-2154.308) (-2155.407) * (-2157.205) (-2154.978) [-2150.845] (-2150.898) -- 0:00:47
744000 -- (-2163.654) (-2153.089) [-2154.958] (-2157.688) * (-2148.753) (-2156.601) [-2151.112] (-2149.352) -- 0:00:47
744500 -- (-2157.727) (-2156.172) [-2153.419] (-2154.649) * [-2147.772] (-2152.384) (-2152.264) (-2152.597) -- 0:00:47
745000 -- [-2150.859] (-2159.054) (-2151.559) (-2155.443) * (-2156.326) [-2148.950] (-2151.675) (-2151.125) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
745500 -- (-2153.158) (-2149.712) [-2158.564] (-2158.458) * (-2153.101) [-2154.151] (-2157.622) (-2151.164) -- 0:00:47
746000 -- (-2149.956) (-2151.999) [-2151.802] (-2161.347) * (-2152.598) (-2152.641) (-2154.442) [-2146.699] -- 0:00:46
746500 -- [-2153.745] (-2155.840) (-2153.984) (-2150.939) * [-2156.629] (-2152.238) (-2154.426) (-2149.504) -- 0:00:46
747000 -- [-2148.518] (-2155.883) (-2153.073) (-2158.092) * (-2151.155) (-2156.442) [-2153.904] (-2156.850) -- 0:00:46
747500 -- (-2152.016) [-2155.541] (-2150.393) (-2162.174) * (-2150.979) (-2149.475) (-2153.563) [-2150.469] -- 0:00:46
748000 -- (-2150.861) (-2154.080) (-2155.264) [-2157.942] * (-2153.795) [-2152.973] (-2149.738) (-2152.966) -- 0:00:46
748500 -- (-2149.625) (-2153.954) (-2155.172) [-2149.461] * (-2155.211) [-2145.686] (-2152.329) (-2155.269) -- 0:00:46
749000 -- (-2152.738) (-2156.922) [-2151.652] (-2152.310) * (-2158.835) [-2153.833] (-2149.577) (-2159.122) -- 0:00:46
749500 -- (-2152.491) (-2150.779) (-2159.043) [-2148.247] * (-2156.646) [-2149.761] (-2153.508) (-2158.173) -- 0:00:46
750000 -- (-2148.014) (-2151.943) (-2157.851) [-2151.082] * (-2158.337) [-2151.693] (-2155.243) (-2155.727) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
750500 -- (-2151.696) (-2150.537) (-2158.472) [-2154.008] * (-2157.518) [-2151.882] (-2164.438) (-2150.976) -- 0:00:45
751000 -- (-2152.704) (-2155.016) [-2154.339] (-2162.809) * (-2154.539) (-2152.556) [-2149.985] (-2160.433) -- 0:00:46
751500 -- (-2159.885) (-2162.594) (-2153.361) [-2152.107] * (-2151.153) (-2160.227) [-2152.315] (-2155.512) -- 0:00:45
752000 -- (-2156.522) (-2147.479) (-2149.885) [-2153.863] * (-2146.973) (-2158.596) [-2153.164] (-2154.524) -- 0:00:45
752500 -- (-2153.854) [-2149.961] (-2156.415) (-2157.302) * [-2148.577] (-2153.726) (-2153.736) (-2152.963) -- 0:00:45
753000 -- (-2149.689) (-2151.931) (-2159.520) [-2159.111] * [-2148.348] (-2153.713) (-2159.060) (-2151.500) -- 0:00:45
753500 -- (-2157.384) [-2154.019] (-2153.957) (-2152.569) * [-2150.487] (-2158.379) (-2157.434) (-2153.090) -- 0:00:45
754000 -- (-2149.958) (-2164.631) (-2153.089) [-2154.272] * (-2155.948) (-2154.299) (-2157.587) [-2152.498] -- 0:00:45
754500 -- (-2151.627) (-2155.696) [-2151.224] (-2157.883) * [-2152.052] (-2151.666) (-2155.718) (-2160.079) -- 0:00:45
755000 -- [-2155.204] (-2159.277) (-2155.337) (-2157.591) * [-2152.315] (-2154.722) (-2151.070) (-2157.183) -- 0:00:45
Average standard deviation of split frequencies: 0.000000
755500 -- [-2152.120] (-2154.983) (-2154.852) (-2157.078) * (-2154.455) [-2148.856] (-2152.072) (-2154.719) -- 0:00:44
756000 -- (-2150.775) [-2153.695] (-2152.882) (-2156.229) * (-2162.933) [-2153.921] (-2153.178) (-2157.742) -- 0:00:44
756500 -- (-2154.390) (-2157.089) (-2150.141) [-2153.236] * (-2150.859) (-2150.710) [-2150.170] (-2151.679) -- 0:00:45
757000 -- [-2149.541] (-2159.139) (-2155.785) (-2151.485) * [-2146.165] (-2152.614) (-2161.580) (-2149.563) -- 0:00:44
757500 -- (-2156.581) (-2154.508) (-2149.093) [-2149.689] * (-2152.378) [-2156.873] (-2154.006) (-2160.909) -- 0:00:44
758000 -- (-2159.863) (-2165.774) (-2158.619) [-2149.933] * [-2150.682] (-2152.342) (-2155.048) (-2149.710) -- 0:00:44
758500 -- [-2150.205] (-2162.468) (-2153.977) (-2155.548) * (-2158.376) (-2151.516) [-2149.036] (-2152.161) -- 0:00:44
759000 -- (-2155.209) (-2163.920) [-2158.317] (-2149.858) * (-2157.348) (-2157.050) [-2146.588] (-2158.868) -- 0:00:44
759500 -- (-2153.430) (-2162.779) (-2159.864) [-2149.605] * (-2159.511) [-2155.880] (-2150.081) (-2154.586) -- 0:00:44
760000 -- [-2153.262] (-2165.876) (-2158.341) (-2154.453) * (-2162.865) (-2153.929) (-2150.056) [-2151.166] -- 0:00:44
Average standard deviation of split frequencies: 0.000000
760500 -- [-2152.081] (-2151.828) (-2151.957) (-2150.602) * (-2156.406) [-2150.076] (-2153.224) (-2153.549) -- 0:00:44
761000 -- (-2152.670) (-2167.552) (-2152.630) [-2154.202] * (-2158.140) (-2150.219) [-2150.096] (-2149.908) -- 0:00:43
761500 -- [-2150.857] (-2151.074) (-2152.798) (-2159.790) * (-2156.854) [-2151.206] (-2152.402) (-2155.091) -- 0:00:43
762000 -- (-2151.699) [-2153.476] (-2157.403) (-2151.885) * (-2154.063) (-2153.772) (-2161.197) [-2150.988] -- 0:00:44
762500 -- [-2157.641] (-2155.442) (-2166.984) (-2153.976) * [-2156.055] (-2154.316) (-2151.792) (-2148.476) -- 0:00:43
763000 -- (-2155.740) (-2150.102) (-2157.922) [-2148.151] * (-2159.717) (-2156.660) [-2153.912] (-2151.902) -- 0:00:43
763500 -- [-2150.776] (-2154.623) (-2156.075) (-2150.563) * [-2151.729] (-2152.137) (-2150.907) (-2158.943) -- 0:00:43
764000 -- (-2154.432) (-2159.272) [-2158.916] (-2148.585) * (-2152.852) (-2152.093) (-2149.953) [-2153.235] -- 0:00:43
764500 -- (-2149.356) (-2155.880) [-2159.111] (-2155.667) * (-2156.565) (-2153.815) (-2148.203) [-2155.179] -- 0:00:43
765000 -- (-2158.944) (-2152.337) [-2150.363] (-2152.205) * (-2157.230) (-2153.162) (-2150.193) [-2155.929] -- 0:00:43
Average standard deviation of split frequencies: 0.000000
765500 -- (-2157.228) (-2156.708) (-2152.277) [-2157.943] * (-2155.087) (-2155.483) (-2151.197) [-2154.130] -- 0:00:43
766000 -- [-2151.943] (-2151.027) (-2152.691) (-2160.179) * (-2155.859) [-2150.356] (-2150.541) (-2156.620) -- 0:00:43
766500 -- [-2148.032] (-2157.195) (-2152.003) (-2155.473) * (-2154.229) (-2151.755) (-2151.822) [-2151.657] -- 0:00:42
767000 -- [-2149.773] (-2149.197) (-2149.259) (-2155.660) * [-2153.384] (-2153.776) (-2156.120) (-2152.761) -- 0:00:43
767500 -- (-2157.446) (-2151.941) [-2151.807] (-2157.446) * (-2158.806) (-2157.100) (-2161.993) [-2152.984] -- 0:00:43
768000 -- (-2158.691) [-2153.658] (-2154.618) (-2153.635) * [-2160.782] (-2149.130) (-2155.544) (-2150.157) -- 0:00:42
768500 -- (-2157.842) (-2150.971) (-2149.140) [-2153.397] * (-2150.281) (-2156.498) (-2153.532) [-2148.706] -- 0:00:42
769000 -- (-2162.821) [-2152.547] (-2157.259) (-2159.002) * (-2152.369) [-2159.060] (-2156.740) (-2157.034) -- 0:00:42
769500 -- [-2152.624] (-2146.889) (-2154.802) (-2160.025) * (-2151.641) (-2156.248) (-2149.907) [-2157.092] -- 0:00:42
770000 -- [-2153.802] (-2152.266) (-2151.901) (-2151.404) * (-2149.280) (-2154.186) [-2149.762] (-2155.351) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
770500 -- (-2156.524) (-2150.985) [-2149.345] (-2160.572) * (-2147.967) [-2159.175] (-2151.847) (-2158.285) -- 0:00:42
771000 -- (-2150.921) (-2151.263) [-2155.660] (-2158.339) * (-2150.600) (-2157.518) (-2149.745) [-2155.929] -- 0:00:42
771500 -- (-2152.677) (-2158.321) [-2156.214] (-2159.969) * [-2149.909] (-2151.959) (-2155.432) (-2150.719) -- 0:00:42
772000 -- (-2149.241) (-2151.800) (-2160.341) [-2156.219] * [-2150.514] (-2156.913) (-2148.665) (-2151.836) -- 0:00:41
772500 -- (-2153.957) (-2152.166) [-2156.000] (-2163.687) * (-2151.006) (-2158.805) [-2151.509] (-2153.597) -- 0:00:42
773000 -- (-2153.743) (-2152.815) (-2165.518) [-2155.044] * (-2146.357) (-2155.932) [-2154.477] (-2162.368) -- 0:00:41
773500 -- (-2152.226) (-2149.822) [-2153.435] (-2153.639) * (-2149.975) (-2158.015) [-2152.301] (-2157.641) -- 0:00:41
774000 -- (-2157.675) (-2157.291) (-2150.588) [-2153.927] * (-2153.570) (-2159.925) (-2150.581) [-2150.139] -- 0:00:41
774500 -- (-2152.615) [-2148.316] (-2162.632) (-2153.588) * (-2156.475) (-2155.619) [-2149.177] (-2156.568) -- 0:00:41
775000 -- (-2158.393) (-2152.796) (-2157.866) [-2150.418] * (-2152.499) [-2154.689] (-2159.439) (-2152.127) -- 0:00:41
Average standard deviation of split frequencies: 0.000000
775500 -- [-2157.167] (-2151.925) (-2151.065) (-2154.231) * (-2152.814) (-2153.526) [-2147.497] (-2154.556) -- 0:00:41
776000 -- (-2162.616) [-2151.971] (-2151.511) (-2153.623) * (-2157.814) [-2152.978] (-2150.636) (-2148.022) -- 0:00:41
776500 -- (-2156.440) (-2157.179) (-2151.357) [-2153.467] * (-2155.405) (-2154.674) [-2152.450] (-2153.947) -- 0:00:41
777000 -- (-2156.034) (-2153.108) (-2154.568) [-2149.615] * (-2149.204) (-2151.970) [-2151.592] (-2157.525) -- 0:00:41
777500 -- (-2155.595) (-2148.449) (-2154.196) [-2148.855] * (-2153.864) (-2151.125) [-2150.574] (-2154.349) -- 0:00:40
778000 -- (-2162.908) [-2149.453] (-2146.439) (-2150.543) * (-2157.056) [-2153.868] (-2146.943) (-2160.125) -- 0:00:41
778500 -- [-2149.027] (-2153.122) (-2157.637) (-2148.212) * (-2152.997) (-2148.591) (-2153.804) [-2154.587] -- 0:00:40
779000 -- (-2151.962) (-2157.771) (-2154.960) [-2153.561] * (-2156.167) (-2154.864) (-2151.523) [-2155.676] -- 0:00:40
779500 -- (-2156.026) [-2156.043] (-2153.073) (-2152.798) * (-2150.368) [-2156.748] (-2149.247) (-2163.125) -- 0:00:40
780000 -- [-2152.057] (-2150.600) (-2152.246) (-2157.264) * [-2149.284] (-2149.363) (-2153.197) (-2160.354) -- 0:00:40
Average standard deviation of split frequencies: 0.000000
780500 -- (-2152.485) (-2151.061) [-2152.537] (-2150.913) * (-2157.001) [-2149.922] (-2157.143) (-2160.288) -- 0:00:40
781000 -- (-2151.697) [-2148.644] (-2152.523) (-2154.560) * (-2159.252) (-2152.663) [-2150.685] (-2159.370) -- 0:00:40
781500 -- [-2152.230] (-2154.421) (-2148.244) (-2163.327) * (-2158.763) [-2150.454] (-2155.073) (-2156.909) -- 0:00:40
782000 -- [-2154.130] (-2153.188) (-2153.294) (-2158.717) * (-2149.001) (-2152.657) (-2153.289) [-2151.482] -- 0:00:40
782500 -- [-2160.067] (-2156.481) (-2158.859) (-2148.014) * (-2155.538) (-2148.126) (-2153.041) [-2150.557] -- 0:00:40
783000 -- (-2150.837) [-2156.261] (-2150.691) (-2152.435) * (-2155.223) [-2152.015] (-2149.213) (-2159.137) -- 0:00:39
783500 -- (-2148.107) [-2154.436] (-2153.536) (-2157.358) * (-2155.933) (-2159.265) [-2149.551] (-2155.002) -- 0:00:40
784000 -- (-2151.670) [-2152.995] (-2154.406) (-2147.786) * (-2150.522) (-2153.141) (-2150.408) [-2149.701] -- 0:00:39
784500 -- (-2152.076) (-2154.051) (-2152.349) [-2152.096] * (-2150.678) (-2149.217) [-2152.073] (-2153.810) -- 0:00:39
785000 -- [-2150.099] (-2152.757) (-2156.153) (-2160.061) * (-2150.897) (-2149.973) (-2148.389) [-2153.092] -- 0:00:39
Average standard deviation of split frequencies: 0.000000
785500 -- (-2166.596) [-2161.056] (-2151.926) (-2154.216) * (-2154.099) [-2154.130] (-2152.456) (-2153.818) -- 0:00:39
786000 -- (-2156.091) [-2149.757] (-2157.619) (-2149.841) * (-2153.073) [-2160.149] (-2147.657) (-2152.308) -- 0:00:39
786500 -- [-2146.955] (-2156.196) (-2149.667) (-2157.440) * (-2153.313) (-2148.733) (-2155.309) [-2154.727] -- 0:00:39
787000 -- [-2150.928] (-2155.189) (-2153.475) (-2153.240) * [-2149.521] (-2155.714) (-2152.908) (-2173.810) -- 0:00:39
787500 -- (-2151.759) (-2155.235) [-2148.288] (-2153.337) * [-2153.308] (-2156.432) (-2156.360) (-2151.317) -- 0:00:39
788000 -- (-2150.306) [-2156.563] (-2153.914) (-2152.359) * (-2155.082) [-2153.585] (-2150.770) (-2149.406) -- 0:00:39
788500 -- (-2155.636) (-2151.066) [-2152.636] (-2150.629) * (-2146.958) (-2154.056) [-2149.541] (-2152.906) -- 0:00:38
789000 -- (-2153.970) (-2154.621) [-2151.449] (-2157.052) * [-2147.720] (-2161.419) (-2152.109) (-2155.122) -- 0:00:39
789500 -- (-2151.922) [-2152.864] (-2161.106) (-2157.557) * (-2153.074) (-2156.664) [-2152.482] (-2150.701) -- 0:00:38
790000 -- [-2150.882] (-2153.425) (-2153.342) (-2155.536) * (-2153.730) (-2152.150) (-2152.523) [-2154.919] -- 0:00:38
Average standard deviation of split frequencies: 0.000000
790500 -- (-2152.973) (-2150.575) [-2151.559] (-2148.924) * (-2155.459) [-2151.863] (-2155.193) (-2152.778) -- 0:00:38
791000 -- (-2153.891) (-2159.976) [-2151.302] (-2151.592) * [-2155.556] (-2153.171) (-2168.173) (-2152.857) -- 0:00:38
791500 -- [-2155.549] (-2150.547) (-2149.836) (-2151.174) * [-2158.415] (-2152.870) (-2162.081) (-2150.413) -- 0:00:38
792000 -- [-2150.363] (-2152.640) (-2152.555) (-2154.451) * (-2159.821) [-2148.874] (-2157.548) (-2155.482) -- 0:00:38
792500 -- (-2149.842) [-2154.355] (-2150.927) (-2153.939) * [-2156.526] (-2151.334) (-2152.716) (-2154.718) -- 0:00:38
793000 -- (-2156.182) [-2150.834] (-2155.946) (-2153.334) * (-2165.249) [-2150.686] (-2153.836) (-2160.300) -- 0:00:38
793500 -- [-2150.254] (-2152.019) (-2155.136) (-2154.164) * (-2157.202) (-2148.363) [-2152.251] (-2164.621) -- 0:00:37
794000 -- [-2150.218] (-2156.557) (-2151.933) (-2152.419) * (-2152.088) [-2151.671] (-2151.546) (-2162.891) -- 0:00:37
794500 -- (-2154.967) [-2150.521] (-2158.306) (-2153.275) * (-2151.907) (-2153.348) [-2161.829] (-2154.571) -- 0:00:38
795000 -- (-2153.996) [-2152.811] (-2157.089) (-2151.911) * (-2153.836) (-2150.833) [-2156.101] (-2164.506) -- 0:00:37
Average standard deviation of split frequencies: 0.000000
795500 -- (-2155.046) (-2156.628) (-2156.008) [-2150.418] * [-2150.002] (-2153.913) (-2151.131) (-2154.471) -- 0:00:37
796000 -- (-2155.326) [-2152.092] (-2160.865) (-2154.624) * (-2150.237) [-2152.247] (-2148.726) (-2157.469) -- 0:00:37
796500 -- (-2153.046) (-2150.526) (-2154.279) [-2148.626] * [-2149.563] (-2151.219) (-2154.577) (-2153.642) -- 0:00:37
797000 -- [-2156.890] (-2152.280) (-2157.610) (-2158.709) * (-2168.695) (-2155.229) [-2150.830] (-2150.611) -- 0:00:37
797500 -- (-2153.879) (-2152.761) [-2160.176] (-2158.890) * [-2152.161] (-2154.615) (-2151.322) (-2155.016) -- 0:00:37
798000 -- [-2150.341] (-2154.668) (-2156.607) (-2152.155) * (-2156.967) (-2160.020) [-2150.370] (-2156.963) -- 0:00:37
798500 -- (-2157.550) [-2152.535] (-2154.752) (-2153.343) * [-2149.457] (-2157.893) (-2150.605) (-2154.732) -- 0:00:37
799000 -- (-2151.600) [-2152.888] (-2150.526) (-2155.246) * (-2162.493) (-2162.506) (-2158.581) [-2148.784] -- 0:00:36
799500 -- [-2152.447] (-2154.558) (-2156.631) (-2151.891) * (-2154.468) (-2153.955) (-2153.502) [-2155.859] -- 0:00:36
800000 -- (-2150.688) [-2151.936] (-2153.884) (-2162.345) * (-2154.721) (-2156.313) [-2149.858] (-2153.596) -- 0:00:37
Average standard deviation of split frequencies: 0.000000
800500 -- (-2154.587) (-2149.827) [-2154.018] (-2158.444) * (-2151.191) (-2154.051) [-2153.900] (-2151.698) -- 0:00:36
801000 -- (-2154.830) (-2155.553) (-2152.536) [-2159.600] * (-2157.218) [-2151.664] (-2153.412) (-2150.253) -- 0:00:36
801500 -- (-2150.817) (-2148.779) (-2150.809) [-2154.661] * (-2152.028) (-2152.595) (-2154.646) [-2153.571] -- 0:00:36
802000 -- [-2152.400] (-2149.624) (-2160.399) (-2158.830) * (-2157.121) (-2149.574) (-2151.304) [-2160.875] -- 0:00:36
802500 -- (-2151.589) (-2151.428) [-2148.032] (-2149.677) * (-2147.935) [-2150.456] (-2161.719) (-2153.886) -- 0:00:36
803000 -- (-2149.712) (-2155.546) (-2158.264) [-2148.947] * [-2151.856] (-2154.567) (-2151.497) (-2154.093) -- 0:00:36
803500 -- [-2150.640] (-2162.518) (-2150.117) (-2148.805) * (-2155.362) (-2150.304) (-2151.769) [-2155.379] -- 0:00:36
804000 -- [-2154.927] (-2155.267) (-2153.699) (-2149.953) * (-2155.687) (-2156.747) (-2152.580) [-2154.369] -- 0:00:36
804500 -- (-2152.769) (-2159.506) (-2152.558) [-2154.222] * (-2160.032) (-2161.405) [-2149.944] (-2149.794) -- 0:00:35
805000 -- [-2155.059] (-2152.262) (-2149.826) (-2153.826) * (-2149.465) (-2153.237) (-2155.876) [-2148.381] -- 0:00:36
Average standard deviation of split frequencies: 0.000000
805500 -- [-2152.087] (-2152.087) (-2162.496) (-2150.337) * (-2158.081) (-2151.340) [-2157.227] (-2164.832) -- 0:00:35
806000 -- [-2146.716] (-2151.361) (-2157.311) (-2156.269) * [-2149.151] (-2159.556) (-2158.079) (-2149.536) -- 0:00:35
806500 -- (-2151.399) [-2153.868] (-2149.994) (-2155.082) * (-2154.470) (-2166.656) (-2147.877) [-2151.210] -- 0:00:35
807000 -- (-2152.175) [-2154.439] (-2150.653) (-2157.233) * [-2154.432] (-2162.600) (-2149.567) (-2149.518) -- 0:00:35
807500 -- (-2151.420) (-2155.205) (-2155.882) [-2152.805] * [-2155.551] (-2157.184) (-2151.606) (-2152.636) -- 0:00:35
808000 -- (-2152.587) (-2150.885) [-2152.967] (-2153.226) * [-2148.116] (-2155.557) (-2149.021) (-2155.205) -- 0:00:35
808500 -- [-2155.817] (-2152.677) (-2155.377) (-2148.766) * (-2153.712) (-2151.674) [-2149.050] (-2152.906) -- 0:00:35
809000 -- (-2157.676) (-2150.320) (-2151.306) [-2151.710] * (-2153.506) (-2155.341) (-2152.494) [-2155.639] -- 0:00:35
809500 -- (-2152.176) [-2149.809] (-2154.988) (-2149.965) * (-2151.124) [-2152.225] (-2160.229) (-2152.284) -- 0:00:35
810000 -- (-2156.890) [-2148.510] (-2161.145) (-2149.830) * (-2155.152) (-2157.109) [-2153.399] (-2150.635) -- 0:00:34
Average standard deviation of split frequencies: 0.000000
810500 -- (-2159.496) (-2153.601) (-2155.909) [-2153.745] * [-2149.561] (-2153.022) (-2153.868) (-2153.132) -- 0:00:35
811000 -- (-2150.560) [-2153.409] (-2151.864) (-2149.516) * (-2149.592) (-2153.721) (-2150.137) [-2157.702] -- 0:00:34
811500 -- (-2155.261) (-2148.459) [-2151.197] (-2154.003) * (-2153.515) [-2154.599] (-2151.341) (-2157.185) -- 0:00:34
812000 -- [-2157.820] (-2152.060) (-2153.530) (-2157.359) * (-2156.137) [-2154.863] (-2157.777) (-2153.862) -- 0:00:34
812500 -- (-2152.597) [-2147.997] (-2156.863) (-2150.436) * (-2151.121) [-2152.439] (-2158.358) (-2150.031) -- 0:00:34
813000 -- (-2154.108) (-2153.816) (-2158.109) [-2153.614] * [-2150.421] (-2152.966) (-2155.376) (-2153.459) -- 0:00:34
813500 -- [-2152.084] (-2155.408) (-2151.363) (-2160.287) * [-2151.893] (-2149.874) (-2156.818) (-2157.328) -- 0:00:34
814000 -- (-2151.681) (-2152.911) [-2155.096] (-2160.306) * [-2152.037] (-2149.421) (-2155.796) (-2157.086) -- 0:00:34
814500 -- (-2153.843) (-2151.818) [-2154.095] (-2150.947) * (-2149.060) [-2157.004] (-2151.374) (-2151.637) -- 0:00:34
815000 -- [-2162.387] (-2158.244) (-2158.885) (-2155.053) * (-2154.239) (-2159.081) (-2151.389) [-2153.435] -- 0:00:34
Average standard deviation of split frequencies: 0.000000
815500 -- (-2150.481) [-2150.803] (-2152.072) (-2152.080) * (-2155.443) (-2158.919) (-2157.327) [-2148.731] -- 0:00:33
816000 -- (-2168.760) [-2151.843] (-2159.353) (-2151.314) * (-2157.963) (-2153.936) [-2148.393] (-2148.504) -- 0:00:34
816500 -- (-2154.663) (-2154.602) [-2154.189] (-2149.833) * [-2154.594] (-2152.459) (-2153.438) (-2149.554) -- 0:00:33
817000 -- (-2152.316) [-2151.025] (-2148.444) (-2158.572) * (-2158.780) [-2151.055] (-2156.258) (-2154.335) -- 0:00:33
817500 -- [-2154.611] (-2153.185) (-2157.602) (-2152.777) * (-2152.696) [-2154.039] (-2153.908) (-2156.527) -- 0:00:33
818000 -- (-2157.388) (-2151.400) [-2149.980] (-2149.871) * (-2155.311) (-2155.113) [-2156.038] (-2154.302) -- 0:00:33
818500 -- [-2158.497] (-2150.269) (-2154.064) (-2149.047) * (-2153.783) (-2162.082) [-2153.521] (-2148.223) -- 0:00:33
819000 -- [-2152.707] (-2151.651) (-2152.356) (-2152.796) * (-2151.864) (-2152.861) (-2154.311) [-2147.059] -- 0:00:33
819500 -- (-2154.860) (-2151.141) [-2151.016] (-2149.817) * [-2151.629] (-2157.774) (-2150.370) (-2161.874) -- 0:00:33
820000 -- (-2151.360) (-2151.534) (-2156.098) [-2151.030] * (-2156.715) [-2154.617] (-2146.726) (-2148.521) -- 0:00:33
Average standard deviation of split frequencies: 0.000000
820500 -- (-2152.177) (-2152.274) (-2153.154) [-2149.569] * (-2153.131) (-2154.634) [-2151.371] (-2148.858) -- 0:00:33
821000 -- (-2155.070) (-2154.938) (-2154.534) [-2152.084] * [-2150.624] (-2154.177) (-2152.721) (-2167.218) -- 0:00:32
821500 -- (-2152.141) (-2157.598) (-2152.876) [-2152.207] * (-2155.510) [-2147.913] (-2151.688) (-2151.580) -- 0:00:33
822000 -- (-2154.254) [-2153.649] (-2151.758) (-2149.914) * (-2151.151) (-2155.317) [-2153.601] (-2150.010) -- 0:00:32
822500 -- [-2157.741] (-2156.680) (-2153.009) (-2153.843) * (-2155.400) (-2154.844) (-2156.063) [-2149.444] -- 0:00:32
823000 -- [-2155.893] (-2158.747) (-2151.739) (-2156.792) * (-2153.114) [-2151.657] (-2161.846) (-2151.520) -- 0:00:32
823500 -- (-2155.378) (-2156.841) (-2159.484) [-2147.632] * (-2154.539) (-2162.478) (-2151.585) [-2153.679] -- 0:00:32
824000 -- [-2160.583] (-2156.126) (-2152.542) (-2155.118) * (-2157.437) (-2151.857) [-2152.831] (-2150.013) -- 0:00:32
824500 -- [-2152.159] (-2161.868) (-2151.541) (-2158.197) * [-2156.189] (-2157.074) (-2150.886) (-2150.894) -- 0:00:32
825000 -- [-2148.568] (-2156.972) (-2161.001) (-2155.096) * [-2159.065] (-2150.790) (-2154.323) (-2157.085) -- 0:00:32
Average standard deviation of split frequencies: 0.000000
825500 -- (-2148.337) (-2154.019) (-2161.801) [-2153.501] * [-2153.347] (-2155.860) (-2151.844) (-2154.809) -- 0:00:32
826000 -- (-2152.401) (-2153.669) [-2148.472] (-2154.650) * (-2151.531) (-2149.952) [-2158.305] (-2150.490) -- 0:00:32
826500 -- [-2149.263] (-2148.454) (-2149.994) (-2152.678) * [-2147.854] (-2150.335) (-2149.268) (-2154.109) -- 0:00:31
827000 -- (-2156.978) (-2148.399) [-2149.203] (-2155.773) * (-2153.085) [-2155.521] (-2152.678) (-2168.409) -- 0:00:32
827500 -- (-2160.588) [-2149.507] (-2152.562) (-2155.536) * (-2156.897) [-2152.783] (-2157.843) (-2149.434) -- 0:00:31
828000 -- (-2161.144) (-2159.964) [-2151.932] (-2149.175) * (-2149.816) (-2156.004) [-2149.380] (-2150.395) -- 0:00:31
828500 -- (-2157.616) (-2153.507) (-2152.215) [-2152.665] * (-2150.278) (-2154.502) (-2154.257) [-2152.308] -- 0:00:31
829000 -- (-2155.077) (-2154.343) [-2151.529] (-2150.465) * (-2159.203) (-2153.793) (-2152.312) [-2150.270] -- 0:00:31
829500 -- [-2153.067] (-2161.246) (-2149.207) (-2152.105) * [-2156.118] (-2162.963) (-2153.784) (-2148.722) -- 0:00:31
830000 -- (-2150.353) (-2157.090) [-2151.543] (-2148.169) * (-2158.281) [-2164.067] (-2161.600) (-2148.766) -- 0:00:31
Average standard deviation of split frequencies: 0.000000
830500 -- (-2156.417) [-2157.444] (-2149.993) (-2153.416) * (-2154.090) (-2152.789) (-2155.634) [-2149.518] -- 0:00:31
831000 -- (-2151.546) [-2158.494] (-2150.609) (-2154.883) * (-2150.646) (-2158.555) (-2158.649) [-2151.745] -- 0:00:31
831500 -- (-2155.376) (-2150.690) (-2160.091) [-2154.823] * [-2147.916] (-2157.447) (-2158.584) (-2149.198) -- 0:00:31
832000 -- (-2153.512) [-2154.411] (-2150.495) (-2153.134) * [-2152.138] (-2157.375) (-2155.185) (-2156.139) -- 0:00:30
832500 -- (-2156.115) [-2151.464] (-2152.799) (-2153.386) * [-2148.161] (-2152.583) (-2148.888) (-2159.839) -- 0:00:30
833000 -- (-2153.607) (-2153.664) [-2155.431] (-2156.643) * (-2152.684) (-2149.824) (-2157.994) [-2150.879] -- 0:00:30
833500 -- [-2152.480] (-2154.934) (-2151.504) (-2157.571) * (-2161.776) [-2151.003] (-2151.176) (-2152.257) -- 0:00:30
834000 -- (-2150.207) (-2155.891) (-2151.318) [-2151.119] * (-2152.542) [-2149.116] (-2152.091) (-2150.251) -- 0:00:30
834500 -- (-2153.209) (-2163.973) (-2153.014) [-2149.979] * (-2155.271) (-2151.848) (-2150.441) [-2153.125] -- 0:00:30
835000 -- (-2149.174) (-2158.739) [-2149.637] (-2152.976) * (-2154.260) [-2151.960] (-2155.286) (-2153.240) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
835500 -- (-2151.645) (-2157.894) [-2150.521] (-2150.090) * [-2153.180] (-2151.991) (-2149.964) (-2153.218) -- 0:00:30
836000 -- (-2149.454) [-2151.157] (-2151.009) (-2157.780) * (-2148.032) (-2154.792) [-2157.770] (-2155.776) -- 0:00:30
836500 -- (-2156.396) [-2151.382] (-2153.507) (-2154.458) * (-2149.383) (-2149.854) [-2151.366] (-2159.396) -- 0:00:30
837000 -- (-2155.134) [-2152.635] (-2154.058) (-2150.194) * (-2153.255) (-2155.703) (-2154.396) [-2154.760] -- 0:00:29
837500 -- (-2151.534) [-2151.601] (-2156.243) (-2156.254) * (-2151.439) [-2152.555] (-2157.476) (-2156.842) -- 0:00:29
838000 -- (-2150.406) (-2149.575) (-2152.249) [-2148.786] * (-2154.591) (-2151.274) (-2152.378) [-2149.498] -- 0:00:29
838500 -- (-2150.362) (-2153.588) [-2158.444] (-2150.512) * (-2153.569) (-2152.469) (-2152.040) [-2150.961] -- 0:00:29
839000 -- (-2152.556) [-2150.945] (-2150.674) (-2151.177) * (-2158.151) (-2154.011) [-2150.147] (-2153.240) -- 0:00:29
839500 -- (-2149.500) (-2153.979) (-2150.843) [-2150.034] * (-2154.000) (-2153.570) (-2149.819) [-2149.928] -- 0:00:29
840000 -- (-2149.846) [-2154.923] (-2157.348) (-2152.477) * (-2156.913) [-2157.022] (-2156.576) (-2147.691) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
840500 -- (-2157.929) (-2157.198) (-2152.592) [-2152.220] * (-2155.553) (-2154.695) (-2158.597) [-2147.594] -- 0:00:29
841000 -- (-2152.550) [-2151.226] (-2157.700) (-2153.043) * (-2152.819) (-2155.802) (-2156.982) [-2147.535] -- 0:00:29
841500 -- (-2153.291) (-2150.312) [-2154.431] (-2157.629) * [-2156.333] (-2156.028) (-2152.657) (-2154.120) -- 0:00:29
842000 -- (-2148.775) (-2153.972) (-2148.386) [-2152.429] * (-2155.852) (-2152.045) (-2152.472) [-2155.348] -- 0:00:29
842500 -- [-2148.937] (-2151.480) (-2146.823) (-2148.017) * (-2150.497) (-2153.453) (-2152.934) [-2148.048] -- 0:00:28
843000 -- (-2151.870) (-2155.844) [-2155.675] (-2157.047) * (-2153.624) [-2155.348] (-2150.756) (-2151.301) -- 0:00:28
843500 -- [-2150.820] (-2158.128) (-2154.945) (-2148.821) * (-2151.531) (-2153.107) (-2149.174) [-2150.736] -- 0:00:28
844000 -- (-2155.573) (-2154.927) (-2159.693) [-2148.632] * (-2153.688) [-2155.488] (-2153.764) (-2152.794) -- 0:00:28
844500 -- (-2151.150) [-2148.766] (-2149.937) (-2152.187) * (-2159.343) (-2155.128) [-2147.421] (-2152.320) -- 0:00:28
845000 -- [-2160.400] (-2154.426) (-2160.759) (-2154.195) * (-2152.314) (-2152.567) (-2154.509) [-2154.229] -- 0:00:28
Average standard deviation of split frequencies: 0.000000
845500 -- (-2151.773) [-2149.685] (-2159.761) (-2152.657) * (-2154.722) (-2154.682) [-2154.235] (-2152.604) -- 0:00:28
846000 -- (-2155.575) [-2150.739] (-2157.513) (-2153.623) * [-2150.575] (-2160.286) (-2154.651) (-2149.720) -- 0:00:28
846500 -- [-2155.329] (-2159.099) (-2150.376) (-2150.786) * (-2148.772) (-2158.963) (-2155.674) [-2150.623] -- 0:00:28
847000 -- (-2148.150) (-2150.982) (-2154.331) [-2152.103] * (-2151.514) (-2156.009) (-2156.228) [-2150.165] -- 0:00:28
847500 -- (-2149.274) (-2154.749) [-2153.416] (-2149.218) * (-2157.808) (-2153.098) (-2163.096) [-2148.182] -- 0:00:28
848000 -- (-2160.039) (-2152.856) (-2151.415) [-2151.481] * [-2147.768] (-2159.879) (-2149.702) (-2157.081) -- 0:00:27
848500 -- (-2154.130) (-2165.209) (-2152.412) [-2153.677] * (-2148.996) [-2155.215] (-2153.566) (-2152.151) -- 0:00:28
849000 -- [-2153.489] (-2155.124) (-2149.815) (-2151.614) * (-2153.692) (-2150.017) (-2151.801) [-2150.352] -- 0:00:27
849500 -- [-2150.212] (-2152.305) (-2152.405) (-2154.456) * (-2156.596) (-2155.146) (-2151.881) [-2152.052] -- 0:00:27
850000 -- (-2153.755) [-2148.177] (-2149.070) (-2157.005) * (-2160.260) [-2159.173] (-2153.167) (-2150.077) -- 0:00:27
Average standard deviation of split frequencies: 0.000000
850500 -- (-2153.839) (-2148.918) (-2153.611) [-2154.480] * [-2152.643] (-2153.007) (-2150.955) (-2156.295) -- 0:00:27
851000 -- [-2147.260] (-2149.269) (-2154.954) (-2153.448) * (-2154.455) (-2150.811) [-2151.871] (-2154.979) -- 0:00:27
851500 -- (-2147.769) (-2156.085) (-2152.457) [-2155.079] * (-2151.929) (-2151.035) [-2151.207] (-2154.189) -- 0:00:27
852000 -- (-2151.668) (-2155.225) (-2154.879) [-2155.567] * (-2157.965) (-2155.395) [-2149.254] (-2149.528) -- 0:00:27
852500 -- (-2155.421) [-2156.370] (-2156.026) (-2157.989) * (-2153.788) (-2149.845) (-2163.502) [-2149.006] -- 0:00:27
853000 -- [-2155.828] (-2158.090) (-2158.407) (-2158.432) * (-2148.542) [-2150.699] (-2151.078) (-2152.591) -- 0:00:27
853500 -- (-2151.197) (-2155.567) (-2154.570) [-2158.760] * (-2153.864) [-2148.917] (-2150.466) (-2158.084) -- 0:00:26
854000 -- (-2149.208) (-2156.133) [-2155.518] (-2153.811) * (-2151.404) (-2160.995) [-2150.172] (-2152.626) -- 0:00:27
854500 -- (-2150.579) (-2153.951) [-2154.365] (-2159.335) * (-2153.503) (-2151.122) (-2156.253) [-2152.333] -- 0:00:26
855000 -- (-2151.908) [-2149.241] (-2153.720) (-2159.251) * (-2156.240) (-2157.464) (-2152.069) [-2153.989] -- 0:00:26
Average standard deviation of split frequencies: 0.000000
855500 -- (-2155.950) [-2146.947] (-2152.123) (-2159.996) * [-2150.829] (-2154.089) (-2158.708) (-2150.448) -- 0:00:26
856000 -- (-2157.377) (-2159.045) [-2147.714] (-2152.559) * (-2158.479) (-2160.010) [-2160.623] (-2150.063) -- 0:00:26
856500 -- (-2161.877) (-2151.815) (-2150.729) [-2149.169] * (-2152.399) (-2157.604) (-2151.832) [-2154.816] -- 0:00:26
857000 -- [-2153.662] (-2150.267) (-2150.682) (-2153.175) * (-2152.569) (-2156.381) [-2150.789] (-2154.625) -- 0:00:26
857500 -- (-2150.379) (-2159.311) [-2150.080] (-2149.302) * [-2150.123] (-2161.852) (-2149.351) (-2151.826) -- 0:00:26
858000 -- (-2148.363) (-2156.005) (-2157.336) [-2156.306] * [-2149.519] (-2153.822) (-2153.160) (-2154.127) -- 0:00:26
858500 -- (-2151.466) (-2154.450) (-2154.274) [-2150.454] * (-2153.869) (-2151.498) [-2153.394] (-2153.042) -- 0:00:26
859000 -- [-2150.864] (-2161.002) (-2154.339) (-2153.903) * [-2148.303] (-2152.765) (-2154.743) (-2155.973) -- 0:00:25
859500 -- (-2153.697) (-2154.141) (-2154.131) [-2148.384] * (-2154.200) (-2148.732) (-2149.460) [-2149.521] -- 0:00:25
860000 -- [-2154.787] (-2158.557) (-2151.115) (-2156.763) * (-2151.045) (-2153.681) (-2150.922) [-2156.240] -- 0:00:25
Average standard deviation of split frequencies: 0.000000
860500 -- (-2153.163) [-2154.724] (-2157.444) (-2153.513) * [-2150.068] (-2149.945) (-2158.254) (-2159.112) -- 0:00:25
861000 -- (-2154.635) [-2149.300] (-2149.965) (-2152.082) * (-2152.719) (-2148.328) (-2154.504) [-2152.200] -- 0:00:25
861500 -- (-2157.252) (-2149.611) (-2155.539) [-2154.334] * (-2155.305) [-2155.663] (-2154.992) (-2150.797) -- 0:00:25
862000 -- (-2152.297) (-2152.897) [-2154.409] (-2152.641) * (-2153.312) (-2151.778) (-2148.521) [-2153.612] -- 0:00:25
862500 -- (-2150.850) [-2152.706] (-2156.066) (-2156.600) * (-2154.108) (-2155.851) [-2152.622] (-2148.425) -- 0:00:25
863000 -- (-2153.468) (-2150.112) (-2156.109) [-2152.258] * (-2157.028) (-2150.490) (-2153.802) [-2149.511] -- 0:00:25
863500 -- (-2158.898) [-2155.171] (-2154.301) (-2153.951) * (-2152.597) (-2154.003) (-2153.436) [-2146.557] -- 0:00:25
864000 -- (-2156.554) [-2151.261] (-2160.073) (-2156.598) * (-2157.204) (-2152.170) [-2152.044] (-2153.015) -- 0:00:25
864500 -- (-2152.149) (-2155.910) (-2157.221) [-2152.300] * [-2155.955] (-2155.249) (-2150.612) (-2158.627) -- 0:00:24
865000 -- (-2158.268) (-2157.598) [-2153.980] (-2150.254) * [-2152.388] (-2160.550) (-2154.000) (-2152.081) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
865500 -- (-2155.100) [-2151.360] (-2157.897) (-2154.847) * (-2157.890) (-2154.868) [-2151.522] (-2151.477) -- 0:00:24
866000 -- (-2154.352) (-2152.776) [-2151.952] (-2155.634) * (-2162.623) [-2153.987] (-2155.944) (-2151.503) -- 0:00:24
866500 -- [-2153.235] (-2153.360) (-2151.965) (-2157.224) * (-2157.402) (-2152.772) (-2160.269) [-2157.642] -- 0:00:24
867000 -- (-2150.248) (-2149.322) (-2154.464) [-2152.785] * [-2155.132] (-2153.768) (-2150.255) (-2147.082) -- 0:00:24
867500 -- (-2151.902) (-2155.647) (-2152.893) [-2153.356] * [-2150.169] (-2157.715) (-2151.131) (-2152.094) -- 0:00:24
868000 -- (-2155.174) (-2155.642) (-2150.262) [-2149.691] * (-2149.998) (-2152.247) [-2153.633] (-2151.401) -- 0:00:24
868500 -- (-2151.537) (-2154.918) (-2159.902) [-2154.217] * (-2155.354) [-2155.152] (-2153.295) (-2146.476) -- 0:00:24
869000 -- (-2152.192) [-2153.672] (-2154.086) (-2154.380) * (-2149.463) (-2152.254) (-2151.255) [-2154.244] -- 0:00:24
869500 -- (-2156.956) (-2152.173) (-2165.538) [-2148.822] * [-2150.822] (-2155.889) (-2150.877) (-2151.674) -- 0:00:24
870000 -- (-2152.552) (-2160.186) [-2152.384] (-2153.894) * [-2151.274] (-2152.724) (-2149.161) (-2153.007) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
870500 -- (-2151.760) (-2151.822) [-2150.686] (-2147.823) * (-2151.783) [-2160.275] (-2159.102) (-2149.374) -- 0:00:23
871000 -- (-2151.318) [-2152.790] (-2152.917) (-2155.297) * [-2150.213] (-2158.402) (-2156.891) (-2149.549) -- 0:00:23
871500 -- [-2157.582] (-2152.216) (-2151.035) (-2152.293) * (-2153.368) [-2154.189] (-2150.109) (-2150.375) -- 0:00:23
872000 -- (-2158.416) (-2150.856) (-2154.493) [-2154.445] * (-2150.559) [-2151.054] (-2155.594) (-2152.252) -- 0:00:23
872500 -- (-2157.098) [-2151.850] (-2153.303) (-2153.831) * (-2152.008) [-2157.728] (-2151.088) (-2150.568) -- 0:00:23
873000 -- [-2153.461] (-2151.948) (-2152.978) (-2150.942) * (-2152.207) [-2151.750] (-2154.435) (-2152.432) -- 0:00:23
873500 -- (-2152.331) [-2151.472] (-2154.458) (-2150.166) * (-2158.315) [-2147.741] (-2149.898) (-2153.417) -- 0:00:23
874000 -- (-2154.980) (-2157.983) (-2151.673) [-2150.371] * (-2158.360) (-2148.540) [-2152.136] (-2158.790) -- 0:00:23
874500 -- (-2149.959) (-2151.016) [-2150.241] (-2153.533) * (-2155.112) (-2158.116) (-2157.578) [-2153.850] -- 0:00:23
875000 -- (-2157.406) (-2157.570) (-2149.048) [-2152.138] * (-2153.045) [-2155.718] (-2157.844) (-2148.122) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
875500 -- (-2153.821) (-2155.348) [-2154.438] (-2149.901) * (-2154.036) [-2155.905] (-2151.901) (-2149.693) -- 0:00:22
876000 -- (-2156.839) (-2155.795) [-2150.946] (-2153.644) * (-2153.263) (-2148.883) (-2153.887) [-2150.505] -- 0:00:22
876500 -- (-2156.276) [-2152.500] (-2150.736) (-2152.918) * (-2162.606) (-2161.911) (-2158.056) [-2150.620] -- 0:00:22
877000 -- (-2152.382) (-2153.179) (-2149.138) [-2151.434] * (-2155.849) (-2156.056) (-2155.049) [-2148.854] -- 0:00:22
877500 -- (-2151.077) (-2154.168) [-2148.543] (-2153.358) * (-2151.700) (-2149.143) (-2157.255) [-2148.198] -- 0:00:22
878000 -- [-2150.723] (-2152.974) (-2151.379) (-2155.417) * (-2155.830) [-2152.593] (-2152.184) (-2145.749) -- 0:00:22
878500 -- (-2150.313) (-2165.637) (-2151.292) [-2148.279] * (-2152.390) (-2159.171) [-2147.582] (-2148.149) -- 0:00:22
879000 -- (-2170.137) [-2151.066] (-2151.644) (-2150.430) * (-2154.241) (-2154.224) (-2153.600) [-2148.066] -- 0:00:22
879500 -- (-2156.621) (-2150.096) [-2153.363] (-2150.847) * [-2152.534] (-2148.691) (-2159.108) (-2154.396) -- 0:00:22
880000 -- (-2148.853) (-2155.042) [-2154.462] (-2150.318) * (-2160.500) (-2156.691) (-2152.896) [-2149.159] -- 0:00:22
Average standard deviation of split frequencies: 0.000000
880500 -- (-2155.616) (-2150.488) [-2157.140] (-2154.227) * (-2149.858) (-2150.728) (-2153.376) [-2151.373] -- 0:00:21
881000 -- (-2149.319) (-2152.387) (-2152.711) [-2154.982] * (-2155.702) [-2153.363] (-2152.287) (-2153.854) -- 0:00:21
881500 -- [-2150.919] (-2154.317) (-2154.641) (-2155.248) * (-2152.290) (-2157.076) [-2151.635] (-2152.643) -- 0:00:21
882000 -- (-2148.869) (-2159.366) (-2155.815) [-2151.076] * (-2152.171) (-2149.511) (-2164.843) [-2152.282] -- 0:00:21
882500 -- [-2153.270] (-2157.947) (-2155.172) (-2151.573) * (-2152.446) (-2150.155) [-2151.860] (-2155.696) -- 0:00:21
883000 -- [-2151.990] (-2158.397) (-2153.524) (-2151.220) * (-2149.445) (-2152.964) [-2154.952] (-2153.445) -- 0:00:21
883500 -- (-2158.377) [-2152.992] (-2160.137) (-2149.013) * [-2152.584] (-2160.903) (-2159.829) (-2151.433) -- 0:00:21
884000 -- (-2156.033) (-2152.872) [-2156.633] (-2154.927) * (-2151.764) (-2156.314) [-2154.027] (-2153.178) -- 0:00:21
884500 -- [-2150.634] (-2151.965) (-2156.584) (-2151.740) * (-2152.301) [-2149.148] (-2159.842) (-2156.663) -- 0:00:21
885000 -- (-2156.364) (-2153.781) (-2155.297) [-2152.163] * (-2155.611) (-2147.739) (-2157.854) [-2154.945] -- 0:00:21
Average standard deviation of split frequencies: 0.000000
885500 -- (-2159.490) (-2153.994) [-2151.969] (-2150.936) * (-2153.358) [-2153.091] (-2160.138) (-2152.937) -- 0:00:21
886000 -- (-2150.924) (-2148.383) [-2149.479] (-2153.975) * [-2154.207] (-2150.523) (-2156.228) (-2153.590) -- 0:00:20
886500 -- (-2159.947) (-2158.776) [-2149.729] (-2150.073) * (-2151.260) (-2153.905) (-2153.233) [-2151.780] -- 0:00:20
887000 -- (-2156.870) (-2165.033) [-2147.860] (-2157.617) * (-2153.222) (-2156.056) [-2149.541] (-2152.644) -- 0:00:20
887500 -- (-2157.914) (-2155.931) (-2151.115) [-2154.811] * (-2154.970) (-2158.338) (-2155.595) [-2150.276] -- 0:00:20
888000 -- (-2153.459) [-2154.517] (-2152.163) (-2156.087) * [-2150.933] (-2159.339) (-2157.262) (-2147.271) -- 0:00:20
888500 -- (-2159.657) [-2156.909] (-2150.085) (-2155.032) * (-2156.183) (-2150.648) [-2155.294] (-2152.422) -- 0:00:20
889000 -- (-2152.905) [-2153.436] (-2149.947) (-2149.885) * [-2152.350] (-2149.382) (-2152.504) (-2154.772) -- 0:00:20
889500 -- [-2151.827] (-2155.173) (-2157.976) (-2151.068) * [-2151.475] (-2152.294) (-2152.826) (-2155.935) -- 0:00:20
890000 -- (-2153.203) (-2153.509) (-2147.672) [-2153.119] * (-2152.558) [-2148.742] (-2150.970) (-2164.443) -- 0:00:20
Average standard deviation of split frequencies: 0.000000
890500 -- (-2157.322) (-2152.126) [-2150.754] (-2156.970) * (-2157.428) [-2153.444] (-2152.164) (-2156.609) -- 0:00:20
891000 -- (-2163.040) (-2153.651) (-2155.792) [-2158.271] * (-2153.760) (-2151.993) (-2158.885) [-2156.121] -- 0:00:20
891500 -- (-2153.493) (-2150.888) [-2147.208] (-2152.574) * (-2152.845) (-2149.006) [-2152.512] (-2150.176) -- 0:00:19
892000 -- [-2150.007] (-2148.092) (-2148.372) (-2151.145) * (-2166.023) (-2151.383) (-2158.117) [-2149.655] -- 0:00:19
892500 -- [-2156.037] (-2149.972) (-2164.990) (-2149.619) * (-2148.461) (-2150.510) [-2153.712] (-2157.830) -- 0:00:19
893000 -- (-2150.858) (-2151.902) [-2154.084] (-2151.888) * (-2152.664) (-2161.552) [-2151.392] (-2152.812) -- 0:00:19
893500 -- [-2151.694] (-2146.711) (-2159.420) (-2152.084) * (-2152.713) (-2155.409) [-2151.604] (-2155.636) -- 0:00:19
894000 -- [-2150.439] (-2151.720) (-2157.939) (-2151.953) * (-2149.142) [-2153.367] (-2157.878) (-2151.986) -- 0:00:19
894500 -- (-2155.650) [-2149.213] (-2158.700) (-2155.713) * (-2154.375) (-2152.258) (-2154.177) [-2150.019] -- 0:00:19
895000 -- (-2148.127) [-2149.519] (-2154.162) (-2152.624) * (-2153.084) [-2151.133] (-2151.017) (-2150.420) -- 0:00:19
Average standard deviation of split frequencies: 0.000000
895500 -- [-2151.917] (-2156.317) (-2157.237) (-2149.690) * (-2149.119) (-2148.262) [-2151.644] (-2154.490) -- 0:00:19
896000 -- (-2151.735) (-2153.342) (-2154.111) [-2151.870] * (-2154.611) [-2152.626] (-2152.860) (-2155.576) -- 0:00:19
896500 -- (-2153.638) (-2154.364) (-2150.223) [-2150.091] * (-2150.666) (-2156.129) (-2156.773) [-2148.091] -- 0:00:19
897000 -- (-2157.998) (-2150.831) (-2147.847) [-2149.974] * (-2157.456) (-2148.370) [-2151.504] (-2152.003) -- 0:00:18
897500 -- (-2155.606) (-2154.180) [-2151.024] (-2149.189) * [-2156.205] (-2152.708) (-2156.695) (-2156.155) -- 0:00:18
898000 -- (-2155.307) (-2152.526) [-2156.130] (-2151.877) * (-2160.588) [-2153.887] (-2147.637) (-2153.132) -- 0:00:18
898500 -- [-2152.702] (-2149.395) (-2152.490) (-2163.096) * (-2153.794) (-2158.184) (-2149.196) [-2150.512] -- 0:00:18
899000 -- (-2153.266) (-2158.601) [-2152.657] (-2162.994) * (-2156.542) (-2152.238) [-2148.049] (-2151.298) -- 0:00:18
899500 -- (-2153.316) [-2155.866] (-2152.534) (-2152.430) * (-2149.968) (-2147.750) [-2152.565] (-2149.221) -- 0:00:18
900000 -- (-2150.522) [-2152.678] (-2151.070) (-2156.265) * (-2155.972) [-2155.151] (-2149.133) (-2151.065) -- 0:00:18
Average standard deviation of split frequencies: 0.000000
900500 -- [-2146.363] (-2151.026) (-2154.410) (-2152.285) * (-2153.564) (-2157.044) (-2151.335) [-2147.053] -- 0:00:18
901000 -- (-2154.432) (-2150.471) (-2151.948) [-2151.425] * (-2152.238) (-2150.953) (-2147.583) [-2147.734] -- 0:00:18
901500 -- (-2155.782) [-2148.714] (-2158.752) (-2155.328) * [-2159.968] (-2152.135) (-2157.226) (-2152.379) -- 0:00:18
902000 -- (-2161.691) (-2154.845) [-2151.012] (-2151.648) * (-2157.752) (-2156.571) [-2150.543] (-2155.991) -- 0:00:18
902500 -- [-2157.622] (-2150.024) (-2157.749) (-2155.031) * (-2150.999) (-2154.376) [-2153.542] (-2147.814) -- 0:00:17
903000 -- (-2150.758) (-2155.420) (-2154.706) [-2159.116] * (-2153.966) (-2157.348) (-2149.129) [-2152.563] -- 0:00:17
903500 -- (-2154.442) (-2156.380) (-2162.241) [-2147.685] * (-2153.813) (-2158.739) (-2159.224) [-2152.579] -- 0:00:17
904000 -- (-2159.913) (-2153.802) (-2154.476) [-2155.828] * (-2151.990) (-2160.434) [-2157.234] (-2151.545) -- 0:00:17
904500 -- (-2152.724) (-2156.474) (-2152.145) [-2157.945] * (-2154.285) (-2167.353) [-2157.447] (-2150.481) -- 0:00:17
905000 -- (-2148.950) [-2155.716] (-2155.223) (-2153.314) * (-2153.999) [-2164.794] (-2151.119) (-2153.470) -- 0:00:17
Average standard deviation of split frequencies: 0.000000
905500 -- (-2151.789) [-2153.442] (-2162.987) (-2151.422) * (-2162.193) (-2153.866) [-2154.258] (-2151.730) -- 0:00:17
906000 -- (-2154.355) [-2154.107] (-2153.419) (-2154.761) * (-2154.880) [-2149.465] (-2152.619) (-2154.593) -- 0:00:17
906500 -- (-2153.814) (-2151.679) [-2153.737] (-2154.192) * (-2149.575) (-2149.569) [-2150.209] (-2151.849) -- 0:00:17
907000 -- (-2151.173) (-2153.892) [-2151.296] (-2152.142) * (-2151.548) [-2149.252] (-2151.928) (-2157.265) -- 0:00:17
907500 -- [-2155.272] (-2156.393) (-2151.378) (-2148.310) * [-2150.864] (-2150.295) (-2152.232) (-2153.273) -- 0:00:17
908000 -- (-2151.480) (-2155.068) (-2153.410) [-2148.393] * [-2151.078] (-2151.625) (-2155.713) (-2152.581) -- 0:00:16
908500 -- (-2152.236) [-2150.711] (-2153.594) (-2155.305) * [-2153.842] (-2152.815) (-2160.874) (-2149.820) -- 0:00:16
909000 -- [-2154.528] (-2153.690) (-2154.038) (-2153.984) * [-2153.430] (-2160.961) (-2153.195) (-2154.880) -- 0:00:16
909500 -- [-2155.171] (-2152.697) (-2154.349) (-2155.638) * [-2146.176] (-2156.375) (-2151.322) (-2153.974) -- 0:00:16
910000 -- (-2156.248) (-2152.366) (-2161.207) [-2153.125] * [-2149.690] (-2154.770) (-2154.730) (-2151.016) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
910500 -- (-2151.109) [-2155.813] (-2149.256) (-2148.733) * [-2154.068] (-2151.415) (-2162.980) (-2153.422) -- 0:00:16
911000 -- (-2155.693) [-2151.120] (-2148.779) (-2152.460) * [-2151.812] (-2147.838) (-2157.096) (-2154.117) -- 0:00:16
911500 -- (-2147.382) (-2149.303) [-2155.418] (-2152.795) * (-2155.586) (-2149.729) [-2153.268] (-2151.379) -- 0:00:16
912000 -- (-2151.416) (-2158.008) (-2151.300) [-2153.094] * (-2157.425) [-2150.203] (-2156.461) (-2157.935) -- 0:00:16
912500 -- [-2148.897] (-2153.231) (-2154.879) (-2154.691) * (-2153.695) [-2150.616] (-2156.292) (-2155.340) -- 0:00:16
913000 -- (-2151.130) [-2149.356] (-2154.881) (-2152.439) * (-2157.549) (-2155.658) (-2151.807) [-2150.497] -- 0:00:16
913500 -- (-2147.545) (-2154.078) (-2151.015) [-2151.149] * [-2152.694] (-2153.747) (-2150.761) (-2149.915) -- 0:00:15
914000 -- [-2156.351] (-2155.150) (-2147.231) (-2155.509) * (-2156.381) (-2160.012) [-2149.201] (-2150.858) -- 0:00:15
914500 -- (-2154.221) (-2155.046) [-2148.224] (-2155.015) * (-2149.932) (-2152.520) [-2154.183] (-2154.641) -- 0:00:15
915000 -- (-2148.152) [-2145.830] (-2151.031) (-2152.292) * [-2149.575] (-2155.331) (-2150.942) (-2152.357) -- 0:00:15
Average standard deviation of split frequencies: 0.000000
915500 -- (-2147.636) [-2148.722] (-2153.963) (-2160.044) * (-2156.718) (-2152.408) (-2153.790) [-2151.340] -- 0:00:15
916000 -- (-2147.348) (-2146.932) [-2150.747] (-2151.108) * (-2147.944) [-2150.200] (-2158.000) (-2156.972) -- 0:00:15
916500 -- [-2147.665] (-2153.697) (-2152.018) (-2150.234) * (-2149.988) (-2154.114) [-2160.320] (-2155.620) -- 0:00:15
917000 -- (-2150.848) (-2149.315) (-2148.932) [-2154.953] * (-2156.863) [-2150.575] (-2153.587) (-2158.121) -- 0:00:15
917500 -- [-2153.895] (-2147.891) (-2156.669) (-2157.344) * (-2153.933) [-2153.418] (-2152.243) (-2149.570) -- 0:00:15
918000 -- (-2153.489) (-2149.709) [-2150.427] (-2155.503) * [-2157.002] (-2151.943) (-2150.365) (-2147.398) -- 0:00:15
918500 -- [-2150.369] (-2160.381) (-2152.287) (-2150.239) * (-2155.936) (-2153.767) (-2156.579) [-2146.935] -- 0:00:14
919000 -- (-2150.690) [-2148.823] (-2153.809) (-2150.066) * [-2153.453] (-2158.120) (-2152.726) (-2151.850) -- 0:00:14
919500 -- (-2158.114) (-2150.627) (-2153.177) [-2149.410] * (-2159.343) (-2150.609) (-2156.407) [-2147.716] -- 0:00:14
920000 -- [-2152.410] (-2152.855) (-2149.783) (-2151.730) * (-2160.715) (-2154.863) (-2153.020) [-2153.053] -- 0:00:14
Average standard deviation of split frequencies: 0.000000
920500 -- (-2153.095) (-2155.050) [-2156.613] (-2152.679) * [-2158.521] (-2154.182) (-2153.955) (-2147.321) -- 0:00:14
921000 -- (-2156.797) (-2158.613) [-2153.436] (-2149.509) * (-2155.493) (-2148.240) [-2152.071] (-2148.357) -- 0:00:14
921500 -- [-2150.800] (-2152.509) (-2161.014) (-2152.411) * (-2156.452) (-2160.357) (-2153.560) [-2153.459] -- 0:00:14
922000 -- (-2150.148) (-2151.763) [-2151.273] (-2151.940) * [-2151.817] (-2156.664) (-2150.707) (-2150.997) -- 0:00:14
922500 -- (-2166.650) (-2153.245) [-2152.914] (-2154.076) * (-2156.429) (-2154.909) [-2150.755] (-2157.983) -- 0:00:14
923000 -- (-2153.041) (-2159.678) [-2149.816] (-2153.110) * [-2154.556] (-2157.494) (-2151.253) (-2154.597) -- 0:00:14
923500 -- (-2150.716) [-2153.966] (-2163.414) (-2153.503) * (-2152.829) (-2162.476) (-2149.398) [-2151.563] -- 0:00:14
924000 -- (-2155.312) (-2157.647) (-2152.552) [-2156.997] * (-2154.964) (-2158.725) (-2156.428) [-2147.676] -- 0:00:13
924500 -- (-2152.957) (-2158.297) [-2151.126] (-2156.377) * (-2150.602) (-2161.724) (-2152.087) [-2150.626] -- 0:00:13
925000 -- (-2149.460) (-2155.426) [-2150.749] (-2150.870) * (-2150.617) [-2154.745] (-2156.524) (-2153.553) -- 0:00:13
Average standard deviation of split frequencies: 0.000255
925500 -- [-2149.966] (-2161.651) (-2150.195) (-2158.904) * (-2150.442) (-2160.731) (-2156.617) [-2156.601] -- 0:00:13
926000 -- (-2155.817) (-2154.682) (-2149.140) [-2151.518] * (-2152.132) [-2153.032] (-2160.979) (-2154.442) -- 0:00:13
926500 -- (-2154.931) (-2157.222) [-2151.402] (-2153.860) * (-2152.072) [-2155.211] (-2152.342) (-2150.642) -- 0:00:13
927000 -- [-2153.923] (-2158.976) (-2153.895) (-2161.684) * (-2151.384) (-2151.816) [-2148.327] (-2151.680) -- 0:00:13
927500 -- (-2152.094) [-2154.431] (-2150.121) (-2162.850) * (-2155.285) (-2157.156) [-2149.178] (-2152.370) -- 0:00:13
928000 -- [-2152.559] (-2156.082) (-2155.389) (-2158.623) * (-2154.418) (-2157.846) [-2152.769] (-2150.313) -- 0:00:13
928500 -- (-2155.776) [-2149.186] (-2158.525) (-2159.156) * (-2154.756) (-2158.883) (-2153.821) [-2148.575] -- 0:00:13
929000 -- [-2151.175] (-2152.546) (-2157.044) (-2163.005) * (-2153.225) [-2149.936] (-2159.061) (-2153.465) -- 0:00:13
929500 -- (-2153.015) (-2150.596) [-2153.619] (-2160.599) * (-2153.930) (-2161.342) [-2150.982] (-2159.056) -- 0:00:12
930000 -- (-2153.334) (-2162.445) [-2154.322] (-2152.207) * [-2158.569] (-2156.806) (-2159.696) (-2154.466) -- 0:00:12
Average standard deviation of split frequencies: 0.000253
930500 -- (-2151.400) [-2152.340] (-2164.521) (-2152.411) * [-2149.185] (-2152.870) (-2154.632) (-2151.506) -- 0:00:12
931000 -- (-2161.983) (-2157.082) (-2155.809) [-2151.996] * (-2164.543) [-2151.335] (-2153.870) (-2153.882) -- 0:00:12
931500 -- (-2158.058) [-2153.046] (-2153.502) (-2159.092) * (-2157.458) (-2152.162) [-2154.370] (-2152.271) -- 0:00:12
932000 -- (-2154.449) (-2155.641) [-2150.596] (-2156.277) * (-2156.472) (-2159.670) [-2151.368] (-2151.351) -- 0:00:12
932500 -- (-2149.592) (-2151.294) [-2147.503] (-2157.344) * (-2153.033) [-2154.122] (-2156.296) (-2157.112) -- 0:00:12
933000 -- (-2154.867) [-2153.394] (-2155.258) (-2151.849) * [-2155.481] (-2158.413) (-2157.066) (-2153.684) -- 0:00:12
933500 -- (-2156.052) [-2150.079] (-2154.155) (-2157.295) * (-2152.423) [-2151.608] (-2161.658) (-2161.758) -- 0:00:12
934000 -- (-2151.446) [-2154.171] (-2150.902) (-2153.204) * [-2154.806] (-2154.975) (-2153.075) (-2158.577) -- 0:00:12
934500 -- (-2159.091) [-2149.511] (-2151.611) (-2152.199) * (-2151.230) (-2155.509) [-2154.883] (-2155.375) -- 0:00:12
935000 -- (-2153.506) (-2155.918) (-2151.577) [-2157.025] * (-2158.106) (-2149.602) [-2149.548] (-2150.209) -- 0:00:11
Average standard deviation of split frequencies: 0.000252
935500 -- [-2150.918] (-2151.659) (-2149.744) (-2160.818) * (-2152.223) (-2152.580) (-2150.915) [-2154.741] -- 0:00:11
936000 -- (-2155.636) [-2150.620] (-2151.041) (-2152.548) * [-2159.707] (-2149.920) (-2154.209) (-2149.787) -- 0:00:11
936500 -- (-2150.315) (-2150.945) [-2147.027] (-2149.574) * (-2158.656) (-2152.002) (-2155.817) [-2151.105] -- 0:00:11
937000 -- [-2148.340] (-2149.335) (-2148.904) (-2156.778) * (-2151.794) (-2151.618) (-2148.871) [-2151.047] -- 0:00:11
937500 -- [-2155.067] (-2157.948) (-2145.559) (-2152.098) * (-2152.217) [-2152.397] (-2154.820) (-2157.632) -- 0:00:11
938000 -- (-2152.840) [-2152.147] (-2154.740) (-2151.530) * (-2152.824) [-2151.173] (-2152.679) (-2152.579) -- 0:00:11
938500 -- (-2151.494) [-2150.464] (-2152.463) (-2150.059) * (-2152.813) [-2150.309] (-2152.701) (-2150.694) -- 0:00:11
939000 -- (-2155.866) [-2151.649] (-2159.307) (-2151.588) * [-2154.259] (-2153.425) (-2152.782) (-2152.253) -- 0:00:11
939500 -- (-2153.371) [-2156.309] (-2157.251) (-2147.774) * (-2154.205) (-2156.009) [-2155.064] (-2158.258) -- 0:00:11
940000 -- (-2153.999) (-2153.272) [-2150.110] (-2152.533) * (-2153.375) (-2152.135) [-2153.064] (-2151.525) -- 0:00:11
Average standard deviation of split frequencies: 0.000251
940500 -- (-2149.109) (-2148.941) (-2154.153) [-2155.400] * (-2149.466) [-2154.750] (-2149.815) (-2152.233) -- 0:00:10
941000 -- [-2156.364] (-2151.717) (-2155.125) (-2156.752) * [-2155.462] (-2155.037) (-2166.633) (-2158.921) -- 0:00:10
941500 -- (-2154.215) [-2153.391] (-2152.783) (-2149.359) * [-2151.695] (-2161.386) (-2155.437) (-2158.977) -- 0:00:10
942000 -- (-2151.726) [-2152.760] (-2157.576) (-2148.714) * (-2154.176) [-2150.082] (-2152.321) (-2161.365) -- 0:00:10
942500 -- [-2155.883] (-2151.363) (-2152.047) (-2151.140) * [-2154.631] (-2148.686) (-2150.194) (-2151.398) -- 0:00:10
943000 -- (-2154.052) [-2152.563] (-2147.738) (-2150.069) * (-2150.450) [-2153.092] (-2154.988) (-2147.116) -- 0:00:10
943500 -- (-2149.384) [-2158.951] (-2149.402) (-2154.465) * (-2153.157) (-2155.097) (-2159.310) [-2154.907] -- 0:00:10
944000 -- (-2162.266) [-2151.580] (-2157.073) (-2156.549) * (-2151.547) (-2156.822) (-2151.514) [-2154.717] -- 0:00:10
944500 -- (-2154.652) (-2151.199) (-2155.706) [-2155.783] * (-2155.962) [-2155.788] (-2154.110) (-2151.727) -- 0:00:10
945000 -- (-2151.652) (-2151.105) [-2152.255] (-2153.758) * [-2153.666] (-2150.927) (-2160.068) (-2157.041) -- 0:00:10
Average standard deviation of split frequencies: 0.000249
945500 -- [-2147.859] (-2156.631) (-2149.326) (-2156.866) * [-2155.596] (-2152.762) (-2149.784) (-2152.101) -- 0:00:10
946000 -- (-2156.209) (-2158.535) (-2148.423) [-2152.651] * (-2152.389) [-2156.793] (-2156.484) (-2155.100) -- 0:00:09
946500 -- (-2154.998) [-2148.600] (-2148.040) (-2150.968) * (-2151.034) [-2150.978] (-2153.440) (-2160.421) -- 0:00:09
947000 -- (-2157.105) [-2153.924] (-2151.856) (-2149.949) * (-2151.358) [-2154.569] (-2150.159) (-2151.980) -- 0:00:09
947500 -- [-2149.277] (-2149.204) (-2152.960) (-2149.042) * (-2161.817) (-2150.943) (-2158.852) [-2148.530] -- 0:00:09
948000 -- (-2149.395) [-2150.682] (-2150.095) (-2157.301) * (-2156.845) [-2147.821] (-2156.120) (-2153.452) -- 0:00:09
948500 -- [-2161.576] (-2154.747) (-2151.891) (-2155.272) * (-2154.534) [-2152.531] (-2154.384) (-2158.455) -- 0:00:09
949000 -- (-2156.214) (-2156.107) (-2154.448) [-2154.499] * (-2149.565) (-2155.726) (-2152.899) [-2150.196] -- 0:00:09
949500 -- (-2154.551) (-2148.525) [-2150.122] (-2151.542) * (-2153.484) (-2152.807) (-2157.706) [-2149.370] -- 0:00:09
950000 -- (-2152.962) (-2152.835) [-2149.823] (-2150.456) * (-2161.416) (-2151.498) [-2153.213] (-2152.625) -- 0:00:09
Average standard deviation of split frequencies: 0.000248
950500 -- (-2151.478) [-2150.901] (-2155.811) (-2152.611) * [-2151.562] (-2154.502) (-2164.809) (-2155.219) -- 0:00:09
951000 -- (-2153.079) (-2153.085) (-2161.799) [-2149.334] * [-2150.391] (-2157.897) (-2155.351) (-2149.492) -- 0:00:09
951500 -- [-2151.417] (-2153.000) (-2158.047) (-2152.781) * (-2151.769) (-2154.428) (-2146.978) [-2151.827] -- 0:00:08
952000 -- (-2155.918) [-2149.063] (-2146.931) (-2158.613) * [-2149.220] (-2156.105) (-2149.318) (-2155.184) -- 0:00:08
952500 -- (-2152.758) [-2149.651] (-2160.803) (-2162.168) * (-2154.362) (-2157.380) (-2163.278) [-2154.516] -- 0:00:08
953000 -- (-2152.207) (-2150.447) [-2148.602] (-2155.266) * (-2155.404) (-2153.843) (-2150.575) [-2154.416] -- 0:00:08
953500 -- (-2153.884) [-2159.326] (-2148.519) (-2154.994) * (-2160.876) (-2153.745) (-2151.683) [-2153.098] -- 0:00:08
954000 -- (-2156.280) (-2160.231) [-2151.238] (-2155.155) * (-2155.264) (-2161.871) [-2155.167] (-2146.566) -- 0:00:08
954500 -- (-2151.594) [-2152.100] (-2147.998) (-2153.483) * (-2155.582) [-2151.442] (-2152.218) (-2151.842) -- 0:00:08
955000 -- (-2152.998) [-2152.962] (-2158.449) (-2154.738) * [-2150.778] (-2154.743) (-2152.578) (-2153.374) -- 0:00:08
Average standard deviation of split frequencies: 0.000247
955500 -- (-2156.659) (-2156.289) [-2151.352] (-2155.099) * (-2166.026) (-2151.213) (-2152.495) [-2150.912] -- 0:00:08
956000 -- (-2158.164) (-2163.868) (-2158.387) [-2150.715] * (-2157.464) (-2149.764) (-2151.679) [-2152.269] -- 0:00:08
956500 -- [-2155.438] (-2155.929) (-2155.522) (-2156.432) * [-2151.944] (-2153.001) (-2151.242) (-2153.810) -- 0:00:08
957000 -- (-2150.209) [-2153.073] (-2155.246) (-2160.948) * (-2149.621) [-2153.593] (-2156.893) (-2156.804) -- 0:00:07
957500 -- [-2154.193] (-2156.371) (-2156.951) (-2160.650) * (-2153.899) (-2164.102) (-2150.726) [-2156.848] -- 0:00:07
958000 -- (-2158.500) (-2157.067) (-2160.309) [-2153.830] * [-2158.801] (-2156.687) (-2158.679) (-2153.042) -- 0:00:07
958500 -- [-2153.726] (-2155.977) (-2158.421) (-2149.920) * (-2151.026) (-2156.427) (-2152.818) [-2151.875] -- 0:00:07
959000 -- (-2151.065) (-2156.652) [-2151.934] (-2155.369) * (-2154.809) [-2151.984] (-2150.185) (-2151.770) -- 0:00:07
959500 -- (-2160.344) [-2158.410] (-2154.778) (-2156.180) * (-2153.295) (-2152.801) [-2151.669] (-2150.972) -- 0:00:07
960000 -- (-2153.267) [-2151.939] (-2161.476) (-2162.323) * (-2155.264) (-2149.827) (-2161.284) [-2151.375] -- 0:00:07
Average standard deviation of split frequencies: 0.000245
960500 -- (-2149.211) [-2152.809] (-2163.927) (-2151.615) * [-2147.735] (-2156.126) (-2159.329) (-2148.283) -- 0:00:07
961000 -- (-2149.492) [-2150.163] (-2159.154) (-2152.596) * (-2149.264) [-2161.605] (-2155.917) (-2154.323) -- 0:00:07
961500 -- (-2153.445) [-2153.607] (-2159.327) (-2159.317) * (-2152.108) (-2160.889) (-2155.541) [-2151.795] -- 0:00:07
962000 -- (-2154.936) [-2147.127] (-2152.848) (-2150.994) * (-2153.551) (-2150.927) [-2156.199] (-2151.480) -- 0:00:06
962500 -- (-2155.492) (-2151.284) [-2152.565] (-2150.947) * (-2150.516) (-2151.264) [-2158.426] (-2149.544) -- 0:00:06
963000 -- (-2153.896) (-2162.676) [-2154.518] (-2152.201) * [-2152.354] (-2162.489) (-2154.396) (-2156.056) -- 0:00:06
963500 -- (-2153.576) [-2149.187] (-2149.185) (-2155.389) * [-2154.238] (-2156.764) (-2154.214) (-2155.717) -- 0:00:06
964000 -- [-2151.966] (-2150.130) (-2157.704) (-2155.714) * (-2151.563) [-2152.983] (-2152.261) (-2149.795) -- 0:00:06
964500 -- (-2153.721) (-2153.524) [-2154.701] (-2149.954) * (-2148.633) (-2152.222) (-2154.798) [-2154.997] -- 0:00:06
965000 -- (-2152.142) [-2152.041] (-2151.870) (-2151.217) * (-2149.619) (-2158.077) (-2154.984) [-2148.809] -- 0:00:06
Average standard deviation of split frequencies: 0.000244
965500 -- [-2148.731] (-2155.467) (-2160.298) (-2148.272) * (-2156.560) [-2148.687] (-2151.825) (-2150.076) -- 0:00:06
966000 -- (-2163.156) (-2153.666) [-2155.018] (-2154.934) * (-2153.175) [-2150.107] (-2158.480) (-2148.153) -- 0:00:06
966500 -- (-2159.126) [-2149.258] (-2150.638) (-2155.666) * (-2151.276) (-2158.201) (-2151.882) [-2153.574] -- 0:00:06
967000 -- (-2151.973) [-2154.365] (-2149.943) (-2149.144) * (-2154.499) [-2150.212] (-2153.676) (-2157.557) -- 0:00:06
967500 -- (-2152.709) [-2151.453] (-2152.639) (-2154.701) * (-2151.849) (-2156.077) (-2154.832) [-2154.192] -- 0:00:05
968000 -- (-2153.052) [-2158.458] (-2158.704) (-2159.546) * (-2156.782) (-2152.340) [-2154.841] (-2154.055) -- 0:00:05
968500 -- (-2161.050) (-2160.625) [-2151.561] (-2157.339) * (-2160.881) (-2155.006) (-2151.173) [-2154.106] -- 0:00:05
969000 -- (-2152.878) (-2158.389) (-2148.475) [-2149.692] * (-2156.806) (-2155.099) (-2150.007) [-2153.786] -- 0:00:05
969500 -- (-2158.805) [-2155.280] (-2152.193) (-2149.140) * [-2155.213] (-2153.654) (-2154.874) (-2153.877) -- 0:00:05
970000 -- [-2152.065] (-2155.304) (-2151.043) (-2157.023) * (-2154.938) (-2159.288) (-2151.253) [-2150.914] -- 0:00:05
Average standard deviation of split frequencies: 0.000243
970500 -- (-2156.218) [-2154.240] (-2153.510) (-2157.062) * [-2153.910] (-2152.513) (-2163.726) (-2151.870) -- 0:00:05
971000 -- (-2160.731) [-2152.646] (-2156.485) (-2155.311) * (-2153.366) [-2153.913] (-2152.025) (-2152.072) -- 0:00:05
971500 -- (-2154.642) [-2152.418] (-2147.613) (-2169.070) * [-2146.716] (-2152.261) (-2149.131) (-2155.083) -- 0:00:05
972000 -- (-2151.670) (-2162.395) [-2148.157] (-2158.812) * (-2155.837) (-2147.198) [-2149.649] (-2152.089) -- 0:00:05
972500 -- (-2154.183) (-2164.702) [-2152.100] (-2166.164) * [-2153.371] (-2158.844) (-2154.221) (-2155.534) -- 0:00:05
973000 -- (-2155.366) (-2161.871) (-2151.483) [-2160.659] * (-2153.345) [-2149.248] (-2151.423) (-2151.273) -- 0:00:04
973500 -- (-2160.848) (-2151.585) [-2152.928] (-2155.184) * [-2154.419] (-2152.836) (-2151.791) (-2158.960) -- 0:00:04
974000 -- (-2157.005) [-2154.044] (-2156.137) (-2149.693) * [-2148.731] (-2158.381) (-2151.754) (-2154.614) -- 0:00:04
974500 -- (-2153.629) [-2156.903] (-2154.486) (-2154.105) * (-2150.986) (-2157.206) (-2150.889) [-2158.171] -- 0:00:04
975000 -- (-2154.420) (-2157.347) [-2152.626] (-2154.094) * (-2150.767) (-2154.493) (-2162.869) [-2152.282] -- 0:00:04
Average standard deviation of split frequencies: 0.000241
975500 -- (-2153.938) (-2156.326) [-2155.611] (-2152.065) * [-2151.645] (-2156.140) (-2150.818) (-2151.690) -- 0:00:04
976000 -- [-2150.117] (-2152.847) (-2152.406) (-2149.660) * (-2149.947) (-2148.351) (-2152.487) [-2148.602] -- 0:00:04
976500 -- [-2157.086] (-2155.009) (-2151.257) (-2156.226) * (-2156.396) (-2150.050) [-2147.139] (-2156.500) -- 0:00:04
977000 -- (-2152.194) [-2151.967] (-2153.685) (-2154.602) * (-2153.481) (-2152.360) [-2151.084] (-2152.584) -- 0:00:04
977500 -- (-2148.637) (-2148.453) (-2160.921) [-2147.253] * (-2148.781) (-2156.913) (-2153.640) [-2160.745] -- 0:00:04
978000 -- [-2149.958] (-2147.915) (-2156.697) (-2150.679) * (-2147.854) (-2156.522) [-2153.508] (-2161.505) -- 0:00:04
978500 -- (-2149.885) (-2147.841) [-2152.604] (-2156.105) * (-2155.551) (-2153.379) [-2153.965] (-2155.247) -- 0:00:03
979000 -- [-2147.338] (-2148.494) (-2153.825) (-2153.000) * (-2149.514) [-2159.557] (-2149.106) (-2154.878) -- 0:00:03
979500 -- (-2153.255) (-2153.194) [-2153.278] (-2149.123) * (-2154.298) [-2153.158] (-2151.787) (-2150.489) -- 0:00:03
980000 -- [-2150.945] (-2160.936) (-2156.268) (-2145.715) * (-2150.940) (-2150.617) [-2151.484] (-2158.166) -- 0:00:03
Average standard deviation of split frequencies: 0.000240
980500 -- (-2150.027) [-2154.021] (-2157.679) (-2151.041) * [-2157.285] (-2159.913) (-2150.575) (-2153.288) -- 0:00:03
981000 -- (-2156.780) (-2156.184) (-2153.256) [-2149.550] * (-2148.692) (-2150.307) [-2149.136] (-2156.346) -- 0:00:03
981500 -- (-2154.988) (-2154.483) [-2151.797] (-2153.649) * (-2149.723) [-2155.499] (-2158.188) (-2154.150) -- 0:00:03
982000 -- (-2149.465) (-2154.021) [-2155.110] (-2146.911) * (-2148.811) (-2152.978) (-2155.614) [-2152.681] -- 0:00:03
982500 -- [-2158.190] (-2149.403) (-2157.565) (-2150.493) * (-2151.731) (-2149.399) [-2150.153] (-2152.873) -- 0:00:03
983000 -- (-2148.825) [-2153.961] (-2155.765) (-2149.638) * (-2150.061) (-2151.600) (-2150.862) [-2153.467] -- 0:00:03
983500 -- [-2151.491] (-2153.183) (-2150.435) (-2158.817) * (-2152.299) (-2155.677) (-2152.608) [-2154.341] -- 0:00:03
984000 -- [-2155.318] (-2158.880) (-2162.360) (-2154.660) * (-2156.489) (-2156.637) [-2153.946] (-2156.849) -- 0:00:02
984500 -- (-2151.013) (-2157.060) (-2157.995) [-2153.333] * [-2158.469] (-2155.360) (-2150.191) (-2155.464) -- 0:00:02
985000 -- (-2156.837) [-2156.679] (-2147.390) (-2154.072) * (-2161.402) (-2152.499) [-2146.796] (-2155.585) -- 0:00:02
Average standard deviation of split frequencies: 0.000239
985500 -- (-2153.733) [-2148.004] (-2159.810) (-2159.477) * (-2155.565) (-2151.125) [-2150.343] (-2160.937) -- 0:00:02
986000 -- (-2171.781) (-2148.835) (-2149.497) [-2155.342] * (-2157.547) (-2151.717) (-2150.347) [-2158.852] -- 0:00:02
986500 -- (-2162.284) (-2154.592) (-2154.577) [-2152.911] * [-2149.148] (-2155.063) (-2152.541) (-2150.009) -- 0:00:02
987000 -- (-2154.481) [-2148.710] (-2158.561) (-2158.470) * (-2152.550) (-2154.157) (-2150.800) [-2152.729] -- 0:00:02
987500 -- (-2159.662) [-2151.747] (-2156.319) (-2153.555) * (-2151.933) (-2152.036) [-2150.527] (-2149.729) -- 0:00:02
988000 -- [-2156.734] (-2150.587) (-2153.591) (-2151.308) * (-2150.901) (-2153.142) (-2150.845) [-2152.963] -- 0:00:02
988500 -- (-2153.637) (-2156.406) (-2158.146) [-2151.013] * (-2153.467) (-2157.298) (-2154.064) [-2152.973] -- 0:00:02
989000 -- (-2160.415) (-2153.955) [-2152.928] (-2152.087) * (-2162.776) (-2156.165) (-2154.870) [-2149.954] -- 0:00:02
989500 -- (-2149.603) (-2157.379) (-2152.034) [-2151.619] * (-2158.770) [-2151.584] (-2154.098) (-2151.374) -- 0:00:01
990000 -- (-2153.445) [-2149.886] (-2149.443) (-2150.739) * (-2148.219) [-2151.784] (-2154.835) (-2150.702) -- 0:00:01
Average standard deviation of split frequencies: 0.000238
990500 -- (-2154.372) [-2146.934] (-2151.834) (-2160.407) * (-2150.511) [-2153.053] (-2154.613) (-2152.039) -- 0:00:01
991000 -- (-2150.323) (-2151.713) [-2157.738] (-2156.080) * (-2150.253) (-2148.993) [-2152.172] (-2162.536) -- 0:00:01
991500 -- (-2148.031) (-2151.115) [-2151.979] (-2155.212) * (-2152.596) (-2155.341) (-2154.658) [-2156.458] -- 0:00:01
992000 -- [-2154.834] (-2151.671) (-2157.037) (-2151.205) * (-2158.881) [-2151.968] (-2149.141) (-2155.518) -- 0:00:01
992500 -- (-2151.271) [-2149.844] (-2153.084) (-2149.924) * (-2154.357) (-2149.146) (-2154.998) [-2161.671] -- 0:00:01
993000 -- (-2149.805) (-2152.906) (-2155.975) [-2151.198] * (-2152.616) [-2153.153] (-2160.598) (-2149.963) -- 0:00:01
993500 -- (-2148.560) [-2150.300] (-2159.568) (-2154.565) * (-2155.570) [-2156.462] (-2149.318) (-2150.998) -- 0:00:01
994000 -- (-2153.852) (-2157.539) (-2152.685) [-2152.232] * (-2151.114) (-2157.284) (-2151.334) [-2154.646] -- 0:00:01
994500 -- (-2155.910) [-2149.762] (-2155.445) (-2153.334) * [-2158.511] (-2155.644) (-2148.074) (-2155.226) -- 0:00:01
995000 -- (-2151.464) (-2154.987) (-2150.299) [-2147.619] * (-2149.394) [-2157.234] (-2151.359) (-2161.907) -- 0:00:00
Average standard deviation of split frequencies: 0.000237
995500 -- (-2152.495) (-2154.912) (-2152.516) [-2147.078] * (-2153.990) [-2153.072] (-2152.493) (-2156.210) -- 0:00:00
996000 -- (-2155.370) (-2159.109) (-2150.548) [-2150.712] * [-2151.381] (-2162.826) (-2151.770) (-2163.190) -- 0:00:00
996500 -- (-2152.065) [-2153.785] (-2155.773) (-2151.989) * [-2154.133] (-2162.100) (-2152.236) (-2155.835) -- 0:00:00
997000 -- (-2148.505) [-2151.430] (-2156.687) (-2160.398) * (-2158.693) [-2153.456] (-2152.445) (-2161.541) -- 0:00:00
997500 -- (-2153.733) (-2152.204) [-2147.947] (-2150.766) * (-2162.271) [-2155.155] (-2150.826) (-2161.079) -- 0:00:00
998000 -- (-2157.891) (-2152.610) (-2153.749) [-2153.673] * [-2150.499] (-2154.624) (-2157.473) (-2156.565) -- 0:00:00
998500 -- (-2160.640) (-2149.608) (-2156.683) [-2149.162] * (-2159.756) (-2156.476) [-2150.413] (-2152.290) -- 0:00:00
999000 -- (-2150.138) (-2150.528) [-2151.648] (-2153.210) * (-2154.683) (-2151.003) (-2148.003) [-2157.556] -- 0:00:00
999500 -- [-2151.531] (-2153.173) (-2152.732) (-2153.973) * (-2164.313) [-2150.195] (-2154.331) (-2155.757) -- 0:00:00
1000000 -- (-2154.221) [-2146.377] (-2149.217) (-2152.344) * (-2160.842) (-2149.560) [-2153.691] (-2157.586) -- 0:00:00
Average standard deviation of split frequencies: 0.000236
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2154.220988 -- 13.534244
Chain 1 -- -2154.220988 -- 13.534244
Chain 2 -- -2146.377149 -- 14.303171
Chain 2 -- -2146.377149 -- 14.303171
Chain 3 -- -2149.217196 -- 13.584822
Chain 3 -- -2149.217196 -- 13.584822
Chain 4 -- -2152.343777 -- 12.958131
Chain 4 -- -2152.343777 -- 12.958131
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2160.842042 -- 14.963946
Chain 1 -- -2160.842042 -- 14.963946
Chain 2 -- -2149.560375 -- 14.190280
Chain 2 -- -2149.560375 -- 14.190280
Chain 3 -- -2153.690528 -- 15.648631
Chain 3 -- -2153.690528 -- 15.648631
Chain 4 -- -2157.586244 -- 14.316236
Chain 4 -- -2157.586244 -- 14.316236
Analysis completed in 3 mins 4 seconds
Analysis used 184.45 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2144.34
Likelihood of best state for "cold" chain of run 2 was -2144.37
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.4 % ( 42 %) Dirichlet(Revmat{all})
64.4 % ( 48 %) Slider(Revmat{all})
25.0 % ( 28 %) Dirichlet(Pi{all})
28.5 % ( 32 %) Slider(Pi{all})
51.1 % ( 28 %) Multiplier(Alpha{1,2})
51.1 % ( 21 %) Multiplier(Alpha{3})
72.6 % ( 49 %) Slider(Pinvar{all})
0.1 % ( 0 %) ExtSPR(Tau{all},V{all})
0.1 % ( 0 %) ExtTBR(Tau{all},V{all})
0.1 % ( 0 %) NNI(Tau{all},V{all})
0.1 % ( 0 %) ParsSPR(Tau{all},V{all})
25.8 % ( 27 %) Multiplier(V{all})
26.2 % ( 31 %) Nodeslider(V{all})
25.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
49.6 % ( 32 %) Dirichlet(Revmat{all})
65.5 % ( 52 %) Slider(Revmat{all})
25.3 % ( 30 %) Dirichlet(Pi{all})
27.8 % ( 35 %) Slider(Pi{all})
51.0 % ( 32 %) Multiplier(Alpha{1,2})
51.1 % ( 29 %) Multiplier(Alpha{3})
72.6 % ( 51 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.1 % ( 0 %) ExtTBR(Tau{all},V{all})
0.1 % ( 0 %) NNI(Tau{all},V{all})
0.1 % ( 0 %) ParsSPR(Tau{all},V{all})
26.0 % ( 23 %) Multiplier(V{all})
26.4 % ( 30 %) Nodeslider(V{all})
25.5 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.57
2 | 166601 0.85 0.71
3 | 166929 167099 0.86
4 | 167088 165572 166711
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.56
2 | 166410 0.85 0.71
3 | 166430 166561 0.86
4 | 166921 166669 167009
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2151.00
| 2 2 1|
| 11 2 2 1 |
| 2 2 2 2 2 1 |
| 1 1 1 1 22 1 2 |
| 2 221 1 * 2 1 12 |
|1 * 1 111 1 2 2 2 1 |
|2 21 * *1 22 2 1 2 21 1 |
| 2 1 1 2 21 2 22 11 21 12 11 12 21 |
| 2 1 2 1 2 2 1 1 1 2 2 22 |
| 2 * 11 1 2 212 |
| 2 11 1 1 |
| 1 2 * 1 |
| 2 2|
| |
| 1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2154.11
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2149.62 -2157.68
2 -2149.50 -2158.96
--------------------------------------
TOTAL -2149.56 -2158.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.332629 0.001331 0.265708 0.406423 0.330473 1413.70 1415.11 1.000
r(A<->C){all} 0.116455 0.000890 0.059962 0.172551 0.113767 1019.30 1025.92 1.002
r(A<->G){all} 0.202088 0.001215 0.137262 0.268375 0.200087 1043.96 1054.78 1.000
r(A<->T){all} 0.165676 0.001315 0.102215 0.244226 0.163246 899.76 991.77 1.000
r(C<->G){all} 0.092578 0.000509 0.055038 0.142017 0.090472 971.28 1026.96 1.000
r(C<->T){all} 0.344030 0.002144 0.252694 0.433154 0.342322 718.68 848.12 1.000
r(G<->T){all} 0.079173 0.000590 0.032792 0.125980 0.077508 1077.38 1121.80 1.000
pi(A){all} 0.205542 0.000175 0.179199 0.231529 0.205372 848.86 1111.87 1.000
pi(C){all} 0.274095 0.000201 0.247518 0.302297 0.274018 921.84 1211.42 1.000
pi(G){all} 0.292202 0.000230 0.262069 0.320820 0.291795 1148.87 1200.40 1.000
pi(T){all} 0.228160 0.000182 0.202011 0.254947 0.228143 1216.92 1232.67 1.000
alpha{1,2} 0.253009 0.025288 0.000140 0.539667 0.224062 1279.28 1300.51 1.000
alpha{3} 1.493012 0.440208 0.477047 2.795138 1.365237 1331.86 1354.33 1.000
pinvar{all} 0.130870 0.009973 0.000050 0.323442 0.110139 1223.84 1224.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- .**..
7 -- ...**
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2999 0.999001 0.000471 0.998668 0.999334 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.025758 0.000048 0.013824 0.040065 0.025118 1.000 2
length{all}[2] 0.021191 0.000033 0.010915 0.032819 0.020719 1.000 2
length{all}[3] 0.009919 0.000015 0.003381 0.018057 0.009534 1.000 2
length{all}[4] 0.074179 0.000218 0.045579 0.102721 0.072886 1.000 2
length{all}[5] 0.142753 0.000603 0.096753 0.190546 0.139876 1.000 2
length{all}[6] 0.028147 0.000056 0.013936 0.042041 0.027536 1.000 2
length{all}[7] 0.030708 0.000105 0.011182 0.050846 0.029910 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000236
Maximum standard deviation of split frequencies = 0.000471
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C2 (2)
|----------------100----------------+
+ \------------------------------------ C3 (3)
|
| /------------------------------------ C4 (4)
\----------------100----------------+
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
| /-------- C2 (2)
|-----------+
+ \---- C3 (3)
|
| /------------------------------- C4 (4)
\------------+
\----------------------------------------------------------- C5 (5)
|-------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 846
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
3 ambiguity characters in seq. 5
2 sites are removed. 1 282
codon 2: TCG TCG TCG TCG AGC
codon 3: AGC AGC AGC AGC TCT
Sequences read..
Counting site patterns.. 0:00
174 patterns at 280 / 280 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
169824 bytes for conP
23664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), (4, 5)); MP score: 177
254736 bytes for conP, adjusted
0.068633 0.069732 0.052501 0.024065 0.072842 0.178811 0.287493 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -2212.445803
Iterating by ming2
Initial: fx= 2212.445803
x= 0.06863 0.06973 0.05250 0.02407 0.07284 0.17881 0.28749 0.30000 1.30000
1 h-m-p 0.0000 0.0056 225.6634 ++++YCCCC 2151.710623 4 0.0037 25 | 0/9
2 h-m-p 0.0002 0.0012 705.9295 YYCCC 2138.705729 4 0.0003 43 | 0/9
3 h-m-p 0.0001 0.0005 326.4719 +YCYCCC 2130.108660 5 0.0003 64 | 0/9
4 h-m-p 0.0001 0.0005 381.5526 CCCCC 2125.965030 4 0.0002 84 | 0/9
5 h-m-p 0.0001 0.0006 226.9698 CCCCC 2124.100597 4 0.0002 104 | 0/9
6 h-m-p 0.0003 0.0055 121.4133 +YCYCCCC 2112.484674 6 0.0030 127 | 0/9
7 h-m-p 0.0001 0.0004 1384.3854 YCYCCCC 2096.756654 6 0.0002 150 | 0/9
8 h-m-p 0.0009 0.0046 39.5926 YCC 2096.357949 2 0.0007 165 | 0/9
9 h-m-p 0.0041 0.0295 6.2765 CCC 2096.312330 2 0.0012 181 | 0/9
10 h-m-p 0.0281 2.0278 0.2620 ++CCCC 2082.497288 3 0.4378 201 | 0/9
11 h-m-p 0.3322 1.6610 0.2359 CYC 2079.319633 2 0.3583 225 | 0/9
12 h-m-p 0.3084 1.5419 0.0984 CYCCC 2077.124318 4 0.5305 253 | 0/9
13 h-m-p 1.2460 7.7202 0.0419 CCCC 2075.996881 3 1.3161 280 | 0/9
14 h-m-p 1.3896 8.0000 0.0397 YCCC 2075.377933 3 3.2529 306 | 0/9
15 h-m-p 1.6000 8.0000 0.0472 CYC 2075.119236 2 2.0059 330 | 0/9
16 h-m-p 1.6000 8.0000 0.0289 CC 2075.043840 1 1.8712 353 | 0/9
17 h-m-p 1.6000 8.0000 0.0178 YC 2074.981180 1 2.5591 375 | 0/9
18 h-m-p 1.6000 8.0000 0.0042 CC 2074.966622 1 2.0299 398 | 0/9
19 h-m-p 1.6000 8.0000 0.0020 YC 2074.965681 1 1.2595 420 | 0/9
20 h-m-p 1.6000 8.0000 0.0007 Y 2074.965666 0 1.0460 441 | 0/9
21 h-m-p 1.6000 8.0000 0.0001 C 2074.965666 0 1.2974 462 | 0/9
22 h-m-p 1.6000 8.0000 0.0000 Y 2074.965666 0 1.2688 483 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 Y 2074.965666 0 1.6000 504 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/9
25 h-m-p 0.0160 8.0000 0.0006 ------------- | 0/9
26 h-m-p 0.0160 8.0000 0.0006 -------------
Out..
lnL = -2074.965666
604 lfun, 604 eigenQcodon, 4228 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), (4, 5)); MP score: 177
0.068633 0.069732 0.052501 0.024065 0.072842 0.178811 0.287493 1.840493 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.015321
np = 10
lnL0 = -2099.343300
Iterating by ming2
Initial: fx= 2099.343300
x= 0.06863 0.06973 0.05250 0.02407 0.07284 0.17881 0.28749 1.84049 0.57321 0.49224
1 h-m-p 0.0000 0.0070 68.7843 ++++CCC 2094.575238 2 0.0024 33 | 0/10
2 h-m-p 0.0002 0.0009 547.0144 YCYCCCC 2085.405616 6 0.0005 67 | 0/10
3 h-m-p 0.0001 0.0003 678.8239 CYCCCC 2083.104839 5 0.0001 99 | 0/10
4 h-m-p 0.0009 0.0046 16.2887 YCC 2083.052459 2 0.0004 125 | 0/10
5 h-m-p 0.0005 0.0358 11.4440 +YC 2082.949331 1 0.0018 150 | 0/10
6 h-m-p 0.0033 0.0739 6.1391 CYC 2082.857881 2 0.0034 176 | 0/10
7 h-m-p 0.0017 0.0755 12.3729 +YCC 2082.520043 2 0.0056 203 | 0/10
8 h-m-p 0.0015 0.0487 46.8529 ++YCCC 2078.645250 3 0.0167 233 | 0/10
9 h-m-p 0.0019 0.0097 53.0449 YCCC 2078.346126 3 0.0011 261 | 0/10
10 h-m-p 0.0267 0.2255 2.0875 +YYYC 2076.387190 3 0.0998 288 | 0/10
11 h-m-p 0.0051 0.0255 30.7180 YCCCC 2073.864659 4 0.0099 318 | 0/10
12 h-m-p 0.2902 1.4512 1.0433 CCCCC 2070.924068 4 0.4160 349 | 0/10
13 h-m-p 0.6273 3.1364 0.0448 YYC 2070.406089 2 0.5407 374 | 0/10
14 h-m-p 0.2286 8.0000 0.1059 +YC 2070.218220 1 0.7130 399 | 0/10
15 h-m-p 1.6000 8.0000 0.0398 YC 2070.194078 1 0.8941 423 | 0/10
16 h-m-p 1.6000 8.0000 0.0024 YC 2070.188507 1 1.0287 447 | 0/10
17 h-m-p 0.4652 8.0000 0.0053 YC 2070.187623 1 0.8029 471 | 0/10
18 h-m-p 1.6000 8.0000 0.0022 YC 2070.187450 1 0.7916 495 | 0/10
19 h-m-p 1.6000 8.0000 0.0005 Y 2070.187426 0 0.8388 518 | 0/10
20 h-m-p 1.6000 8.0000 0.0002 Y 2070.187425 0 0.8051 541 | 0/10
21 h-m-p 1.6000 8.0000 0.0001 Y 2070.187425 0 0.6711 564 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 2070.187425 0 0.9266 587 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 -C 2070.187425 0 0.1000 611
Out..
lnL = -2070.187425
612 lfun, 1836 eigenQcodon, 8568 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), (4, 5)); MP score: 177
initial w for M2:NSpselection reset.
0.068633 0.069732 0.052501 0.024065 0.072842 0.178811 0.287493 1.904845 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.635238
np = 12
lnL0 = -2110.444491
Iterating by ming2
Initial: fx= 2110.444491
x= 0.06863 0.06973 0.05250 0.02407 0.07284 0.17881 0.28749 1.90484 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0103 85.7307 +++CYCC 2108.135651 3 0.0007 37 | 0/12
2 h-m-p 0.0002 0.0009 137.2876 YCYCCC 2105.696519 5 0.0005 72 | 0/12
3 h-m-p 0.0002 0.0011 427.5441 +YCCCCC 2095.871897 5 0.0007 109 | 0/12
4 h-m-p 0.0000 0.0002 916.7170 +YYCCC 2091.438191 4 0.0001 143 | 0/12
5 h-m-p 0.0014 0.0070 31.6066 YCCC 2091.200706 3 0.0006 175 | 0/12
6 h-m-p 0.0006 0.0174 33.8598 +CCCC 2090.202443 3 0.0032 209 | 0/12
7 h-m-p 0.0012 0.0088 88.0340 CCCC 2088.785373 3 0.0019 242 | 0/12
8 h-m-p 0.0023 0.0356 74.0144 +CCCC 2082.409608 3 0.0117 276 | 0/12
9 h-m-p 0.0080 0.0398 23.5346 CYC 2082.117943 2 0.0022 306 | 0/12
10 h-m-p 0.0079 0.1540 6.5966 +++ 2075.650135 m 0.1540 334 | 1/12
11 h-m-p 0.1850 0.9250 2.4792 YCCCCC 2073.173573 5 0.2227 370 | 1/12
12 h-m-p 0.2451 1.2255 1.4533 CCC 2070.767028 2 0.2573 400 | 1/12
13 h-m-p 0.6463 3.2317 0.3506 YCY 2070.227972 2 0.3704 429 | 1/12
14 h-m-p 1.6000 8.0000 0.0403 YC 2070.192091 1 0.7215 456 | 1/12
15 h-m-p 1.5475 8.0000 0.0188 YC 2070.188036 1 0.7990 483 | 1/12
16 h-m-p 1.6000 8.0000 0.0031 YC 2070.187573 1 0.9330 510 | 1/12
17 h-m-p 0.8856 8.0000 0.0033 C 2070.187430 0 1.0090 536 | 1/12
18 h-m-p 1.6000 8.0000 0.0006 Y 2070.187426 0 1.0338 562 | 1/12
19 h-m-p 1.6000 8.0000 0.0002 Y 2070.187425 0 0.7734 588 | 1/12
20 h-m-p 1.1551 8.0000 0.0001 Y 2070.187425 0 0.7040 614 | 1/12
21 h-m-p 1.6000 8.0000 0.0000 Y 2070.187425 0 0.9162 640 | 1/12
22 h-m-p 1.6000 8.0000 0.0000 +Y 2070.187425 0 4.1695 667 | 1/12
23 h-m-p 1.2834 8.0000 0.0000 ----------------.. | 1/12
24 h-m-p 0.0160 8.0000 0.0003 --Y 2070.187425 0 0.0003 735 | 1/12
25 h-m-p 0.0160 8.0000 0.0001 ------C 2070.187425 0 0.0000 767
Out..
lnL = -2070.187425
768 lfun, 3072 eigenQcodon, 16128 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2079.029096 S = -1945.705517 -125.327380
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 174 patterns 0:10
did 20 / 174 patterns 0:10
did 30 / 174 patterns 0:10
did 40 / 174 patterns 0:10
did 50 / 174 patterns 0:10
did 60 / 174 patterns 0:10
did 70 / 174 patterns 0:10
did 80 / 174 patterns 0:10
did 90 / 174 patterns 0:10
did 100 / 174 patterns 0:10
did 110 / 174 patterns 0:10
did 120 / 174 patterns 0:10
did 130 / 174 patterns 0:10
did 140 / 174 patterns 0:10
did 150 / 174 patterns 0:10
did 160 / 174 patterns 0:10
did 170 / 174 patterns 0:10
did 174 / 174 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, (2, 3), (4, 5)); MP score: 177
0.068633 0.069732 0.052501 0.024065 0.072842 0.178811 0.287493 1.904844 0.331355 0.382499 0.119834 0.299156 0.500902
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 9.993726
np = 13
lnL0 = -2073.480829
Iterating by ming2
Initial: fx= 2073.480829
x= 0.06863 0.06973 0.05250 0.02407 0.07284 0.17881 0.28749 1.90484 0.33136 0.38250 0.11983 0.29916 0.50090
1 h-m-p 0.0000 0.0033 47.8096 +++CC 2072.760111 1 0.0006 36 | 0/13
2 h-m-p 0.0003 0.0014 101.8127 CYC 2072.343627 2 0.0002 68 | 0/13
3 h-m-p 0.0002 0.0009 119.0675 +CYC 2070.964545 2 0.0007 101 | 0/13
4 h-m-p 0.0000 0.0002 156.9856 ++ 2070.424265 m 0.0002 130 | 1/13
5 h-m-p 0.0012 0.0134 9.6853 CYC 2070.360529 2 0.0010 162 | 1/13
6 h-m-p 0.0006 0.0966 17.2845 +YC 2070.225079 1 0.0015 192 | 1/13
7 h-m-p 0.0007 0.0134 36.1504 YC 2070.011286 1 0.0012 221 | 1/13
8 h-m-p 0.0017 0.0202 25.0964 YCC 2069.872606 2 0.0013 252 | 1/13
9 h-m-p 0.0112 0.5521 2.9695 YC 2069.847883 1 0.0060 281 | 1/13
10 h-m-p 0.0061 0.2273 2.8792 +CYY 2069.766018 2 0.0241 313 | 1/13
11 h-m-p 0.2943 5.9762 0.2361 +YYC 2069.351616 2 0.9959 344 | 1/13
12 h-m-p 0.3201 8.0000 0.7347 YC 2069.317757 1 0.1424 373 | 1/13
13 h-m-p 0.1603 4.4471 0.6526 YYY 2069.295421 2 0.1569 403 | 1/13
14 h-m-p 0.9213 8.0000 0.1111 YC 2069.252756 1 2.0190 432 | 0/13
15 h-m-p 0.0464 2.6510 4.8310 --YC 2069.252378 1 0.0014 463 | 0/13
16 h-m-p 0.0464 0.4197 0.1470 ++ 2069.238834 m 0.4197 492 | 1/13
17 h-m-p 0.1180 8.0000 0.5227 +CC 2069.210943 1 0.5655 524 | 1/13
18 h-m-p 0.6058 8.0000 0.4878 YCCC 2069.196997 3 0.4081 557 | 1/13
19 h-m-p 1.1544 8.0000 0.1725 YYCC 2069.181624 3 1.9500 589 | 1/13
20 h-m-p 1.4633 8.0000 0.2298 YYC 2069.175550 2 1.1857 619 | 1/13
21 h-m-p 1.6000 8.0000 0.0742 YC 2069.174172 1 2.6894 648 | 1/13
22 h-m-p 1.6000 8.0000 0.0351 Y 2069.173931 0 1.2639 676 | 1/13
23 h-m-p 1.6000 8.0000 0.0124 C 2069.173900 0 0.5503 704 | 1/13
24 h-m-p 0.4699 8.0000 0.0146 +Y 2069.173888 0 1.2118 733 | 1/13
25 h-m-p 1.6000 8.0000 0.0016 Y 2069.173888 0 1.1174 761 | 1/13
26 h-m-p 1.6000 8.0000 0.0003 Y 2069.173888 0 0.8854 789 | 1/13
27 h-m-p 1.6000 8.0000 0.0000 Y 2069.173888 0 0.8741 817 | 1/13
28 h-m-p 1.6000 8.0000 0.0000 C 2069.173888 0 1.3645 845 | 1/13
29 h-m-p 1.6000 8.0000 0.0000 Y 2069.173888 0 0.4000 873 | 1/13
30 h-m-p 0.1212 8.0000 0.0000 C 2069.173888 0 0.1212 901 | 1/13
31 h-m-p 0.7257 8.0000 0.0000 Y 2069.173888 0 0.1814 929 | 1/13
32 h-m-p 0.0639 8.0000 0.0000 ------------Y 2069.173888 0 0.0000 969
Out..
lnL = -2069.173888
970 lfun, 3880 eigenQcodon, 20370 P(t)
Time used: 0:17
Model 7: beta
TREE # 1
(1, (2, 3), (4, 5)); MP score: 177
0.068633 0.069732 0.052501 0.024065 0.072842 0.178811 0.287493 1.870620 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.895478
np = 10
lnL0 = -2071.384589
Iterating by ming2
Initial: fx= 2071.384589
x= 0.06863 0.06973 0.05250 0.02407 0.07284 0.17881 0.28749 1.87062 0.66567 1.54913
1 h-m-p 0.0000 0.0048 43.6795 +++YCCC 2070.931865 3 0.0005 33 | 0/10
2 h-m-p 0.0005 0.0075 40.3805 YCCC 2070.800826 3 0.0003 61 | 0/10
3 h-m-p 0.0002 0.0035 51.2616 YCCC 2070.604013 3 0.0004 89 | 0/10
4 h-m-p 0.0004 0.0076 43.7456 CCC 2070.393048 2 0.0006 116 | 0/10
5 h-m-p 0.0014 0.0349 19.0929 YC 2070.104740 1 0.0028 140 | 0/10
6 h-m-p 0.0007 0.0079 76.9330 CCCC 2069.782666 3 0.0008 169 | 0/10
7 h-m-p 0.0041 0.0466 15.2334 -CC 2069.764083 1 0.0003 195 | 0/10
8 h-m-p 0.0020 0.0760 2.5753 YC 2069.761105 1 0.0010 219 | 0/10
9 h-m-p 0.0063 3.1718 0.5303 +++CCCC 2069.675246 3 0.5219 251 | 0/10
10 h-m-p 0.1350 0.6949 2.0498 CCCC 2069.584882 3 0.1501 280 | 0/10
11 h-m-p 0.5817 2.9083 0.3637 YCCC 2069.512380 3 0.3466 308 | 0/10
12 h-m-p 1.0872 8.0000 0.1160 YC 2069.503522 1 0.6451 332 | 0/10
13 h-m-p 1.6000 8.0000 0.0090 YC 2069.503203 1 0.9032 356 | 0/10
14 h-m-p 1.6000 8.0000 0.0002 Y 2069.503200 0 0.9037 379 | 0/10
15 h-m-p 1.6000 8.0000 0.0001 Y 2069.503200 0 0.8777 402 | 0/10
16 h-m-p 1.6000 8.0000 0.0000 Y 2069.503200 0 1.0369 425 | 0/10
17 h-m-p 1.6000 8.0000 0.0000 ----Y 2069.503200 0 0.0016 452
Out..
lnL = -2069.503200
453 lfun, 4983 eigenQcodon, 31710 P(t)
Time used: 0:27
Model 8: beta&w>1
TREE # 1
(1, (2, 3), (4, 5)); MP score: 177
initial w for M8:NSbetaw>1 reset.
0.068633 0.069732 0.052501 0.024065 0.072842 0.178811 0.287493 1.879805 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.485507
np = 12
lnL0 = -2075.348071
Iterating by ming2
Initial: fx= 2075.348071
x= 0.06863 0.06973 0.05250 0.02407 0.07284 0.17881 0.28749 1.87980 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0014 93.8606 +++CCCC 2071.880608 3 0.0008 38 | 0/12
2 h-m-p 0.0001 0.0006 90.5993 +YCCC 2070.905058 3 0.0003 71 | 0/12
3 h-m-p 0.0000 0.0002 141.5211 +YC 2070.402756 1 0.0002 100 | 0/12
4 h-m-p 0.0000 0.0001 47.6819 ++ 2070.282006 m 0.0001 127 | 0/12
5 h-m-p 0.0000 0.0000 20.8220
h-m-p: 0.00000000e+00 0.00000000e+00 2.08219611e+01 2070.282006
.. | 0/12
6 h-m-p 0.0000 0.0030 34.0936 +++YCC 2070.023081 2 0.0004 184 | 0/12
7 h-m-p 0.0000 0.0001 49.6174 ++ 2069.943487 m 0.0001 211 | 1/12
8 h-m-p 0.0002 0.0054 23.0679 YCC 2069.867588 2 0.0004 241 | 1/12
9 h-m-p 0.0004 0.0425 25.7908 +YCC 2069.700577 2 0.0012 271 | 1/12
10 h-m-p 0.0023 0.0178 13.1271 CC 2069.657605 1 0.0009 299 | 1/12
11 h-m-p 0.0011 0.0335 10.2355 YC 2069.638973 1 0.0007 326 | 1/12
12 h-m-p 0.0018 0.0286 4.1375 CC 2069.635899 1 0.0005 354 | 1/12
13 h-m-p 0.0008 0.2067 2.7777 CC 2069.633255 1 0.0011 382 | 1/12
14 h-m-p 0.0047 2.2900 0.6430 ++CC 2069.609767 1 0.1139 412 | 1/12
15 h-m-p 0.0170 0.3221 4.3142 +YCC 2069.551077 2 0.0453 442 | 1/12
16 h-m-p 0.1660 1.0831 1.1773 YCC 2069.523703 2 0.0997 471 | 1/12
17 h-m-p 1.6000 8.0000 0.0383 YCC 2069.504491 2 0.9103 500 | 1/12
18 h-m-p 1.6000 8.0000 0.0162 YC 2069.503515 1 1.0305 527 | 1/12
19 h-m-p 1.6000 8.0000 0.0043 Y 2069.503493 0 0.7769 553 | 1/12
20 h-m-p 1.6000 8.0000 0.0005 Y 2069.503493 0 1.1739 579 | 1/12
21 h-m-p 1.2320 8.0000 0.0005 ++ 2069.503491 m 8.0000 605 | 1/12
22 h-m-p 0.0439 8.0000 0.0839 +++Y 2069.503457 0 2.1149 634 | 1/12
23 h-m-p 1.6000 8.0000 0.0880 ++ 2069.503246 m 8.0000 660 | 1/12
24 h-m-p 0.0456 0.2280 0.5735 ++ 2069.503221 m 0.2280 686 | 2/12
25 h-m-p 0.3002 8.0000 0.0003 +Y 2069.503212 0 1.0058 713 | 2/12
26 h-m-p 1.6000 8.0000 0.0001 Y 2069.503212 0 0.9998 738 | 2/12
27 h-m-p 1.6000 8.0000 0.0000 ----Y 2069.503212 0 0.0006 767
Out..
lnL = -2069.503212
768 lfun, 9216 eigenQcodon, 59136 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2077.527581 S = -1946.103643 -124.214707
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 174 patterns 0:46
did 20 / 174 patterns 0:47
did 30 / 174 patterns 0:47
did 40 / 174 patterns 0:47
did 50 / 174 patterns 0:47
did 60 / 174 patterns 0:47
did 70 / 174 patterns 0:47
did 80 / 174 patterns 0:47
did 90 / 174 patterns 0:48
did 100 / 174 patterns 0:48
did 110 / 174 patterns 0:48
did 120 / 174 patterns 0:48
did 130 / 174 patterns 0:48
did 140 / 174 patterns 0:48
did 150 / 174 patterns 0:49
did 160 / 174 patterns 0:49
did 170 / 174 patterns 0:49
did 174 / 174 patterns 0:49
Time used: 0:49
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=282
D_melanogaster_zetaTry-PA -MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
D_sechellia_zetaTry-PA -MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
D_simulans_zetaTry-PA -MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
D_yakuba_zetaTry-PA -MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
D_erecta_zetaTry-PA MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
****: ***.*.. ::*:***********:..*.*******.*****
D_melanogaster_zetaTry-PA VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
D_sechellia_zetaTry-PA VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
D_simulans_zetaTry-PA VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
D_yakuba_zetaTry-PA VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
D_erecta_zetaTry-PA VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
*****:****.*::*:**:********.*****:*****::******:**
D_melanogaster_zetaTry-PA VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
D_sechellia_zetaTry-PA VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
D_simulans_zetaTry-PA VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
D_yakuba_zetaTry-PA VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
D_erecta_zetaTry-PA VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
***:*::*.:********.::*** * **********:************
D_melanogaster_zetaTry-PA TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
D_sechellia_zetaTry-PA TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
D_simulans_zetaTry-PA TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
D_yakuba_zetaTry-PA TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
D_erecta_zetaTry-PA TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
*****:** * *::*: **:****:* ..* :* **********.*:***
D_melanogaster_zetaTry-PA QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
D_sechellia_zetaTry-PA QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
D_simulans_zetaTry-PA QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
D_yakuba_zetaTry-PA QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
D_erecta_zetaTry-PA LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
***:* ****:********************.******.*** *:****
D_melanogaster_zetaTry-PA WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
D_sechellia_zetaTry-PA WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
D_simulans_zetaTry-PA WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
D_yakuba_zetaTry-PA WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
D_erecta_zetaTry-PA WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-
***.************** ******** ***
>D_melanogaster_zetaTry-PA ---ATGTCGAGCTCTTGGATAGTTGGCCTCTTGGCCTTTCTCGTCAGCTT GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA GCGTTCCGGATGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCACCACGCCGGAGAA TCCCTTTCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACTACAATAG TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCAAGTCAATATAAAGTG GTGGCCGGGACAAATTTCCAAACCGGCTCCGATGGCGTTATCACCAATGT CAAGGAGATCGTTATGCACGAAGGGTATTACTCGGGAGCTGCCTACAACA ACGATATTGCCATTCTATTTGTGGATCCCCCATTGCCGCTCAACAACTTC ACCATCAAGGCCATTAAGCTGGCCTTGGAACAACCAATTGAGGGAACGGT CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTTTGTGAT CAGGACTACGAGGATTTTGGCGACGAGACCTACCGCATTACATCGGCCAT GTTGTGTGCCGGCAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGAG ATTCCGGAGGACCGTTGGCGGTGCGCGATGAACTCTATGGAGTCGTGTCC TGGGGCAACAGTTGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT GGCGTACCTGAGGCCTTGGATCGATGCCGTTTTGGCAGGGCTC--- >D_sechellia_zetaTry-PA ---ATGTCGAGCTCTTGGCTGGTTTGCCTCTTGGCCTTTCTCGTCAGTTT GGTGACCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA ACGTTCCGGGAGGTCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG GTCCCGTACCAGATTTCCCTGCGCTACAAGGCTATCAGCACGCCGCAGAA TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG TGACAGCGGCGCACTGCGTCGTAGGAACGGTGGCCAGTCAATATAAGGTC GTGGCCGGAACAAATTTCCAAACCAGCTCCGATGGCGTTATCACCAATGT CAAGCAGATCGTTATGCACGAAGGGTACGACTCGGGAGCTGCCTACAACA ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC ACCATCAAGGCCATTAAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACACCTCGT ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGCTG ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT TGGGGTAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC--- >D_simulans_zetaTry-PA ---ATGTCGAGCTCTTGGCTGGTTTGCCTATTGGCCTTTCTCGTCAGTTT GGTGGCCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA GCGTTCCGGGAGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCAGCACGCCGGAGAA TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG TGACAGCGGCGCACTGCGTCATCGGAACGGTGGCCAGTCAATATAAGGTT GTGGCCGGGACCAATTTCCAAACCGGATCCGATGGCGTTATCACCAATGT CAAGCAGATCGTTATGCACGAAGGTTACTACTCGGGAGCTGCCTACAACA ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC ACCATCAAGGCCATTCAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA ACCAACTGCTTGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGTG ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT TGGGGCAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC--- >D_yakuba_zetaTry-PA ---ATGTCGAGCTCTTGGCTGGTCTGCCTTTTGGCTCTTCTCGTCGGCGT GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA GCGTTCCGGGCGGGCGCATTGTGGGTGGCTATGTGACGGACATAGCGCAG GTACCGTACCAGATTTCGCTGCGCTACAAGGGTATCACCACGCCGGAGAA TCCCTATAGACACCGTTGCGGAGGATCCATTTTCAATGAAACCACAATAG TGACAGCGGCGCACTGCATCATCGGCACGGTGGCTAGTCAATTCAAGGTG GTGGCCGGGTCAAACTGGCGAACAGGCTCCGATGGCGTCATCACCAATGT CAAGCAGATCGTTATGCATGAGGAGTACTTCTCGGGAGCTGCCTACAACA ATGATATCGCCATTCTATTCGTGGATCCCCCATTGCCACTCAATAACTTC ACCATCAAGGCCATTAAGCTGGCTTCGGAGCCACCACTTGAGGGAACGGT CAGCAAGATCAGCGGATGGGGAACCACTTCTTCCGCTGGCTCCGCCTCGA ATCAACTACTCGCGGTAGATGTGCCGATTGTGAGCAACGAGTTGTGTGAC CAGGACTACGAGGACTTCGGCGATGAGACCTACCGCATCACATCGGCCAT GTTGTGTGCCGGCAAACGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG ATTCCGGTGGGCCGTTGGTGGTGCGCGATGAGCTCCATGGAGTCGTGTCC TGGGGCAACAAATGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT GGCTTACCTGAGACCCTGGATCGATGCTGTTCTGGCGGGGCTC--- >D_erecta_zetaTry-PA ATGTCGAGCTCTTCTTGGCTGGGTTGCCTCCTGGCCGTTCTATTCAGCGC CTTGGCCTTGAGCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAACA GCTTTCCGGATGGCCGCATTGTGGGTGGCTACGTGACGGACATAGCGCAG GTCCCATACCAGATTACCCTGCGCTACAAGGCCATCAGCTCGCCGGAGAA TCCCTTTCGGCATCGGTGCGGAGGATCCATTGTCAATGAGACTACAATAC TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCTAGTCAGTTCAAGGTG GTGGCCGGTACCAATTTCCAAACAGGCACCGATGGCGTCATCACCAATGT CAAGCGGGTCATCATGCACGAGGGATACAACTCGGGAGCAGCCTACAATA ACGATATTGCCGTTCTATTTGTGGATCCCCCATTGCCCCTGAACAACTTC ACCATCAAGGCCATTAAGCTGGCTACGGAGCCACCACTTGATGGAGCGCC CAGCAAGATCAGCGGATGGGGCTCCACTTATCCCGGCGGCTACTCCTCCA ACCAACTTCTCGCGGTGGATGTCCCGATTGTGGGCAACGACTTGTGTGAC CTGGACTACGAGAACTTCATCGATGAGACCTACCACATCACATCCGCCAT GTTGTGTGCCGGCAAGCGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG ATTCCGGCGGACCGTTGGTGGTGCGCGACGAGCTCCATGGAGTCGTGTCC TGGGGCAACAGTTGCGCCCTGCCCAATTATCCCGGCGTCTACGCCAATGT GGCGTTCCTGAGGCCCTGGATCGATGCCGTTCGGGCAGGTCTC---
>D_melanogaster_zetaTry-PA -MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS WGNSCALPNYPGVYANVAYLRPWIDAVLAGL >D_sechellia_zetaTry-PA -MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS WGNSCALPNYPGVYANVANLRPWIDAVLAGL >D_simulans_zetaTry-PA -MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS WGNSCALPNYPGVYANVANLRPWIDAVLAGL >D_yakuba_zetaTry-PA -MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS WGNKCALPNYPGVYANVAYLRPWIDAVLAGL >D_erecta_zetaTry-PA MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS WGNSCALPNYPGVYANVAFLRPWIDAVRAGL
#NEXUS
[ID: 7533981066]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_zetaTry-PA
D_sechellia_zetaTry-PA
D_simulans_zetaTry-PA
D_yakuba_zetaTry-PA
D_erecta_zetaTry-PA
;
end;
begin trees;
translate
1 D_melanogaster_zetaTry-PA,
2 D_sechellia_zetaTry-PA,
3 D_simulans_zetaTry-PA,
4 D_yakuba_zetaTry-PA,
5 D_erecta_zetaTry-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02511799,(2:0.02071919,3:0.009533657)1.000:0.02753561,(4:0.07288627,5:0.139876)0.999:0.02990961);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02511799,(2:0.02071919,3:0.009533657):0.02753561,(4:0.07288627,5:0.139876):0.02990961);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2149.62 -2157.68
2 -2149.50 -2158.96
--------------------------------------
TOTAL -2149.56 -2158.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.332629 0.001331 0.265708 0.406423 0.330473 1413.70 1415.11 1.000
r(A<->C){all} 0.116455 0.000890 0.059962 0.172551 0.113767 1019.30 1025.92 1.002
r(A<->G){all} 0.202088 0.001215 0.137262 0.268375 0.200087 1043.96 1054.78 1.000
r(A<->T){all} 0.165676 0.001315 0.102215 0.244226 0.163246 899.76 991.77 1.000
r(C<->G){all} 0.092578 0.000509 0.055038 0.142017 0.090472 971.28 1026.96 1.000
r(C<->T){all} 0.344030 0.002144 0.252694 0.433154 0.342322 718.68 848.12 1.000
r(G<->T){all} 0.079173 0.000590 0.032792 0.125980 0.077508 1077.38 1121.80 1.000
pi(A){all} 0.205542 0.000175 0.179199 0.231529 0.205372 848.86 1111.87 1.000
pi(C){all} 0.274095 0.000201 0.247518 0.302297 0.274018 921.84 1211.42 1.000
pi(G){all} 0.292202 0.000230 0.262069 0.320820 0.291795 1148.87 1200.40 1.000
pi(T){all} 0.228160 0.000182 0.202011 0.254947 0.228143 1216.92 1232.67 1.000
alpha{1,2} 0.253009 0.025288 0.000140 0.539667 0.224062 1279.28 1300.51 1.000
alpha{3} 1.493012 0.440208 0.477047 2.795138 1.365237 1331.86 1354.33 1.000
pinvar{all} 0.130870 0.009973 0.000050 0.323442 0.110139 1223.84 1224.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 280
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 2 2 0 3 | Ser TCT 2 3 3 2 2 | Tyr TAT 6 6 6 4 2 | Cys TGT 3 2 2 3 2
TTC 3 4 4 6 6 | TCC 6 4 5 6 7 | TAC 8 8 8 7 9 | TGC 3 5 5 4 5
Leu TTA 0 0 0 0 0 | TCA 0 0 0 1 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 8 6 6 6 6 | TCG 4 5 5 6 3 | TAG 0 0 0 0 0 | Trp TGG 4 4 4 5 4
----------------------------------------------------------------------------------------------------------------------
Leu CTT 3 2 3 5 4 | Pro CCT 1 2 2 0 0 | His CAT 1 1 1 2 2 | Arg CGT 1 1 1 1 0
CTC 6 7 5 5 4 | CCC 6 5 5 6 9 | CAC 2 3 3 2 3 | CGC 5 4 4 4 3
CTA 1 0 1 2 2 | CCA 2 2 2 4 4 | Gln CAA 5 5 5 3 3 | CGA 0 0 0 1 0
CTG 7 10 10 8 11 | CCG 6 6 6 5 4 | CAG 4 6 6 5 4 | CGG 1 1 1 1 5
----------------------------------------------------------------------------------------------------------------------
Ile ATT 9 8 8 6 6 | Thr ACT 2 2 2 1 2 | Asn AAT 6 6 6 8 7 | Ser AGT 2 3 3 1 2
ATC 6 6 7 10 9 | ACC 7 8 7 7 6 | AAC 7 8 8 5 9 | AGC 6 6 6 5 7
ATA 3 2 2 2 2 | ACA 4 4 3 4 4 | Lys AAA 2 1 1 2 0 | Arg AGA 0 0 0 2 0
Met ATG 3 3 3 3 2 | ACG 4 4 4 4 3 | AAG 6 7 6 7 7 | AGG 1 1 1 0 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 6 3 3 | Ala GCT 1 3 1 7 2 | Asp GAT 13 8 8 11 12 | Gly GGT 6 7 8 6 7
GTC 11 12 11 8 10 | GCC 12 12 13 10 14 | GAC 3 8 7 4 5 | GGC 12 6 8 12 14
GTA 0 1 0 2 0 | GCA 3 1 1 1 2 | Glu GAA 3 2 2 1 0 | GGA 10 12 12 8 9
GTG 11 11 11 15 12 | GCG 8 9 9 6 7 | GAG 9 7 8 11 9 | GGG 3 3 3 4 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_zetaTry-PA
position 1: T:0.18214 C:0.18214 A:0.24286 G:0.39286
position 2: T:0.28571 C:0.24286 A:0.26786 G:0.20357
position 3: T:0.23214 C:0.36786 A:0.11786 G:0.28214
Average T:0.23333 C:0.26429 A:0.20952 G:0.29286
#2: D_sechellia_zetaTry-PA
position 1: T:0.17500 C:0.19643 A:0.24643 G:0.38214
position 2: T:0.28214 C:0.25000 A:0.27143 G:0.19643
position 3: T:0.21786 C:0.37857 A:0.10714 G:0.29643
Average T:0.22500 C:0.27500 A:0.20833 G:0.29167
#3: D_simulans_zetaTry-PA
position 1: T:0.17857 C:0.19643 A:0.23929 G:0.38571
position 2: T:0.28214 C:0.24286 A:0.26786 G:0.20714
position 3: T:0.22143 C:0.37857 A:0.10357 G:0.29643
Average T:0.22738 C:0.27262 A:0.20357 G:0.29643
#4: D_yakuba_zetaTry-PA
position 1: T:0.17857 C:0.19286 A:0.23929 G:0.38929
position 2: T:0.28929 C:0.25000 A:0.25714 G:0.20357
position 3: T:0.21429 C:0.36071 A:0.11786 G:0.30714
Average T:0.22738 C:0.26786 A:0.20476 G:0.30000
#5: D_erecta_zetaTry-PA
position 1: T:0.17500 C:0.20714 A:0.23929 G:0.37857
position 2: T:0.28571 C:0.24643 A:0.25714 G:0.21071
position 3: T:0.20000 C:0.42857 A:0.09286 G:0.27857
Average T:0.22024 C:0.29405 A:0.19643 G:0.28929
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 11 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 12
TTC 23 | TCC 28 | TAC 40 | TGC 22
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 32 | TCG 23 | TAG 0 | Trp W TGG 21
------------------------------------------------------------------------------
Leu L CTT 17 | Pro P CCT 5 | His H CAT 7 | Arg R CGT 4
CTC 27 | CCC 31 | CAC 13 | CGC 20
CTA 6 | CCA 14 | Gln Q CAA 21 | CGA 1
CTG 46 | CCG 27 | CAG 25 | CGG 9
------------------------------------------------------------------------------
Ile I ATT 37 | Thr T ACT 9 | Asn N AAT 33 | Ser S AGT 11
ATC 38 | ACC 35 | AAC 37 | AGC 30
ATA 11 | ACA 19 | Lys K AAA 6 | Arg R AGA 2
Met M ATG 14 | ACG 19 | AAG 33 | AGG 4
------------------------------------------------------------------------------
Val V GTT 22 | Ala A GCT 14 | Asp D GAT 52 | Gly G GGT 34
GTC 52 | GCC 61 | GAC 27 | GGC 52
GTA 3 | GCA 8 | Glu E GAA 8 | GGA 51
GTG 60 | GCG 39 | GAG 44 | GGG 13
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17786 C:0.19500 A:0.24143 G:0.38571
position 2: T:0.28500 C:0.24643 A:0.26429 G:0.20429
position 3: T:0.21714 C:0.38286 A:0.10786 G:0.29214
Average T:0.22667 C:0.27476 A:0.20452 G:0.29405
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_zetaTry-PA
D_sechellia_zetaTry-PA 0.2252 (0.0342 0.1517)
D_simulans_zetaTry-PA 0.1230 (0.0193 0.1572) 0.4010 (0.0185 0.0462)
D_yakuba_zetaTry-PA 0.1912 (0.0520 0.2719) 0.2091 (0.0632 0.3022) 0.1649 (0.0503 0.3051)
D_erecta_zetaTry-PA 0.3486 (0.0965 0.2769) 0.3184 (0.1048 0.3290) 0.2924 (0.0939 0.3211) 0.3142 (0.0999 0.3178)
Model 0: one-ratio
TREE # 1: (1, (2, 3), (4, 5)); MP score: 177
check convergence..
lnL(ntime: 7 np: 9): -2074.965666 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.064974 0.073216 0.054882 0.023043 0.082380 0.175730 0.313433 1.840493 0.239668
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.78766
(1: 0.064974, (2: 0.054882, 3: 0.023043): 0.073216, (4: 0.175730, 5: 0.313433): 0.082380);
(D_melanogaster_zetaTry-PA: 0.064974, (D_sechellia_zetaTry-PA: 0.054882, D_simulans_zetaTry-PA: 0.023043): 0.073216, (D_yakuba_zetaTry-PA: 0.175730, D_erecta_zetaTry-PA: 0.313433): 0.082380);
Detailed output identifying parameters
kappa (ts/tv) = 1.84049
omega (dN/dS) = 0.23967
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.065 634.7 205.3 0.2397 0.0122 0.0509 7.7 10.4
6..7 0.073 634.7 205.3 0.2397 0.0137 0.0574 8.7 11.8
7..2 0.055 634.7 205.3 0.2397 0.0103 0.0430 6.5 8.8
7..3 0.023 634.7 205.3 0.2397 0.0043 0.0181 2.7 3.7
6..8 0.082 634.7 205.3 0.2397 0.0155 0.0645 9.8 13.2
8..4 0.176 634.7 205.3 0.2397 0.0330 0.1377 20.9 28.3
8..5 0.313 634.7 205.3 0.2397 0.0589 0.2456 37.4 50.4
tree length for dN: 0.1479
tree length for dS: 0.6171
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 177
lnL(ntime: 7 np: 10): -2070.187425 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.065732 0.074880 0.055746 0.023477 0.083744 0.182407 0.330570 1.904845 0.812976 0.113335
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.81656
(1: 0.065732, (2: 0.055746, 3: 0.023477): 0.074880, (4: 0.182407, 5: 0.330570): 0.083744);
(D_melanogaster_zetaTry-PA: 0.065732, (D_sechellia_zetaTry-PA: 0.055746, D_simulans_zetaTry-PA: 0.023477): 0.074880, (D_yakuba_zetaTry-PA: 0.182407, D_erecta_zetaTry-PA: 0.330570): 0.083744);
Detailed output identifying parameters
kappa (ts/tv) = 1.90484
dN/dS (w) for site classes (K=2)
p: 0.81298 0.18702
w: 0.11334 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.066 634.0 206.0 0.2792 0.0134 0.0481 8.5 9.9
6..7 0.075 634.0 206.0 0.2792 0.0153 0.0547 9.7 11.3
7..2 0.056 634.0 206.0 0.2792 0.0114 0.0408 7.2 8.4
7..3 0.023 634.0 206.0 0.2792 0.0048 0.0172 3.0 3.5
6..8 0.084 634.0 206.0 0.2792 0.0171 0.0612 10.8 12.6
8..4 0.182 634.0 206.0 0.2792 0.0372 0.1333 23.6 27.5
8..5 0.331 634.0 206.0 0.2792 0.0675 0.2417 42.8 49.8
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 177
lnL(ntime: 7 np: 12): -2070.187425 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.065732 0.074880 0.055746 0.023477 0.083745 0.182407 0.330570 1.904844 0.812976 0.112014 0.113335 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.81656
(1: 0.065732, (2: 0.055746, 3: 0.023477): 0.074880, (4: 0.182407, 5: 0.330570): 0.083745);
(D_melanogaster_zetaTry-PA: 0.065732, (D_sechellia_zetaTry-PA: 0.055746, D_simulans_zetaTry-PA: 0.023477): 0.074880, (D_yakuba_zetaTry-PA: 0.182407, D_erecta_zetaTry-PA: 0.330570): 0.083745);
Detailed output identifying parameters
kappa (ts/tv) = 1.90484
dN/dS (w) for site classes (K=3)
p: 0.81298 0.11201 0.07501
w: 0.11334 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.066 634.0 206.0 0.2792 0.0134 0.0481 8.5 9.9
6..7 0.075 634.0 206.0 0.2792 0.0153 0.0547 9.7 11.3
7..2 0.056 634.0 206.0 0.2792 0.0114 0.0408 7.2 8.4
7..3 0.023 634.0 206.0 0.2792 0.0048 0.0172 3.0 3.5
6..8 0.084 634.0 206.0 0.2792 0.0171 0.0612 10.8 12.6
8..4 0.182 634.0 206.0 0.2792 0.0372 0.1333 23.6 27.5
8..5 0.331 634.0 206.0 0.2792 0.0675 0.2417 42.8 49.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaTry-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.129 0.854 0.017 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.837 0.128 0.024 0.006 0.002 0.001 0.001 0.000 0.000 0.000
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.092
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.043 0.400
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.056 0.299 0.093
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 177
lnL(ntime: 7 np: 13): -2069.173888 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.065471 0.074148 0.055385 0.023305 0.081820 0.180372 0.325544 1.870620 0.500476 0.084118 0.000001 0.510189 0.510190
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.80604
(1: 0.065471, (2: 0.055385, 3: 0.023305): 0.074148, (4: 0.180372, 5: 0.325544): 0.081820);
(D_melanogaster_zetaTry-PA: 0.065471, (D_sechellia_zetaTry-PA: 0.055385, D_simulans_zetaTry-PA: 0.023305): 0.074148, (D_yakuba_zetaTry-PA: 0.180372, D_erecta_zetaTry-PA: 0.325544): 0.081820);
Detailed output identifying parameters
kappa (ts/tv) = 1.87062
dN/dS (w) for site classes (K=3)
p: 0.50048 0.08412 0.41541
w: 0.00000 0.51019 0.51019
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.065 634.4 205.6 0.2549 0.0127 0.0499 8.1 10.3
6..7 0.074 634.4 205.6 0.2549 0.0144 0.0565 9.1 11.6
7..2 0.055 634.4 205.6 0.2549 0.0108 0.0422 6.8 8.7
7..3 0.023 634.4 205.6 0.2549 0.0045 0.0178 2.9 3.7
6..8 0.082 634.4 205.6 0.2549 0.0159 0.0624 10.1 12.8
8..4 0.180 634.4 205.6 0.2549 0.0350 0.1375 22.2 28.3
8..5 0.326 634.4 205.6 0.2549 0.0632 0.2482 40.1 51.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 177
lnL(ntime: 7 np: 10): -2069.503200 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.065556 0.074402 0.055507 0.023358 0.082595 0.180998 0.327234 1.879805 0.350315 0.990521
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.80965
(1: 0.065556, (2: 0.055507, 3: 0.023358): 0.074402, (4: 0.180998, 5: 0.327234): 0.082595);
(D_melanogaster_zetaTry-PA: 0.065556, (D_sechellia_zetaTry-PA: 0.055507, D_simulans_zetaTry-PA: 0.023358): 0.074402, (D_yakuba_zetaTry-PA: 0.180998, D_erecta_zetaTry-PA: 0.327234): 0.082595);
Detailed output identifying parameters
kappa (ts/tv) = 1.87980
Parameters in M7 (beta):
p = 0.35032 q = 0.99052
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00020 0.00450 0.01936 0.05056 0.10357 0.18354 0.29542 0.44387 0.63321 0.86688
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.066 634.3 205.7 0.2601 0.0129 0.0495 8.2 10.2
6..7 0.074 634.3 205.7 0.2601 0.0146 0.0562 9.3 11.6
7..2 0.056 634.3 205.7 0.2601 0.0109 0.0419 6.9 8.6
7..3 0.023 634.3 205.7 0.2601 0.0046 0.0176 2.9 3.6
6..8 0.083 634.3 205.7 0.2601 0.0162 0.0624 10.3 12.8
8..4 0.181 634.3 205.7 0.2601 0.0356 0.1367 22.6 28.1
8..5 0.327 634.3 205.7 0.2601 0.0643 0.2472 40.8 50.9
Time used: 0:27
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 177
lnL(ntime: 7 np: 12): -2069.503212 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.065556 0.074402 0.055507 0.023358 0.082595 0.180998 0.327234 1.879806 0.999990 0.350321 0.990571 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.80965
(1: 0.065556, (2: 0.055507, 3: 0.023358): 0.074402, (4: 0.180998, 5: 0.327234): 0.082595);
(D_melanogaster_zetaTry-PA: 0.065556, (D_sechellia_zetaTry-PA: 0.055507, D_simulans_zetaTry-PA: 0.023358): 0.074402, (D_yakuba_zetaTry-PA: 0.180998, D_erecta_zetaTry-PA: 0.327234): 0.082595);
Detailed output identifying parameters
kappa (ts/tv) = 1.87981
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.35032 q = 0.99057
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00020 0.00450 0.01936 0.05056 0.10357 0.18354 0.29541 0.44386 0.63319 0.86686 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.066 634.3 205.7 0.2601 0.0129 0.0495 8.2 10.2
6..7 0.074 634.3 205.7 0.2601 0.0146 0.0562 9.3 11.6
7..2 0.056 634.3 205.7 0.2601 0.0109 0.0419 6.9 8.6
7..3 0.023 634.3 205.7 0.2601 0.0046 0.0176 2.9 3.6
6..8 0.083 634.3 205.7 0.2601 0.0162 0.0624 10.3 12.8
8..4 0.181 634.3 205.7 0.2601 0.0356 0.1367 22.6 28.1
8..5 0.327 634.3 205.7 0.2601 0.0643 0.2472 40.8 50.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaTry-PA)
Pr(w>1) post mean +- SE for w
126 Y 0.533 1.180 +- 0.561
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.037 0.963
p : 0.111 0.525 0.339 0.024 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.037 0.049 0.016 0.064 0.144 0.161 0.155 0.173 0.201
ws: 0.906 0.086 0.008 0.001 0.000 0.000 0.000 0.000 0.000 0.000
Time used: 0:49
Model 1: NearlyNeutral -2070.187425 Model 2: PositiveSelection -2070.187425 Model 0: one-ratio -2074.965666 Model 3: discrete -2069.173888 Model 7: beta -2069.5032 Model 8: beta&w>1 -2069.503212 Model 0 vs 1 9.55648199999996 Model 2 vs 1 0.0 Model 8 vs 7 2.3999999939405825E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
