--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Sat Dec 10 13:17:28 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/zetaTry-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2149.62         -2157.68
2      -2149.50         -2158.96
--------------------------------------
TOTAL    -2149.56         -2158.51
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.332629    0.001331    0.265708    0.406423    0.330473   1413.70   1415.11    1.000
r(A<->C){all}   0.116455    0.000890    0.059962    0.172551    0.113767   1019.30   1025.92    1.002
r(A<->G){all}   0.202088    0.001215    0.137262    0.268375    0.200087   1043.96   1054.78    1.000
r(A<->T){all}   0.165676    0.001315    0.102215    0.244226    0.163246    899.76    991.77    1.000
r(C<->G){all}   0.092578    0.000509    0.055038    0.142017    0.090472    971.28   1026.96    1.000
r(C<->T){all}   0.344030    0.002144    0.252694    0.433154    0.342322    718.68    848.12    1.000
r(G<->T){all}   0.079173    0.000590    0.032792    0.125980    0.077508   1077.38   1121.80    1.000
pi(A){all}      0.205542    0.000175    0.179199    0.231529    0.205372    848.86   1111.87    1.000
pi(C){all}      0.274095    0.000201    0.247518    0.302297    0.274018    921.84   1211.42    1.000
pi(G){all}      0.292202    0.000230    0.262069    0.320820    0.291795   1148.87   1200.40    1.000
pi(T){all}      0.228160    0.000182    0.202011    0.254947    0.228143   1216.92   1232.67    1.000
alpha{1,2}      0.253009    0.025288    0.000140    0.539667    0.224062   1279.28   1300.51    1.000
alpha{3}        1.493012    0.440208    0.477047    2.795138    1.365237   1331.86   1354.33    1.000
pinvar{all}     0.130870    0.009973    0.000050    0.323442    0.110139   1223.84   1224.03    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2070.187425
Model 2: PositiveSelection	-2070.187425
Model 0: one-ratio	-2074.965666
Model 3: discrete	-2069.173888
Model 7: beta	-2069.5032
Model 8: beta&w>1	-2069.503212


Model 0 vs 1	9.55648199999996

Model 2 vs 1	0.0

Model 8 vs 7	2.3999999939405825E-5
>C1
MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQV
PYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV
AGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFT
IKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQ
DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW
GNSCALPNYPGVYANVAYLRPWIDAVLAGLo
>C2
MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQV
PYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKVV
AGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNFT
IKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCDQ
DYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVSW
GNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C3
MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQV
PYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV
AGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFT
IKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQ
DYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVSW
GNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C4
MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQV
PYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKVV
AGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNFT
IKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCDQ
DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVSW
GNKCALPNYPGVYANVAYLRPWIDAVLAGLo
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=282 

C1              -MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
C2              -MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
C3              -MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
C4              -MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
C5              MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
                  ****:  ***.*.. ::*:***********:..*.*******.*****

C1              VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
C2              VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
C3              VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
C4              VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
C5              VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
                *****:****.*::*:**:********.*****:*****::******:**

C1              VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
C2              VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
C3              VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
C4              VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
C5              VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
                ***:*::*.:********.::*** * **********:************

C1              TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
C2              TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
C3              TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
C4              TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
C5              TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
                *****:** * *::*: **:****:* ..* :* **********.*:***

C1              QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
C2              QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
C3              QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
C4              QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
C5              LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
                 ***:* ****:********************.******.*** *:****

C1              WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
C2              WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
C3              WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
C4              WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
C5              WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-
                ***.************** ******** *** 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  281 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  281 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5688]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [5688]--->[5684]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/zetaTry-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.290 Mb, Max= 30.586 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
-MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
>C2
-MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C3
-MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C4
-MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-

FORMAT of file /tmp/tmp3373879098649502982aln Not Supported[FATAL:T-COFFEE]
>C1
-MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
WGNSCALPNYPGVYANVAYLRPWIDAVLAGLo
>C2
-MSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C3
-MSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGLo
>C4
-MSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNKCALPNYPGVYANVAYLRPWIDAVLAGLo
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL-
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:282 S:99 BS:282
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 92.88 C1	 C2	 92.88
TOP	    1    0	 92.88 C2	 C1	 92.88
BOT	    0    2	 96.09 C1	 C3	 96.09
TOP	    2    0	 96.09 C3	 C1	 96.09
BOT	    0    3	 90.39 C1	 C4	 90.39
TOP	    3    0	 90.39 C4	 C1	 90.39
BOT	    0    4	 84.29 C1	 C5	 84.29
TOP	    4    0	 84.29 C5	 C1	 84.29
BOT	    1    2	 96.09 C2	 C3	 96.09
TOP	    2    1	 96.09 C3	 C2	 96.09
BOT	    1    3	 88.26 C2	 C4	 88.26
TOP	    3    1	 88.26 C4	 C2	 88.26
BOT	    1    4	 82.14 C2	 C5	 82.14
TOP	    4    1	 82.14 C5	 C2	 82.14
BOT	    2    3	 90.75 C3	 C4	 90.75
TOP	    3    2	 90.75 C4	 C3	 90.75
BOT	    2    4	 84.29 C3	 C5	 84.29
TOP	    4    2	 84.29 C5	 C3	 84.29
BOT	    3    4	 82.86 C4	 C5	 82.86
TOP	    4    3	 82.86 C5	 C4	 82.86
AVG	 0	 C1	  *	 90.91
AVG	 1	 C2	  *	 89.84
AVG	 2	 C3	  *	 91.80
AVG	 3	 C4	  *	 88.06
AVG	 4	 C5	  *	 83.39
TOT	 TOT	  *	 88.80
CLUSTAL W (1.83) multiple sequence alignment

C1              ---ATGTCGAGCTCTTGGATAGTTGGCCTCTTGGCCTTTCTCGTCAGCTT
C2              ---ATGTCGAGCTCTTGGCTGGTTTGCCTCTTGGCCTTTCTCGTCAGTTT
C3              ---ATGTCGAGCTCTTGGCTGGTTTGCCTATTGGCCTTTCTCGTCAGTTT
C4              ---ATGTCGAGCTCTTGGCTGGTCTGCCTTTTGGCTCTTCTCGTCGGCGT
C5              ATGTCGAGCTCTTCTTGGCTGGGTTGCCTCCTGGCCGTTCTATTCAGCGC
                   : *:  :  ******.*.*   ****  ****  ****. **.*   

C1              GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
C2              GGTGACCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
C3              GGTGGCCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
C4              GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
C5              CTTGGCCTTGAGCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAACA
                  **.******  *********************** *********** *

C1              GCGTTCCGGATGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
C2              ACGTTCCGGGAGGTCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
C3              GCGTTCCGGGAGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
C4              GCGTTCCGGGCGGGCGCATTGTGGGTGGCTATGTGACGGACATAGCGCAG
C5              GCTTTCCGGATGGCCGCATTGTGGGTGGCTACGTGACGGACATAGCGCAG
                .* ******. ** ***************** * ****************

C1              GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCACCACGCCGGAGAA
C2              GTCCCGTACCAGATTTCCCTGCGCTACAAGGCTATCAGCACGCCGCAGAA
C3              GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCAGCACGCCGGAGAA
C4              GTACCGTACCAGATTTCGCTGCGCTACAAGGGTATCACCACGCCGGAGAA
C5              GTCCCATACCAGATTACCCTGCGCTACAAGGCCATCAGCTCGCCGGAGAA
                **.**.*********:* *************  **** *:***** ****

C1              TCCCTTTCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACTACAATAG
C2              TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
C3              TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
C4              TCCCTATAGACACCGTTGCGGAGGATCCATTTTCAATGAAACCACAATAG
C5              TCCCTTTCGGCATCGGTGCGGAGGATCCATTGTCAATGAGACTACAATAC
                *****:*.* ** ** *************** *******.** ****** 

C1              TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCAAGTCAATATAAAGTG
C2              TGACAGCGGCGCACTGCGTCGTAGGAACGGTGGCCAGTCAATATAAGGTC
C3              TGACAGCGGCGCACTGCGTCATCGGAACGGTGGCCAGTCAATATAAGGTT
C4              TGACAGCGGCGCACTGCATCATCGGCACGGTGGCTAGTCAATTCAAGGTG
C5              TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCTAGTCAGTTCAAGGTG
                *****************.**.*.**.******** *****.*: **.** 

C1              GTGGCCGGGACAAATTTCCAAACCGGCTCCGATGGCGTTATCACCAATGT
C2              GTGGCCGGAACAAATTTCCAAACCAGCTCCGATGGCGTTATCACCAATGT
C3              GTGGCCGGGACCAATTTCCAAACCGGATCCGATGGCGTTATCACCAATGT
C4              GTGGCCGGGTCAAACTGGCGAACAGGCTCCGATGGCGTCATCACCAATGT
C5              GTGGCCGGTACCAATTTCCAAACAGGCACCGATGGCGTCATCACCAATGT
                ******** :*.** *  *.***..*.:********** ***********

C1              CAAGGAGATCGTTATGCACGAAGGGTATTACTCGGGAGCTGCCTACAACA
C2              CAAGCAGATCGTTATGCACGAAGGGTACGACTCGGGAGCTGCCTACAACA
C3              CAAGCAGATCGTTATGCACGAAGGTTACTACTCGGGAGCTGCCTACAACA
C4              CAAGCAGATCGTTATGCATGAGGAGTACTTCTCGGGAGCTGCCTACAACA
C5              CAAGCGGGTCATCATGCACGAGGGATACAACTCGGGAGCAGCCTACAATA
                **** .*.**.* ***** **.*. **  :*********:******** *

C1              ACGATATTGCCATTCTATTTGTGGATCCCCCATTGCCGCTCAACAACTTC
C2              ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
C3              ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
C4              ATGATATCGCCATTCTATTCGTGGATCCCCCATTGCCACTCAATAACTTC
C5              ACGATATTGCCGTTCTATTTGTGGATCCCCCATTGCCCCTGAACAACTTC
                * ** ** ***.****.** ******** ******** ** ** ******

C1              ACCATCAAGGCCATTAAGCTGGCCTTGGAACAACCAATTGAGGGAACGGT
C2              ACCATCAAGGCCATTAAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
C3              ACCATCAAGGCCATTCAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
C4              ACCATCAAGGCCATTAAGCTGGCTTCGGAGCCACCACTTGAGGGAACGGT
C5              ACCATCAAGGCCATTAAGCTGGCTACGGAGCCACCACTTGATGGAGCGCC
                ***************.******* : ***.*.****.**** ***.**  

C1              CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
C2              CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACACCTCGT
C3              CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
C4              CAGCAAGATCAGCGGATGGGGAACCACTTCTTCCGCTGGCTCCGCCTCGA
C5              CAGCAAGATCAGCGGATGGGGCTCCACTTATCCCGGCGGCTACTCCTCCA
                *******.*************.:******.* ***  ****.* **** :

C1              ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTTTGTGAT
C2              ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
C3              ACCAACTGCTTGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
C4              ATCAACTACTCGCGGTAGATGTGCCGATTGTGAGCAACGAGTTGTGTGAC
C5              ACCAACTTCTCGCGGTGGATGTCCCGATTGTGGGCAACGACTTGTGTGAC
                * ***** ** ***** ***** *********.*******  * ***** 

C1              CAGGACTACGAGGATTTTGGCGACGAGACCTACCGCATTACATCGGCCAT
C2              CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
C3              CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
C4              CAGGACTACGAGGACTTCGGCGATGAGACCTACCGCATCACATCGGCCAT
C5              CTGGACTACGAGAACTTCATCGATGAGACCTACCACATCACATCCGCCAT
                *:**********.* ** . *** **********.*** ***** *****

C1              GTTGTGTGCCGGCAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGAG
C2              GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGCTG
C3              GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGTG
C4              GTTGTGTGCCGGCAAACGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
C5              GTTGTGTGCCGGCAAGCGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
                ************ **.*********** ******************* :*

C1              ATTCCGGAGGACCGTTGGCGGTGCGCGATGAACTCTATGGAGTCGTGTCC
C2              ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
C3              ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
C4              ATTCCGGTGGGCCGTTGGTGGTGCGCGATGAGCTCCATGGAGTCGTGTCC
C5              ATTCCGGCGGACCGTTGGTGGTGCGCGACGAGCTCCATGGAGTCGTGTCC
                ******* **.******* ********* *:.*** ************* 

C1              TGGGGCAACAGTTGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C2              TGGGGTAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C3              TGGGGCAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C4              TGGGGCAACAAATGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
C5              TGGGGCAACAGTTGCGCCCTGCCCAATTATCCCGGCGTCTACGCCAATGT
                ***** ****.:** **.*********************** ********

C1              GGCGTACCTGAGGCCTTGGATCGATGCCGTTTTGGCAGGGCTC---
C2              GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
C3              GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
C4              GGCTTACCTGAGACCCTGGATCGATGCTGTTCTGGCGGGGCTC---
C5              GGCGTTCCTGAGGCCCTGGATCGATGCCGTTCGGGCAGGTCTC---
                *** ::******.** *********** ***  ***.** ***   



>C1
---ATGTCGAGCTCTTGGATAGTTGGCCTCTTGGCCTTTCTCGTCAGCTT
GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
GCGTTCCGGATGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCACCACGCCGGAGAA
TCCCTTTCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACTACAATAG
TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCAAGTCAATATAAAGTG
GTGGCCGGGACAAATTTCCAAACCGGCTCCGATGGCGTTATCACCAATGT
CAAGGAGATCGTTATGCACGAAGGGTATTACTCGGGAGCTGCCTACAACA
ACGATATTGCCATTCTATTTGTGGATCCCCCATTGCCGCTCAACAACTTC
ACCATCAAGGCCATTAAGCTGGCCTTGGAACAACCAATTGAGGGAACGGT
CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTTTGTGAT
CAGGACTACGAGGATTTTGGCGACGAGACCTACCGCATTACATCGGCCAT
GTTGTGTGCCGGCAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGAG
ATTCCGGAGGACCGTTGGCGGTGCGCGATGAACTCTATGGAGTCGTGTCC
TGGGGCAACAGTTGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCGTACCTGAGGCCTTGGATCGATGCCGTTTTGGCAGGGCTC---
>C2
---ATGTCGAGCTCTTGGCTGGTTTGCCTCTTGGCCTTTCTCGTCAGTTT
GGTGACCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
ACGTTCCGGGAGGTCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
GTCCCGTACCAGATTTCCCTGCGCTACAAGGCTATCAGCACGCCGCAGAA
TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
TGACAGCGGCGCACTGCGTCGTAGGAACGGTGGCCAGTCAATATAAGGTC
GTGGCCGGAACAAATTTCCAAACCAGCTCCGATGGCGTTATCACCAATGT
CAAGCAGATCGTTATGCACGAAGGGTACGACTCGGGAGCTGCCTACAACA
ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
ACCATCAAGGCCATTAAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACACCTCGT
ACCAACTGCTCGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGCTG
ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
TGGGGTAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
>C3
---ATGTCGAGCTCTTGGCTGGTTTGCCTATTGGCCTTTCTCGTCAGTTT
GGTGGCCTTGACTCAAGGTCTTCCCCTTCTGGAGGACCTGGATGAGAAGA
GCGTTCCGGGAGGCCGCATTGTGGGTGGCTATGCGACGGACATAGCGCAG
GTCCCGTACCAGATTTCCCTGCGCTACAAGGGTATCAGCACGCCGGAGAA
TCCCTATCGCCATCGTTGCGGAGGATCCATTTTCAATGAGACCACAATAG
TGACAGCGGCGCACTGCGTCATCGGAACGGTGGCCAGTCAATATAAGGTT
GTGGCCGGGACCAATTTCCAAACCGGATCCGATGGCGTTATCACCAATGT
CAAGCAGATCGTTATGCACGAAGGTTACTACTCGGGAGCTGCCTACAACA
ACGACATTGCCATTCTGTTTGTGGATCCTCCATTGCCGCTCAACAACTTC
ACCATCAAGGCCATTCAGCTGGCCTCGGAACAACCAATTGAGGGAACGGT
CAGCAAGGTCAGCGGATGGGGAACCACTTCTCCCGGCGGCTACTCCTCGA
ACCAACTGCTTGCGGTCGATGTCCCGATTGTGAGCAACGAGCTCTGTGAC
CAGGACTACGAGGACTTCGGCGACGAGACCTACCACATCACATCGGCCAT
GTTGTGTGCCGGGAAACGGGGTGTCGGTGGTGCGGATGCCTGCCAGGGTG
ATTCCGGAGGACCGTTGGCGGTGCGCGATGTGCTCTATGGAGTCGTGTCT
TGGGGCAACAGTTGCGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCGAACCTGAGGCCTTGGATCGATGCCGTTCTGGCGGGGCTC---
>C4
---ATGTCGAGCTCTTGGCTGGTCTGCCTTTTGGCTCTTCTCGTCGGCGT
GGTGGCCTTGACCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAAGA
GCGTTCCGGGCGGGCGCATTGTGGGTGGCTATGTGACGGACATAGCGCAG
GTACCGTACCAGATTTCGCTGCGCTACAAGGGTATCACCACGCCGGAGAA
TCCCTATAGACACCGTTGCGGAGGATCCATTTTCAATGAAACCACAATAG
TGACAGCGGCGCACTGCATCATCGGCACGGTGGCTAGTCAATTCAAGGTG
GTGGCCGGGTCAAACTGGCGAACAGGCTCCGATGGCGTCATCACCAATGT
CAAGCAGATCGTTATGCATGAGGAGTACTTCTCGGGAGCTGCCTACAACA
ATGATATCGCCATTCTATTCGTGGATCCCCCATTGCCACTCAATAACTTC
ACCATCAAGGCCATTAAGCTGGCTTCGGAGCCACCACTTGAGGGAACGGT
CAGCAAGATCAGCGGATGGGGAACCACTTCTTCCGCTGGCTCCGCCTCGA
ATCAACTACTCGCGGTAGATGTGCCGATTGTGAGCAACGAGTTGTGTGAC
CAGGACTACGAGGACTTCGGCGATGAGACCTACCGCATCACATCGGCCAT
GTTGTGTGCCGGCAAACGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
ATTCCGGTGGGCCGTTGGTGGTGCGCGATGAGCTCCATGGAGTCGTGTCC
TGGGGCAACAAATGTGCACTGCCCAATTATCCCGGCGTCTATGCCAATGT
GGCTTACCTGAGACCCTGGATCGATGCTGTTCTGGCGGGGCTC---
>C5
ATGTCGAGCTCTTCTTGGCTGGGTTGCCTCCTGGCCGTTCTATTCAGCGC
CTTGGCCTTGAGCCAAGGTCTTCCCCTTCTGGAGGATCTGGATGAGAACA
GCTTTCCGGATGGCCGCATTGTGGGTGGCTACGTGACGGACATAGCGCAG
GTCCCATACCAGATTACCCTGCGCTACAAGGCCATCAGCTCGCCGGAGAA
TCCCTTTCGGCATCGGTGCGGAGGATCCATTGTCAATGAGACTACAATAC
TGACAGCGGCGCACTGCGTCATCGGCACGGTGGCTAGTCAGTTCAAGGTG
GTGGCCGGTACCAATTTCCAAACAGGCACCGATGGCGTCATCACCAATGT
CAAGCGGGTCATCATGCACGAGGGATACAACTCGGGAGCAGCCTACAATA
ACGATATTGCCGTTCTATTTGTGGATCCCCCATTGCCCCTGAACAACTTC
ACCATCAAGGCCATTAAGCTGGCTACGGAGCCACCACTTGATGGAGCGCC
CAGCAAGATCAGCGGATGGGGCTCCACTTATCCCGGCGGCTACTCCTCCA
ACCAACTTCTCGCGGTGGATGTCCCGATTGTGGGCAACGACTTGTGTGAC
CTGGACTACGAGAACTTCATCGATGAGACCTACCACATCACATCCGCCAT
GTTGTGTGCCGGCAAGCGGGGTGTCGGCGGTGCGGATGCCTGCCAGGGAG
ATTCCGGCGGACCGTTGGTGGTGCGCGACGAGCTCCATGGAGTCGTGTCC
TGGGGCAACAGTTGCGCCCTGCCCAATTATCCCGGCGTCTACGCCAATGT
GGCGTTCCTGAGGCCCTGGATCGATGCCGTTCGGGCAGGTCTC---
>C1
oMSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQ
VPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS
WGNSCALPNYPGVYANVAYLRPWIDAVLAGL
>C2
oMSSSWLVCLLAFLVSLVTLTQGLPLLEDLDEKNVPGGRIVGGYATDIAQ
VPYQISLRYKAISTPQNPYRHRCGGSIFNETTIVTAAHCVVGTVASQYKV
VAGTNFQTSSDGVITNVKQIVMHEGYDSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEQPIEGTVSKVSGWGTTSPGGYTSYQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQADSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGL
>C3
oMSSSWLVCLLAFLVSLVALTQGLPLLEDLDEKSVPGGRIVGGYATDIAQ
VPYQISLRYKGISTPENPYRHRCGGSIFNETTIVTAAHCVIGTVASQYKV
VAGTNFQTGSDGVITNVKQIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF
TIKAIQLASEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD
QDYEDFGDETYHITSAMLCAGKRGVGGADACQGDSGGPLAVRDVLYGVVS
WGNSCALPNYPGVYANVANLRPWIDAVLAGL
>C4
oMSSSWLVCLLALLVGVVALTQGLPLLEDLDEKSVPGGRIVGGYVTDIAQ
VPYQISLRYKGITTPENPYRHRCGGSIFNETTIVTAAHCIIGTVASQFKV
VAGSNWRTGSDGVITNVKQIVMHEEYFSGAAYNNDIAILFVDPPLPLNNF
TIKAIKLASEPPLEGTVSKISGWGTTSSAGSASNQLLAVDVPIVSNELCD
QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNKCALPNYPGVYANVAYLRPWIDAVLAGL
>C5
MSSSSWLGCLLAVLFSALALSQGLPLLEDLDENSFPDGRIVGGYVTDIAQ
VPYQITLRYKAISSPENPFRHRCGGSIVNETTILTAAHCVIGTVASQFKV
VAGTNFQTGTDGVITNVKRVIMHEGYNSGAAYNNDIAVLFVDPPLPLNNF
TIKAIKLATEPPLDGAPSKISGWGSTYPGGYSSNQLLAVDVPIVGNDLCD
LDYENFIDETYHITSAMLCAGKRGVGGADACQGDSGGPLVVRDELHGVVS
WGNSCALPNYPGVYANVAFLRPWIDAVRAGL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 846 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481375613
      Setting output file names to "/opt/ADOPS/443/zetaTry-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1305873983
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 7533981066
      Seed = 1677725866
      Swapseed = 1481375613
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 37 unique site patterns
      Division 2 has 32 unique site patterns
      Division 3 has 57 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2418.560719 -- -25.624409
         Chain 2 -- -2478.706439 -- -25.624409
         Chain 3 -- -2487.017828 -- -25.624409
         Chain 4 -- -2473.006779 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2471.853347 -- -25.624409
         Chain 2 -- -2421.902147 -- -25.624409
         Chain 3 -- -2418.560719 -- -25.624409
         Chain 4 -- -2471.014327 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2418.561] (-2478.706) (-2487.018) (-2473.007) * [-2471.853] (-2421.902) (-2418.561) (-2471.014) 
        500 -- (-2173.077) (-2157.355) (-2166.930) [-2155.580] * (-2179.258) (-2167.720) [-2164.522] (-2164.760) -- 0:00:00
       1000 -- (-2170.225) [-2162.881] (-2161.255) (-2155.589) * (-2171.344) (-2172.170) (-2157.714) [-2156.960] -- 0:00:00
       1500 -- (-2163.150) (-2151.918) [-2156.227] (-2155.442) * [-2153.430] (-2169.084) (-2157.589) (-2159.570) -- 0:00:00
       2000 -- (-2158.914) (-2153.713) (-2161.570) [-2147.982] * [-2152.404] (-2165.341) (-2159.110) (-2152.297) -- 0:00:00
       2500 -- [-2154.665] (-2153.511) (-2155.275) (-2150.578) * (-2149.778) (-2162.052) [-2152.565] (-2153.139) -- 0:06:39
       3000 -- (-2152.375) (-2162.857) (-2155.960) [-2152.434] * (-2150.245) (-2155.089) [-2157.521] (-2155.753) -- 0:05:32
       3500 -- (-2151.835) (-2150.478) (-2149.687) [-2155.397] * (-2152.296) (-2153.880) (-2158.694) [-2151.097] -- 0:04:44
       4000 -- (-2152.424) (-2150.422) (-2152.988) [-2154.762] * (-2155.066) [-2153.005] (-2156.039) (-2151.433) -- 0:04:09
       4500 -- (-2158.277) (-2154.094) [-2151.646] (-2155.753) * (-2149.109) (-2150.354) (-2154.843) [-2149.518] -- 0:03:41
       5000 -- [-2150.096] (-2151.066) (-2150.606) (-2155.948) * [-2148.070] (-2152.490) (-2158.667) (-2150.882) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-2151.215] (-2149.625) (-2151.765) (-2158.245) * [-2152.190] (-2155.372) (-2156.513) (-2151.716) -- 0:03:00
       6000 -- (-2150.621) (-2158.515) (-2156.222) [-2153.845] * [-2152.244] (-2152.816) (-2151.835) (-2151.968) -- 0:02:45
       6500 -- [-2154.540] (-2156.637) (-2153.538) (-2158.562) * (-2149.182) [-2154.766] (-2151.271) (-2153.007) -- 0:02:32
       7000 -- (-2155.355) (-2158.870) (-2152.588) [-2154.870] * [-2152.579] (-2152.733) (-2151.601) (-2152.962) -- 0:02:21
       7500 -- (-2158.471) (-2153.994) [-2149.078] (-2151.088) * (-2149.958) (-2157.115) (-2159.931) [-2149.484] -- 0:04:24
       8000 -- (-2156.502) (-2155.925) [-2147.446] (-2153.065) * [-2148.381] (-2153.873) (-2152.845) (-2156.038) -- 0:04:08
       8500 -- (-2154.733) [-2152.594] (-2150.110) (-2148.153) * [-2147.804] (-2154.067) (-2157.716) (-2154.777) -- 0:03:53
       9000 -- (-2153.099) [-2153.403] (-2147.311) (-2153.285) * (-2148.187) [-2150.554] (-2150.461) (-2151.327) -- 0:03:40
       9500 -- (-2153.638) (-2151.615) [-2153.723] (-2151.260) * (-2148.254) (-2155.032) [-2151.544] (-2153.132) -- 0:03:28
      10000 -- (-2150.165) (-2159.893) [-2152.431] (-2150.197) * (-2151.076) [-2149.255] (-2151.999) (-2155.009) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-2155.928) (-2150.058) [-2153.839] (-2156.751) * [-2150.700] (-2149.395) (-2152.665) (-2151.680) -- 0:03:08
      11000 -- [-2153.016] (-2153.818) (-2157.816) (-2151.038) * [-2149.968] (-2148.999) (-2158.770) (-2152.526) -- 0:02:59
      11500 -- (-2153.598) (-2151.518) [-2150.776] (-2151.413) * (-2146.285) [-2151.463] (-2151.858) (-2153.318) -- 0:02:51
      12000 -- (-2150.917) [-2147.084] (-2155.122) (-2154.480) * [-2150.944] (-2152.702) (-2151.369) (-2152.324) -- 0:02:44
      12500 -- [-2152.551] (-2156.157) (-2155.397) (-2152.937) * [-2154.110] (-2158.406) (-2152.212) (-2153.349) -- 0:02:38
      13000 -- [-2148.654] (-2148.454) (-2152.337) (-2153.327) * (-2155.490) (-2152.291) [-2147.829] (-2152.426) -- 0:03:47
      13500 -- (-2150.118) (-2156.529) [-2149.930] (-2147.423) * (-2159.599) [-2154.347] (-2153.449) (-2154.457) -- 0:03:39
      14000 -- (-2156.609) [-2148.052] (-2152.074) (-2154.591) * (-2156.154) (-2151.733) [-2157.392] (-2153.245) -- 0:03:31
      14500 -- (-2150.829) (-2150.983) (-2152.018) [-2152.239] * (-2159.210) (-2152.124) (-2148.280) [-2150.087] -- 0:03:23
      15000 -- (-2152.629) (-2151.005) [-2152.908] (-2153.471) * (-2161.855) (-2150.327) (-2156.487) [-2148.890] -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-2148.022) (-2152.438) (-2153.638) [-2149.803] * (-2156.097) (-2159.930) (-2157.314) [-2150.960] -- 0:03:10
      16000 -- [-2150.448] (-2161.827) (-2161.166) (-2154.029) * (-2158.378) (-2159.258) [-2152.787] (-2155.206) -- 0:03:04
      16500 -- (-2151.677) (-2156.828) [-2153.003] (-2153.040) * [-2149.276] (-2168.753) (-2157.557) (-2148.856) -- 0:02:58
      17000 -- (-2153.787) (-2150.181) [-2152.425] (-2151.803) * (-2151.180) (-2159.638) (-2150.730) [-2152.531] -- 0:02:53
      17500 -- (-2151.887) (-2158.518) [-2152.245] (-2153.949) * (-2148.922) (-2152.694) (-2147.888) [-2150.799] -- 0:02:48
      18000 -- (-2153.406) [-2154.299] (-2147.393) (-2150.115) * [-2149.041] (-2157.183) (-2153.682) (-2151.003) -- 0:02:43
      18500 -- (-2158.139) (-2149.825) [-2148.729] (-2151.948) * [-2154.020] (-2150.658) (-2157.870) (-2152.161) -- 0:03:32
      19000 -- (-2152.523) (-2150.723) (-2156.306) [-2151.298] * (-2154.818) (-2154.683) (-2158.429) [-2151.545] -- 0:03:26
      19500 -- (-2151.109) (-2150.757) (-2158.687) [-2151.362] * (-2151.271) [-2153.260] (-2155.617) (-2149.698) -- 0:03:21
      20000 -- [-2149.709] (-2156.771) (-2152.519) (-2152.430) * (-2149.358) (-2158.419) [-2150.006] (-2151.592) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-2147.937) (-2151.800) (-2162.302) [-2155.569] * [-2147.725] (-2155.371) (-2154.284) (-2156.567) -- 0:03:11
      21000 -- (-2152.309) (-2152.618) (-2149.680) [-2152.245] * (-2148.572) [-2153.133] (-2155.589) (-2163.350) -- 0:03:06
      21500 -- [-2153.197] (-2156.266) (-2146.767) (-2153.718) * (-2150.591) (-2152.364) [-2153.766] (-2160.816) -- 0:03:02
      22000 -- (-2156.598) [-2148.707] (-2158.390) (-2151.340) * (-2155.812) (-2152.622) (-2152.661) [-2155.921] -- 0:02:57
      22500 -- (-2157.000) (-2151.742) (-2152.987) [-2154.430] * (-2152.956) (-2154.100) (-2164.131) [-2151.099] -- 0:02:53
      23000 -- (-2156.269) (-2151.056) [-2154.158] (-2153.186) * (-2150.481) (-2150.553) [-2155.651] (-2153.623) -- 0:02:49
      23500 -- (-2157.565) (-2151.709) (-2156.581) [-2151.531] * (-2150.344) [-2152.469] (-2148.921) (-2151.888) -- 0:02:46
      24000 -- (-2163.358) (-2149.880) [-2152.335] (-2148.686) * [-2151.071] (-2153.787) (-2152.741) (-2154.583) -- 0:03:23
      24500 -- (-2154.970) (-2150.451) [-2152.663] (-2146.496) * (-2150.464) (-2161.408) [-2153.620] (-2153.554) -- 0:03:19
      25000 -- (-2151.554) (-2150.936) (-2151.670) [-2148.403] * [-2147.855] (-2161.201) (-2160.077) (-2152.128) -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-2152.048) [-2151.301] (-2149.572) (-2152.216) * (-2153.018) (-2154.587) [-2153.323] (-2150.418) -- 0:03:11
      26000 -- (-2151.562) (-2153.756) (-2152.437) [-2151.872] * [-2150.478] (-2160.861) (-2152.867) (-2154.618) -- 0:03:07
      26500 -- (-2148.784) [-2155.255] (-2148.454) (-2154.736) * [-2150.605] (-2161.268) (-2156.206) (-2157.695) -- 0:03:03
      27000 -- (-2148.277) [-2148.902] (-2151.653) (-2152.537) * (-2152.909) (-2157.898) [-2147.192] (-2159.822) -- 0:03:00
      27500 -- [-2149.964] (-2149.043) (-2153.869) (-2152.891) * (-2155.818) [-2161.497] (-2155.231) (-2152.731) -- 0:02:56
      28000 -- [-2151.056] (-2152.951) (-2158.965) (-2154.852) * [-2152.019] (-2151.092) (-2155.267) (-2152.488) -- 0:02:53
      28500 -- (-2157.677) (-2148.353) (-2158.167) [-2151.581] * (-2148.891) [-2149.240] (-2159.717) (-2155.440) -- 0:02:50
      29000 -- (-2150.367) [-2151.397] (-2154.800) (-2155.594) * (-2152.675) (-2150.912) [-2154.163] (-2158.866) -- 0:03:20
      29500 -- (-2151.660) (-2153.638) [-2159.874] (-2152.966) * [-2153.912] (-2153.242) (-2154.029) (-2151.344) -- 0:03:17
      30000 -- (-2146.823) (-2151.376) (-2155.978) [-2151.781] * [-2152.924] (-2155.265) (-2156.690) (-2153.352) -- 0:03:14

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-2149.668) (-2159.607) (-2153.084) [-2151.478] * (-2153.434) (-2153.102) [-2152.985] (-2152.005) -- 0:03:10
      31000 -- (-2152.292) (-2153.195) (-2153.922) [-2147.653] * (-2151.688) (-2155.845) [-2151.364] (-2155.674) -- 0:03:07
      31500 -- (-2147.788) (-2153.825) (-2149.569) [-2154.211] * (-2150.376) (-2154.515) (-2152.315) [-2147.014] -- 0:03:04
      32000 -- [-2153.354] (-2153.415) (-2160.659) (-2155.705) * (-2156.746) (-2152.524) (-2151.264) [-2147.919] -- 0:03:01
      32500 -- (-2155.651) (-2156.032) (-2154.096) [-2158.683] * (-2164.980) (-2157.383) [-2152.078] (-2148.758) -- 0:02:58
      33000 -- [-2150.146] (-2155.688) (-2149.502) (-2153.410) * (-2159.223) (-2158.706) (-2153.071) [-2152.247] -- 0:02:55
      33500 -- [-2154.233] (-2155.050) (-2151.781) (-2157.386) * (-2151.269) (-2151.507) (-2149.826) [-2151.356] -- 0:02:53
      34000 -- [-2148.442] (-2155.422) (-2157.206) (-2154.098) * [-2152.491] (-2148.904) (-2159.034) (-2150.297) -- 0:02:50
      34500 -- [-2150.046] (-2158.026) (-2151.360) (-2152.049) * (-2152.977) [-2148.712] (-2153.576) (-2150.179) -- 0:03:15
      35000 -- (-2152.690) [-2155.132] (-2155.995) (-2153.492) * (-2155.059) (-2152.594) [-2149.070] (-2150.935) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-2153.598) (-2150.446) (-2153.105) [-2154.749] * (-2153.484) [-2149.372] (-2151.770) (-2151.144) -- 0:03:10
      36000 -- (-2153.549) [-2150.642] (-2154.251) (-2154.994) * (-2154.330) (-2148.802) [-2149.942] (-2148.957) -- 0:03:07
      36500 -- (-2152.728) (-2160.679) (-2155.741) [-2154.506] * (-2154.725) (-2152.334) [-2152.126] (-2153.562) -- 0:03:04
      37000 -- (-2155.324) (-2154.873) (-2154.784) [-2156.869] * (-2153.027) [-2153.646] (-2160.063) (-2154.643) -- 0:03:02
      37500 -- (-2154.425) (-2156.580) (-2154.548) [-2152.070] * (-2152.465) (-2149.561) (-2156.155) [-2150.251] -- 0:02:59
      38000 -- (-2148.251) [-2152.000] (-2149.800) (-2152.672) * (-2154.846) (-2151.319) (-2152.239) [-2149.999] -- 0:02:57
      38500 -- (-2149.744) [-2152.284] (-2157.253) (-2148.037) * (-2149.218) (-2149.561) [-2152.147] (-2153.530) -- 0:02:54
      39000 -- [-2148.462] (-2157.824) (-2154.166) (-2153.973) * (-2154.922) (-2158.298) (-2152.671) [-2152.646] -- 0:02:52
      39500 -- [-2153.262] (-2157.814) (-2159.595) (-2153.000) * (-2157.278) (-2155.290) [-2155.531] (-2152.114) -- 0:02:50
      40000 -- [-2150.863] (-2153.674) (-2151.850) (-2152.268) * (-2149.712) (-2152.403) [-2149.527] (-2150.666) -- 0:03:12

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-2150.353) (-2154.948) (-2152.895) [-2151.726] * (-2155.590) (-2151.296) (-2155.220) [-2151.929] -- 0:03:09
      41000 -- (-2154.701) (-2154.807) [-2152.808] (-2152.322) * (-2152.421) [-2151.909] (-2158.388) (-2152.200) -- 0:03:07
      41500 -- (-2153.181) (-2156.864) [-2149.141] (-2155.042) * (-2154.565) (-2152.885) (-2156.464) [-2150.150] -- 0:03:04
      42000 -- (-2149.751) [-2151.996] (-2152.972) (-2159.822) * (-2147.889) (-2160.252) (-2158.775) [-2152.089] -- 0:03:02
      42500 -- (-2152.371) (-2151.459) (-2154.850) [-2152.847] * (-2149.235) (-2154.710) (-2169.169) [-2152.518] -- 0:03:00
      43000 -- (-2153.910) [-2155.395] (-2149.441) (-2154.573) * (-2152.256) (-2148.647) [-2149.114] (-2149.758) -- 0:02:58
      43500 -- (-2152.865) (-2153.307) [-2151.650] (-2154.279) * (-2152.311) (-2150.318) [-2150.134] (-2154.161) -- 0:02:55
      44000 -- (-2159.415) [-2149.961] (-2153.717) (-2157.969) * (-2149.865) (-2152.446) [-2150.164] (-2155.542) -- 0:02:53
      44500 -- (-2160.604) [-2148.587] (-2153.343) (-2152.479) * (-2152.395) (-2151.288) (-2153.695) [-2151.335] -- 0:02:51
      45000 -- (-2154.067) (-2151.537) (-2150.692) [-2152.798] * [-2149.660] (-2154.094) (-2148.064) (-2152.329) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-2154.695) (-2150.119) [-2145.539] (-2154.682) * (-2152.097) (-2152.204) (-2150.950) [-2148.005] -- 0:03:08
      46000 -- [-2155.608] (-2159.051) (-2148.263) (-2150.284) * (-2148.312) (-2160.237) (-2154.322) [-2154.205] -- 0:03:06
      46500 -- (-2152.460) (-2152.496) [-2154.362] (-2147.293) * [-2155.966] (-2158.118) (-2152.432) (-2154.603) -- 0:03:04
      47000 -- (-2148.533) (-2156.125) (-2160.260) [-2152.434] * (-2155.172) (-2149.729) [-2149.936] (-2155.362) -- 0:03:02
      47500 -- [-2153.284] (-2157.451) (-2158.070) (-2149.671) * [-2155.564] (-2157.855) (-2152.134) (-2158.653) -- 0:03:00
      48000 -- (-2155.344) [-2150.856] (-2149.109) (-2154.543) * [-2152.373] (-2159.081) (-2151.662) (-2159.058) -- 0:02:58
      48500 -- (-2155.827) (-2153.272) [-2153.349] (-2154.766) * (-2152.026) [-2161.294] (-2151.921) (-2162.874) -- 0:02:56
      49000 -- (-2157.299) (-2152.068) [-2148.349] (-2154.840) * [-2153.784] (-2160.494) (-2154.507) (-2156.805) -- 0:02:54
      49500 -- (-2151.089) (-2149.486) (-2151.270) [-2150.257] * (-2157.151) (-2153.335) [-2150.813] (-2151.307) -- 0:02:52
      50000 -- (-2157.489) [-2149.798] (-2151.761) (-2148.972) * (-2154.077) (-2154.154) (-2156.046) [-2149.234] -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-2148.523) (-2152.411) [-2150.242] (-2149.975) * (-2156.368) (-2148.557) (-2154.129) [-2152.622] -- 0:02:49
      51000 -- [-2148.366] (-2157.170) (-2154.846) (-2157.639) * (-2151.633) (-2152.843) (-2154.076) [-2147.780] -- 0:03:06
      51500 -- (-2155.167) (-2156.697) (-2160.933) [-2153.923] * (-2154.337) (-2157.063) (-2157.521) [-2153.603] -- 0:03:04
      52000 -- [-2152.444] (-2158.937) (-2158.141) (-2155.120) * [-2150.714] (-2164.146) (-2158.512) (-2149.114) -- 0:03:02
      52500 -- (-2151.444) (-2154.095) (-2154.389) [-2150.783] * [-2154.233] (-2160.038) (-2153.302) (-2149.595) -- 0:03:00
      53000 -- [-2155.385] (-2157.581) (-2152.406) (-2150.631) * [-2150.755] (-2158.218) (-2162.000) (-2156.075) -- 0:02:58
      53500 -- (-2151.105) (-2156.105) (-2151.545) [-2151.362] * (-2153.828) [-2153.036] (-2156.815) (-2153.677) -- 0:02:56
      54000 -- (-2145.734) (-2163.017) (-2156.635) [-2156.980] * (-2150.826) (-2155.534) (-2152.125) [-2156.235] -- 0:02:55
      54500 -- [-2154.600] (-2153.947) (-2153.802) (-2154.902) * [-2151.473] (-2150.455) (-2151.434) (-2152.746) -- 0:02:53
      55000 -- (-2149.165) (-2155.040) [-2148.554] (-2158.102) * (-2156.950) (-2150.609) [-2153.923] (-2152.151) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2152.752) (-2153.441) (-2159.652) [-2153.839] * (-2153.397) (-2148.983) (-2149.909) [-2152.460] -- 0:02:50
      56000 -- [-2149.181] (-2153.826) (-2154.029) (-2160.902) * (-2158.948) (-2150.886) [-2149.712] (-2156.768) -- 0:03:05
      56500 -- (-2149.882) (-2157.242) [-2149.514] (-2159.232) * [-2152.664] (-2152.860) (-2148.443) (-2152.827) -- 0:03:03
      57000 -- (-2155.649) (-2154.105) [-2152.155] (-2152.035) * (-2150.440) (-2152.692) (-2152.761) [-2152.703] -- 0:03:01
      57500 -- (-2149.727) (-2161.887) (-2150.516) [-2156.873] * (-2155.821) (-2150.036) (-2148.465) [-2151.381] -- 0:03:00
      58000 -- [-2155.767] (-2155.948) (-2149.410) (-2163.651) * (-2152.175) [-2154.793] (-2149.586) (-2154.805) -- 0:02:58
      58500 -- (-2157.899) (-2152.759) (-2158.116) [-2154.910] * (-2150.910) [-2152.652] (-2152.902) (-2150.588) -- 0:02:57
      59000 -- (-2155.540) (-2155.843) (-2159.359) [-2155.492] * (-2155.042) (-2151.082) [-2148.694] (-2152.997) -- 0:02:55
      59500 -- (-2154.129) (-2151.556) (-2157.477) [-2149.280] * (-2153.332) (-2152.201) [-2150.549] (-2154.735) -- 0:02:53
      60000 -- (-2153.862) (-2146.836) [-2158.382] (-2152.441) * (-2157.847) [-2149.726] (-2154.347) (-2156.501) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-2160.919) (-2147.757) [-2150.246] (-2150.790) * (-2153.841) (-2151.521) [-2152.797] (-2155.897) -- 0:02:50
      61000 -- (-2151.070) (-2155.317) [-2151.645] (-2157.647) * (-2156.176) [-2146.727] (-2154.546) (-2150.692) -- 0:02:49
      61500 -- (-2154.846) (-2156.388) [-2149.685] (-2150.150) * (-2158.110) (-2155.491) [-2147.139] (-2154.540) -- 0:03:03
      62000 -- (-2152.601) (-2155.591) [-2148.618] (-2156.369) * (-2153.058) (-2159.560) [-2147.924] (-2150.855) -- 0:03:01
      62500 -- [-2152.011] (-2157.469) (-2150.154) (-2163.139) * (-2151.623) (-2149.987) [-2155.541] (-2155.273) -- 0:03:00
      63000 -- (-2151.500) [-2149.954] (-2151.550) (-2156.588) * [-2152.851] (-2153.205) (-2160.369) (-2152.382) -- 0:02:58
      63500 -- (-2151.823) [-2147.017] (-2168.866) (-2160.501) * (-2149.192) [-2151.752] (-2152.738) (-2147.211) -- 0:02:56
      64000 -- (-2152.593) [-2151.105] (-2153.697) (-2156.429) * (-2148.701) [-2153.067] (-2149.753) (-2154.967) -- 0:02:55
      64500 -- (-2154.522) [-2155.950] (-2153.261) (-2155.271) * (-2155.387) [-2153.330] (-2149.415) (-2149.675) -- 0:02:54
      65000 -- (-2156.074) [-2151.459] (-2158.131) (-2150.488) * [-2148.282] (-2149.308) (-2152.196) (-2166.181) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-2156.729) [-2150.753] (-2167.490) (-2157.282) * (-2150.101) [-2159.950] (-2155.609) (-2151.141) -- 0:02:51
      66000 -- (-2155.830) [-2155.514] (-2158.652) (-2149.884) * (-2151.612) [-2152.223] (-2156.660) (-2154.232) -- 0:02:49
      66500 -- (-2156.788) (-2148.221) (-2157.222) [-2148.679] * (-2152.218) [-2148.765] (-2149.821) (-2152.809) -- 0:02:48
      67000 -- (-2152.183) (-2150.835) (-2150.952) [-2148.088] * (-2150.270) [-2155.836] (-2152.173) (-2154.092) -- 0:03:01
      67500 -- (-2155.956) [-2148.488] (-2149.589) (-2150.425) * [-2149.607] (-2159.794) (-2153.509) (-2152.801) -- 0:02:59
      68000 -- (-2159.327) (-2149.054) [-2150.049] (-2153.333) * [-2151.722] (-2152.015) (-2156.158) (-2158.139) -- 0:02:58
      68500 -- (-2156.013) [-2148.794] (-2147.488) (-2153.219) * [-2149.754] (-2158.535) (-2155.420) (-2154.486) -- 0:02:56
      69000 -- [-2158.104] (-2157.336) (-2155.161) (-2154.938) * [-2154.461] (-2165.503) (-2157.411) (-2158.724) -- 0:02:55
      69500 -- (-2154.348) [-2150.918] (-2157.723) (-2148.936) * [-2155.315] (-2160.800) (-2152.865) (-2155.693) -- 0:02:54
      70000 -- (-2151.879) (-2156.192) [-2150.622] (-2158.100) * (-2152.783) [-2151.529] (-2153.273) (-2153.488) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      70500 -- [-2150.307] (-2155.622) (-2158.281) (-2156.296) * [-2150.464] (-2156.721) (-2149.814) (-2151.348) -- 0:02:51
      71000 -- (-2152.567) (-2153.302) [-2151.864] (-2155.806) * (-2150.682) (-2151.059) (-2153.356) [-2152.421] -- 0:02:50
      71500 -- (-2152.180) (-2153.309) [-2152.915] (-2149.558) * (-2153.963) [-2148.563] (-2152.201) (-2151.813) -- 0:02:48
      72000 -- (-2153.659) (-2152.294) [-2147.645] (-2148.966) * (-2153.005) (-2157.632) (-2148.503) [-2154.087] -- 0:02:47
      72500 -- (-2154.794) (-2157.505) [-2155.333] (-2149.882) * [-2153.755] (-2154.857) (-2153.274) (-2153.887) -- 0:02:59
      73000 -- (-2151.884) (-2158.850) (-2158.139) [-2153.925] * [-2154.858] (-2156.269) (-2155.201) (-2156.218) -- 0:02:57
      73500 -- (-2154.909) (-2155.442) (-2156.098) [-2152.069] * (-2152.780) [-2150.993] (-2153.013) (-2158.152) -- 0:02:56
      74000 -- [-2154.050] (-2151.191) (-2159.371) (-2151.774) * (-2150.183) (-2146.623) [-2153.948] (-2158.821) -- 0:02:55
      74500 -- [-2153.434] (-2153.899) (-2153.193) (-2150.220) * [-2149.210] (-2153.858) (-2160.338) (-2152.321) -- 0:02:53
      75000 -- (-2152.852) [-2155.462] (-2152.495) (-2151.122) * [-2153.662] (-2148.855) (-2149.934) (-2158.638) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-2149.975) (-2155.038) (-2155.157) [-2153.544] * (-2149.536) (-2154.262) [-2150.716] (-2152.246) -- 0:02:51
      76000 -- (-2150.034) (-2165.726) (-2154.265) [-2148.896] * (-2151.544) [-2151.929] (-2149.064) (-2155.490) -- 0:02:50
      76500 -- (-2151.622) (-2155.902) [-2150.585] (-2152.714) * (-2151.854) (-2148.281) (-2151.530) [-2151.063] -- 0:02:49
      77000 -- (-2151.612) [-2157.733] (-2155.776) (-2149.487) * (-2156.103) (-2152.173) [-2150.429] (-2158.823) -- 0:02:47
      77500 -- (-2151.442) [-2150.335] (-2155.298) (-2152.841) * (-2155.984) (-2150.983) [-2156.947] (-2153.104) -- 0:02:46
      78000 -- (-2150.972) (-2156.856) (-2153.327) [-2156.047] * [-2156.544] (-2158.671) (-2150.542) (-2154.928) -- 0:02:57
      78500 -- (-2148.448) [-2156.435] (-2147.888) (-2158.806) * (-2161.112) (-2158.655) [-2149.067] (-2154.517) -- 0:02:56
      79000 -- (-2156.484) [-2152.348] (-2157.636) (-2156.585) * (-2150.839) (-2156.924) [-2151.648] (-2158.631) -- 0:02:54
      79500 -- (-2154.010) (-2156.481) (-2149.539) [-2151.121] * (-2149.511) [-2148.341] (-2154.810) (-2154.380) -- 0:02:53
      80000 -- [-2150.024] (-2160.430) (-2150.867) (-2160.780) * [-2151.429] (-2155.970) (-2155.057) (-2156.520) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      80500 -- [-2152.638] (-2160.721) (-2158.405) (-2151.774) * (-2148.736) (-2156.851) (-2155.080) [-2152.725] -- 0:02:51
      81000 -- (-2155.758) (-2152.724) [-2151.761] (-2156.116) * (-2159.470) (-2156.122) [-2155.581] (-2152.487) -- 0:02:50
      81500 -- (-2154.266) (-2149.242) (-2148.213) [-2149.484] * (-2151.694) [-2156.457] (-2153.597) (-2156.010) -- 0:02:49
      82000 -- (-2156.466) [-2153.277] (-2150.342) (-2153.144) * [-2152.913] (-2155.452) (-2153.436) (-2148.572) -- 0:02:47
      82500 -- (-2152.893) [-2154.729] (-2151.647) (-2153.822) * (-2149.004) [-2152.740] (-2154.571) (-2151.148) -- 0:02:46
      83000 -- (-2151.363) (-2152.621) (-2150.853) [-2150.228] * (-2152.830) (-2153.474) (-2156.428) [-2147.826] -- 0:02:56
      83500 -- (-2163.175) (-2153.034) (-2153.480) [-2148.300] * [-2152.582] (-2154.166) (-2158.746) (-2155.459) -- 0:02:55
      84000 -- (-2159.772) [-2150.727] (-2157.368) (-2149.474) * [-2152.868] (-2153.610) (-2154.409) (-2157.714) -- 0:02:54
      84500 -- [-2146.841] (-2154.595) (-2156.138) (-2156.952) * (-2159.648) (-2159.241) [-2151.254] (-2151.678) -- 0:02:53
      85000 -- (-2150.244) (-2154.081) (-2153.971) [-2151.146] * [-2150.045] (-2156.593) (-2156.356) (-2159.641) -- 0:02:52

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-2153.331) [-2150.383] (-2155.414) (-2155.932) * [-2151.981] (-2154.521) (-2153.520) (-2155.774) -- 0:02:51
      86000 -- [-2155.805] (-2149.621) (-2152.784) (-2154.775) * [-2154.583] (-2152.685) (-2153.865) (-2154.719) -- 0:02:50
      86500 -- (-2151.587) (-2148.542) (-2149.704) [-2152.408] * [-2152.477] (-2153.568) (-2152.002) (-2157.770) -- 0:02:48
      87000 -- (-2154.712) [-2154.566] (-2155.486) (-2158.611) * [-2155.463] (-2155.666) (-2152.094) (-2149.849) -- 0:02:47
      87500 -- [-2151.330] (-2148.239) (-2152.954) (-2156.358) * (-2154.659) (-2158.803) (-2153.940) [-2149.919] -- 0:02:46
      88000 -- (-2159.086) [-2150.692] (-2153.789) (-2153.856) * (-2149.259) (-2147.409) (-2155.970) [-2158.731] -- 0:02:45
      88500 -- (-2157.922) (-2157.749) [-2153.325] (-2157.894) * (-2147.809) (-2148.062) [-2152.332] (-2151.198) -- 0:02:55
      89000 -- [-2151.949] (-2155.722) (-2156.208) (-2154.978) * [-2150.704] (-2151.404) (-2153.962) (-2150.371) -- 0:02:54
      89500 -- (-2160.428) (-2152.370) (-2160.753) [-2147.276] * (-2156.103) (-2155.061) [-2153.058] (-2157.797) -- 0:02:52
      90000 -- (-2165.511) (-2160.931) [-2155.490] (-2156.915) * [-2149.652] (-2152.322) (-2154.777) (-2151.727) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-2152.186) [-2149.880] (-2153.214) (-2155.285) * (-2148.745) (-2158.160) (-2151.805) [-2147.474] -- 0:02:50
      91000 -- [-2155.545] (-2154.374) (-2156.662) (-2154.610) * [-2151.620] (-2166.160) (-2157.427) (-2153.840) -- 0:02:49
      91500 -- [-2147.829] (-2154.041) (-2151.605) (-2147.942) * (-2155.463) [-2149.383] (-2156.104) (-2148.498) -- 0:02:48
      92000 -- (-2152.468) (-2150.555) [-2154.164] (-2148.707) * (-2149.610) (-2154.502) [-2149.855] (-2150.024) -- 0:02:47
      92500 -- (-2149.328) [-2148.871] (-2157.334) (-2152.238) * (-2159.712) [-2151.787] (-2149.612) (-2150.952) -- 0:02:46
      93000 -- (-2157.407) (-2163.740) (-2151.546) [-2153.625] * (-2166.789) (-2151.338) [-2156.467] (-2153.240) -- 0:02:45
      93500 -- (-2152.208) [-2148.621] (-2151.581) (-2151.147) * (-2159.124) (-2152.875) [-2151.340] (-2150.424) -- 0:02:44
      94000 -- (-2152.174) [-2148.436] (-2156.083) (-2162.790) * (-2154.596) [-2153.233] (-2153.838) (-2154.033) -- 0:02:53
      94500 -- (-2156.258) (-2148.697) [-2152.271] (-2156.635) * (-2153.814) [-2150.710] (-2149.328) (-2156.529) -- 0:02:52
      95000 -- (-2158.325) (-2154.972) (-2159.637) [-2154.648] * [-2155.056] (-2149.223) (-2151.071) (-2155.052) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-2161.048) (-2147.639) (-2146.884) [-2152.704] * (-2151.475) (-2150.775) [-2148.332] (-2151.912) -- 0:02:50
      96000 -- (-2158.100) (-2161.319) [-2154.435] (-2149.925) * [-2148.944] (-2150.192) (-2148.574) (-2153.262) -- 0:02:49
      96500 -- (-2155.762) (-2152.609) (-2156.713) [-2152.944] * (-2150.479) (-2152.295) [-2147.534] (-2149.062) -- 0:02:48
      97000 -- (-2160.850) (-2154.521) (-2154.979) [-2152.052] * [-2153.464] (-2149.015) (-2149.062) (-2156.410) -- 0:02:47
      97500 -- (-2156.696) (-2162.158) (-2153.012) [-2151.838] * (-2153.406) [-2154.603] (-2155.513) (-2158.232) -- 0:02:46
      98000 -- (-2156.145) [-2152.245] (-2149.404) (-2150.911) * (-2148.756) (-2152.062) [-2151.881] (-2153.882) -- 0:02:45
      98500 -- (-2151.010) [-2156.103] (-2150.739) (-2154.342) * (-2151.560) (-2154.589) [-2149.986] (-2151.620) -- 0:02:44
      99000 -- (-2152.600) (-2150.149) [-2154.154] (-2148.632) * (-2160.441) (-2154.138) [-2152.421] (-2159.720) -- 0:02:43
      99500 -- (-2150.713) (-2161.013) [-2157.829] (-2158.008) * [-2150.255] (-2158.671) (-2154.425) (-2155.494) -- 0:02:51
      100000 -- (-2153.344) (-2155.299) [-2154.290] (-2162.425) * (-2160.263) (-2159.310) [-2148.262] (-2151.712) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-2154.314) [-2151.738] (-2150.691) (-2155.280) * [-2152.045] (-2158.635) (-2151.685) (-2153.245) -- 0:02:50
      101000 -- (-2165.094) [-2149.388] (-2148.400) (-2156.546) * (-2158.955) (-2156.327) (-2162.760) [-2152.763] -- 0:02:49
      101500 -- (-2164.646) (-2151.067) (-2156.008) [-2152.858] * (-2153.614) (-2150.814) (-2155.678) [-2154.961] -- 0:02:48
      102000 -- [-2154.792] (-2155.459) (-2152.756) (-2153.052) * (-2157.102) (-2152.803) [-2151.541] (-2157.734) -- 0:02:47
      102500 -- [-2154.227] (-2157.567) (-2156.419) (-2152.627) * (-2159.174) (-2158.812) [-2151.619] (-2154.228) -- 0:02:46
      103000 -- (-2155.339) (-2157.405) (-2151.874) [-2154.100] * (-2150.148) (-2157.932) [-2149.713] (-2154.710) -- 0:02:45
      103500 -- [-2150.106] (-2161.088) (-2154.541) (-2152.262) * (-2162.249) (-2151.843) [-2152.798] (-2152.516) -- 0:02:44
      104000 -- [-2152.424] (-2148.149) (-2154.898) (-2151.465) * (-2166.310) [-2151.093] (-2163.647) (-2151.636) -- 0:02:43
      104500 -- (-2155.161) [-2148.326] (-2154.982) (-2155.114) * (-2158.224) (-2150.747) [-2150.404] (-2149.612) -- 0:02:42
      105000 -- (-2155.303) [-2151.990] (-2155.655) (-2158.238) * (-2147.925) (-2158.154) (-2155.959) [-2146.411] -- 0:02:50

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-2151.748) [-2148.958] (-2151.406) (-2159.650) * (-2150.117) (-2152.838) (-2153.303) [-2152.700] -- 0:02:49
      106000 -- (-2153.927) (-2150.658) [-2154.261] (-2147.242) * (-2152.122) [-2151.938] (-2154.803) (-2148.096) -- 0:02:48
      106500 -- (-2149.099) [-2151.894] (-2154.511) (-2155.885) * (-2149.359) (-2153.815) (-2157.645) [-2151.343] -- 0:02:47
      107000 -- (-2149.229) [-2147.923] (-2150.580) (-2153.554) * (-2151.044) (-2150.369) (-2155.629) [-2148.574] -- 0:02:46
      107500 -- [-2151.729] (-2148.355) (-2155.991) (-2154.654) * [-2150.006] (-2156.694) (-2147.359) (-2151.423) -- 0:02:46
      108000 -- (-2160.440) (-2150.756) (-2155.981) [-2152.748] * [-2163.452] (-2155.789) (-2151.319) (-2153.015) -- 0:02:45
      108500 -- (-2157.863) (-2156.529) (-2152.917) [-2150.066] * [-2153.143] (-2152.641) (-2152.580) (-2149.868) -- 0:02:44
      109000 -- (-2153.110) [-2154.557] (-2155.922) (-2148.442) * (-2152.500) [-2154.856] (-2156.016) (-2152.043) -- 0:02:43
      109500 -- (-2154.232) [-2151.014] (-2153.209) (-2154.784) * (-2149.645) (-2149.865) (-2150.661) [-2151.331] -- 0:02:42
      110000 -- (-2156.920) [-2152.663] (-2150.577) (-2153.203) * (-2156.017) (-2154.144) [-2150.897] (-2155.076) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-2157.510] (-2148.465) (-2159.775) (-2152.246) * (-2155.596) (-2154.934) (-2150.017) [-2147.482] -- 0:02:49
      111000 -- (-2158.679) [-2147.594] (-2153.639) (-2147.691) * [-2156.600] (-2152.981) (-2156.230) (-2154.427) -- 0:02:48
      111500 -- [-2156.814] (-2152.275) (-2155.846) (-2154.628) * (-2154.812) [-2158.244] (-2153.874) (-2153.967) -- 0:02:47
      112000 -- (-2154.374) [-2147.504] (-2148.566) (-2149.409) * (-2154.479) (-2150.423) (-2154.796) [-2147.983] -- 0:02:46
      112500 -- (-2155.162) (-2154.385) (-2149.263) [-2145.742] * [-2151.748] (-2154.686) (-2156.705) (-2152.519) -- 0:02:45
      113000 -- (-2157.199) (-2152.383) (-2154.802) [-2152.532] * (-2151.179) [-2148.150] (-2160.349) (-2151.542) -- 0:02:44
      113500 -- (-2152.886) (-2152.592) [-2149.459] (-2153.104) * (-2152.886) [-2146.560] (-2161.620) (-2147.311) -- 0:02:44
      114000 -- (-2154.552) (-2153.002) [-2150.147] (-2154.794) * (-2150.787) (-2150.787) (-2162.511) [-2148.933] -- 0:02:43
      114500 -- (-2149.108) [-2148.961] (-2157.766) (-2157.526) * (-2153.530) (-2151.440) (-2158.956) [-2152.301] -- 0:02:42
      115000 -- (-2153.969) (-2158.977) [-2163.123] (-2151.710) * (-2153.508) [-2149.252] (-2151.043) (-2150.069) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-2149.292) (-2148.851) (-2151.453) [-2154.017] * (-2149.879) (-2150.824) [-2154.557] (-2149.622) -- 0:02:40
      116000 -- [-2147.666] (-2152.810) (-2153.297) (-2157.414) * [-2153.784] (-2150.919) (-2152.998) (-2152.840) -- 0:02:47
      116500 -- (-2149.671) [-2152.989] (-2160.436) (-2153.986) * (-2161.272) (-2153.589) (-2158.567) [-2147.579] -- 0:02:46
      117000 -- [-2151.128] (-2157.769) (-2159.485) (-2157.520) * (-2152.246) [-2157.859] (-2154.144) (-2151.803) -- 0:02:46
      117500 -- [-2152.074] (-2151.477) (-2163.548) (-2155.169) * (-2153.454) (-2156.160) [-2152.539] (-2154.594) -- 0:02:45
      118000 -- (-2152.551) (-2150.146) [-2150.580] (-2158.357) * (-2155.295) (-2152.500) (-2157.142) [-2152.488] -- 0:02:44
      118500 -- (-2153.451) (-2155.271) [-2156.164] (-2156.731) * (-2158.294) (-2153.822) [-2156.313] (-2151.559) -- 0:02:43
      119000 -- (-2155.032) [-2152.088] (-2153.217) (-2151.379) * (-2155.344) (-2170.931) [-2149.755] (-2157.990) -- 0:02:42
      119500 -- (-2161.049) [-2155.935] (-2153.526) (-2152.203) * (-2157.540) (-2153.579) [-2151.635] (-2159.457) -- 0:02:42
      120000 -- (-2154.881) (-2152.861) (-2158.441) [-2152.521] * (-2151.784) (-2161.069) (-2152.979) [-2151.089] -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-2149.306] (-2150.933) (-2152.695) (-2151.457) * (-2153.255) (-2155.482) (-2160.291) [-2155.869] -- 0:02:40
      121000 -- (-2155.704) (-2151.269) [-2154.635] (-2158.505) * [-2148.401] (-2157.372) (-2161.973) (-2156.547) -- 0:02:39
      121500 -- (-2155.538) [-2150.001] (-2157.899) (-2152.404) * [-2152.450] (-2165.402) (-2156.725) (-2150.212) -- 0:02:46
      122000 -- [-2152.186] (-2151.863) (-2150.518) (-2154.481) * (-2152.740) (-2150.888) [-2154.246] (-2150.424) -- 0:02:45
      122500 -- [-2149.325] (-2149.978) (-2149.931) (-2157.826) * (-2156.361) [-2151.895] (-2151.395) (-2156.114) -- 0:02:44
      123000 -- (-2151.628) (-2152.930) [-2153.517] (-2157.846) * (-2153.523) (-2154.790) [-2150.281] (-2153.741) -- 0:02:43
      123500 -- (-2147.577) (-2158.023) [-2156.124] (-2150.170) * [-2154.829] (-2150.960) (-2156.341) (-2151.416) -- 0:02:43
      124000 -- (-2153.228) (-2155.693) [-2154.238] (-2152.473) * [-2149.705] (-2153.058) (-2157.932) (-2157.919) -- 0:02:42
      124500 -- (-2148.940) (-2155.971) (-2153.421) [-2156.962] * [-2151.251] (-2155.201) (-2160.660) (-2154.397) -- 0:02:41
      125000 -- (-2149.026) [-2155.974] (-2154.415) (-2154.652) * (-2151.768) (-2150.328) [-2149.756] (-2148.419) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-2152.445) (-2150.610) (-2155.418) [-2152.241] * (-2153.907) [-2149.931] (-2149.606) (-2149.112) -- 0:02:40
      126000 -- [-2150.195] (-2161.945) (-2154.659) (-2156.514) * (-2152.571) (-2155.895) [-2147.765] (-2151.427) -- 0:02:39
      126500 -- (-2156.843) [-2151.674] (-2153.690) (-2150.906) * (-2152.430) (-2155.582) (-2157.756) [-2150.747] -- 0:02:45
      127000 -- (-2153.735) [-2154.416] (-2148.806) (-2150.177) * (-2150.009) (-2153.596) [-2148.126] (-2160.319) -- 0:02:44
      127500 -- (-2152.625) (-2154.523) [-2150.646] (-2155.970) * [-2150.687] (-2155.006) (-2158.049) (-2149.800) -- 0:02:44
      128000 -- [-2152.218] (-2153.224) (-2147.300) (-2157.007) * (-2156.481) (-2157.996) [-2151.802] (-2158.244) -- 0:02:43
      128500 -- (-2157.756) (-2155.254) (-2150.135) [-2153.124] * (-2161.035) (-2161.944) [-2152.002] (-2152.664) -- 0:02:42
      129000 -- (-2156.755) (-2153.780) [-2150.134] (-2157.744) * (-2156.993) [-2158.196] (-2155.187) (-2154.791) -- 0:02:42
      129500 -- (-2160.294) (-2158.837) (-2150.068) [-2159.633] * (-2157.583) (-2153.939) (-2150.948) [-2155.776] -- 0:02:41
      130000 -- (-2155.965) (-2156.805) [-2152.228] (-2151.102) * [-2151.855] (-2157.124) (-2155.323) (-2155.108) -- 0:02:40

      Average standard deviation of split frequencies: 0.001804

      130500 -- (-2154.388) (-2159.768) (-2152.375) [-2153.194] * (-2148.919) [-2149.319] (-2151.631) (-2155.731) -- 0:02:39
      131000 -- (-2153.025) (-2156.957) (-2152.465) [-2151.892] * [-2155.633] (-2148.602) (-2152.160) (-2157.222) -- 0:02:39
      131500 -- [-2154.068] (-2156.000) (-2154.736) (-2153.452) * [-2160.706] (-2151.647) (-2158.066) (-2158.206) -- 0:02:38
      132000 -- (-2152.865) (-2151.321) [-2156.853] (-2153.851) * (-2155.467) (-2157.648) (-2152.537) [-2150.338] -- 0:02:44
      132500 -- [-2150.945] (-2153.313) (-2152.518) (-2148.977) * (-2153.133) (-2151.083) [-2154.414] (-2155.178) -- 0:02:43
      133000 -- (-2151.315) (-2153.363) (-2150.388) [-2152.808] * (-2148.342) (-2162.752) [-2150.613] (-2151.933) -- 0:02:42
      133500 -- [-2159.120] (-2151.196) (-2151.152) (-2166.437) * (-2155.213) (-2158.342) [-2154.968] (-2149.782) -- 0:02:42
      134000 -- (-2153.450) (-2153.752) [-2154.723] (-2157.278) * [-2155.231] (-2156.569) (-2151.299) (-2151.276) -- 0:02:41
      134500 -- [-2153.420] (-2153.793) (-2153.596) (-2154.798) * (-2155.649) (-2152.620) (-2154.281) [-2155.954] -- 0:02:40
      135000 -- (-2149.421) (-2154.344) [-2155.741] (-2149.378) * (-2154.011) (-2155.158) (-2148.536) [-2148.582] -- 0:02:40

      Average standard deviation of split frequencies: 0.001733

      135500 -- (-2151.418) (-2159.357) [-2148.760] (-2156.163) * (-2153.045) (-2154.500) [-2155.584] (-2151.526) -- 0:02:39
      136000 -- (-2162.872) (-2158.863) [-2152.018] (-2151.741) * (-2154.781) (-2156.904) [-2154.481] (-2150.982) -- 0:02:38
      136500 -- (-2157.538) [-2147.967] (-2150.061) (-2151.847) * (-2157.814) (-2153.560) [-2153.356] (-2152.989) -- 0:02:38
      137000 -- (-2148.617) (-2149.197) [-2149.855] (-2150.465) * (-2159.348) (-2157.147) (-2150.097) [-2149.871] -- 0:02:37
      137500 -- (-2153.541) [-2150.473] (-2147.282) (-2158.775) * (-2169.278) [-2150.314] (-2159.477) (-2155.321) -- 0:02:43
      138000 -- (-2153.056) (-2154.806) [-2148.193] (-2150.427) * [-2152.351] (-2151.400) (-2155.018) (-2152.857) -- 0:02:42
      138500 -- (-2153.440) [-2152.027] (-2153.071) (-2154.356) * (-2152.618) (-2151.484) [-2152.144] (-2157.072) -- 0:02:41
      139000 -- (-2155.228) (-2152.668) (-2153.169) [-2149.648] * (-2150.689) (-2154.385) [-2158.485] (-2147.136) -- 0:02:41
      139500 -- (-2156.353) (-2157.483) [-2153.241] (-2155.481) * [-2152.371] (-2154.455) (-2165.295) (-2153.632) -- 0:02:40
      140000 -- (-2149.921) (-2155.135) [-2150.214] (-2151.761) * (-2152.367) [-2150.500] (-2153.447) (-2158.880) -- 0:02:39

      Average standard deviation of split frequencies: 0.001676

      140500 -- (-2157.320) (-2148.440) (-2158.002) [-2153.846] * (-2153.337) [-2150.602] (-2155.780) (-2156.628) -- 0:02:39
      141000 -- (-2161.367) (-2151.921) [-2150.602] (-2155.356) * (-2158.348) [-2153.429] (-2155.512) (-2153.783) -- 0:02:38
      141500 -- (-2154.566) (-2158.411) (-2149.652) [-2154.660] * (-2151.182) (-2154.790) [-2152.244] (-2157.734) -- 0:02:37
      142000 -- (-2154.378) (-2155.667) (-2150.546) [-2153.029] * [-2151.093] (-2154.499) (-2154.904) (-2156.004) -- 0:02:37
      142500 -- [-2156.291] (-2160.479) (-2154.767) (-2152.344) * (-2149.105) (-2153.933) [-2156.110] (-2148.549) -- 0:02:36
      143000 -- (-2158.621) [-2155.145] (-2151.268) (-2160.875) * (-2146.040) [-2150.217] (-2151.786) (-2152.608) -- 0:02:41
      143500 -- (-2158.914) (-2152.067) [-2159.015] (-2156.621) * [-2150.124] (-2152.418) (-2148.613) (-2151.217) -- 0:02:41
      144000 -- (-2152.741) (-2152.314) (-2161.476) [-2152.051] * (-2152.023) (-2159.647) (-2151.132) [-2153.255] -- 0:02:40
      144500 -- [-2149.298] (-2151.891) (-2154.113) (-2149.216) * (-2151.722) (-2150.992) [-2151.489] (-2153.378) -- 0:02:39
      145000 -- (-2150.179) [-2150.203] (-2158.784) (-2155.617) * (-2157.294) (-2152.542) (-2154.401) [-2155.142] -- 0:02:39

      Average standard deviation of split frequencies: 0.001614

      145500 -- [-2149.916] (-2151.855) (-2152.696) (-2153.873) * (-2157.114) [-2147.896] (-2149.994) (-2156.363) -- 0:02:38
      146000 -- (-2150.150) (-2152.625) (-2150.269) [-2150.680] * [-2150.646] (-2156.798) (-2148.050) (-2154.076) -- 0:02:37
      146500 -- [-2157.385] (-2151.576) (-2153.727) (-2155.142) * (-2157.916) [-2149.239] (-2149.339) (-2154.026) -- 0:02:37
      147000 -- [-2148.434] (-2159.806) (-2153.003) (-2158.437) * (-2156.359) [-2151.560] (-2156.587) (-2149.815) -- 0:02:36
      147500 -- (-2153.522) (-2156.405) (-2153.767) [-2147.857] * [-2156.042] (-2151.815) (-2163.066) (-2152.729) -- 0:02:36
      148000 -- (-2153.832) (-2149.256) [-2151.457] (-2163.005) * (-2157.088) (-2150.524) [-2164.154] (-2157.527) -- 0:02:35
      148500 -- (-2163.064) (-2146.738) [-2148.841] (-2155.531) * (-2158.958) (-2151.112) [-2154.547] (-2154.218) -- 0:02:40
      149000 -- (-2155.477) (-2150.394) [-2148.265] (-2150.987) * (-2155.354) (-2154.566) (-2151.831) [-2157.809] -- 0:02:39
      149500 -- (-2154.939) [-2150.386] (-2154.189) (-2154.509) * (-2145.753) (-2156.731) (-2151.636) [-2152.930] -- 0:02:39
      150000 -- [-2155.733] (-2150.390) (-2151.481) (-2149.120) * (-2150.050) (-2151.874) [-2149.123] (-2155.802) -- 0:02:38

      Average standard deviation of split frequencies: 0.001564

      150500 -- (-2154.613) (-2152.821) [-2152.614] (-2156.989) * (-2150.202) [-2154.342] (-2150.577) (-2150.704) -- 0:02:38
      151000 -- (-2151.909) (-2154.257) (-2156.043) [-2148.801] * (-2152.094) (-2161.781) (-2150.917) [-2148.864] -- 0:02:37
      151500 -- (-2159.827) (-2150.808) [-2150.620] (-2156.580) * (-2152.943) [-2158.115] (-2154.962) (-2150.510) -- 0:02:36
      152000 -- (-2158.279) (-2148.490) [-2148.719] (-2158.522) * (-2153.301) [-2155.742] (-2155.568) (-2150.194) -- 0:02:36
      152500 -- [-2154.545] (-2153.975) (-2157.383) (-2156.235) * [-2151.785] (-2154.841) (-2160.825) (-2153.579) -- 0:02:35
      153000 -- (-2152.271) (-2154.699) [-2153.418] (-2153.806) * [-2155.334] (-2152.037) (-2156.768) (-2157.891) -- 0:02:35
      153500 -- [-2148.035] (-2153.970) (-2155.833) (-2159.840) * (-2155.002) [-2150.434] (-2154.159) (-2151.628) -- 0:02:34
      154000 -- [-2153.979] (-2153.953) (-2156.714) (-2158.461) * (-2152.403) [-2152.378] (-2156.719) (-2149.425) -- 0:02:39
      154500 -- (-2149.831) [-2151.084] (-2159.042) (-2150.995) * (-2148.671) (-2151.676) (-2152.136) [-2156.679] -- 0:02:38
      155000 -- (-2155.363) (-2164.209) [-2149.470] (-2153.424) * (-2150.822) (-2153.424) [-2149.893] (-2152.117) -- 0:02:38

      Average standard deviation of split frequencies: 0.001511

      155500 -- (-2151.134) (-2153.046) (-2149.048) [-2154.540] * (-2152.207) [-2150.590] (-2151.427) (-2151.403) -- 0:02:37
      156000 -- (-2149.989) (-2158.329) [-2151.666] (-2151.075) * (-2149.434) [-2154.336] (-2151.818) (-2157.097) -- 0:02:36
      156500 -- (-2151.780) (-2151.986) (-2150.625) [-2153.728] * (-2154.443) (-2149.531) (-2161.312) [-2151.862] -- 0:02:36
      157000 -- (-2153.260) (-2152.306) [-2149.220] (-2157.605) * (-2159.808) (-2156.062) (-2157.926) [-2152.044] -- 0:02:35
      157500 -- (-2158.876) (-2150.997) [-2148.889] (-2154.415) * [-2160.659] (-2149.714) (-2159.461) (-2150.102) -- 0:02:35
      158000 -- (-2155.497) [-2156.807] (-2149.015) (-2152.218) * (-2151.404) [-2155.773] (-2159.224) (-2150.831) -- 0:02:34
      158500 -- [-2150.803] (-2151.063) (-2151.950) (-2153.437) * [-2149.859] (-2154.579) (-2155.302) (-2148.626) -- 0:02:33
      159000 -- (-2157.201) (-2157.040) (-2155.621) [-2158.038] * (-2153.973) (-2154.769) [-2149.736] (-2154.698) -- 0:02:33
      159500 -- (-2156.914) [-2152.470] (-2157.764) (-2154.744) * (-2164.369) [-2158.806] (-2154.198) (-2155.769) -- 0:02:38
      160000 -- (-2154.953) (-2152.196) [-2155.859] (-2152.550) * (-2163.970) [-2148.895] (-2150.916) (-2152.979) -- 0:02:37

      Average standard deviation of split frequencies: 0.001467

      160500 -- (-2153.383) [-2148.112] (-2156.717) (-2155.056) * (-2161.305) (-2153.208) (-2148.712) [-2151.517] -- 0:02:36
      161000 -- (-2153.244) (-2148.912) (-2158.957) [-2161.972] * (-2149.800) (-2149.813) (-2154.753) [-2150.232] -- 0:02:36
      161500 -- (-2154.994) (-2154.046) (-2157.028) [-2158.566] * (-2161.442) (-2154.018) (-2153.627) [-2152.656] -- 0:02:35
      162000 -- (-2154.191) [-2154.203] (-2154.526) (-2152.936) * [-2156.883] (-2156.389) (-2154.238) (-2153.601) -- 0:02:35
      162500 -- (-2155.857) (-2151.422) [-2155.687] (-2148.879) * (-2155.876) (-2150.884) [-2150.753] (-2152.197) -- 0:02:34
      163000 -- (-2155.983) (-2152.629) [-2156.674] (-2150.139) * [-2153.497] (-2154.078) (-2153.063) (-2149.735) -- 0:02:34
      163500 -- (-2156.506) [-2151.861] (-2149.692) (-2151.888) * [-2153.202] (-2151.691) (-2150.577) (-2147.876) -- 0:02:33
      164000 -- [-2152.910] (-2149.572) (-2151.762) (-2150.745) * (-2157.067) (-2152.965) (-2157.136) [-2159.279] -- 0:02:32
      164500 -- (-2153.107) (-2147.226) (-2150.245) [-2153.452] * (-2159.823) [-2154.123] (-2157.836) (-2157.279) -- 0:02:37
      165000 -- (-2154.483) [-2150.734] (-2154.405) (-2150.037) * (-2154.145) (-2146.864) [-2152.292] (-2150.432) -- 0:02:36

      Average standard deviation of split frequencies: 0.001420

      165500 -- (-2152.547) (-2149.352) (-2149.666) [-2151.675] * (-2155.291) (-2149.176) [-2154.211] (-2156.084) -- 0:02:36
      166000 -- (-2149.362) (-2155.741) (-2150.586) [-2151.338] * (-2154.163) [-2148.548] (-2153.292) (-2149.509) -- 0:02:35
      166500 -- [-2147.305] (-2152.244) (-2155.262) (-2151.467) * (-2149.073) [-2154.080] (-2152.657) (-2151.778) -- 0:02:35
      167000 -- [-2151.434] (-2152.454) (-2154.166) (-2149.012) * (-2149.463) [-2150.325] (-2155.539) (-2152.729) -- 0:02:34
      167500 -- [-2152.458] (-2152.497) (-2153.603) (-2150.133) * (-2148.207) (-2151.964) [-2147.406] (-2156.836) -- 0:02:34
      168000 -- (-2151.559) (-2152.202) [-2153.431] (-2152.669) * [-2148.354] (-2151.398) (-2150.702) (-2153.959) -- 0:02:33
      168500 -- [-2154.195] (-2158.656) (-2147.662) (-2153.019) * (-2156.602) [-2148.902] (-2148.753) (-2158.516) -- 0:02:32
      169000 -- (-2155.811) [-2154.087] (-2159.123) (-2155.644) * (-2153.282) (-2148.703) [-2146.363] (-2158.918) -- 0:02:32
      169500 -- (-2153.362) (-2156.166) (-2154.254) [-2151.003] * [-2149.046] (-2147.335) (-2152.062) (-2166.673) -- 0:02:31
      170000 -- (-2152.977) (-2154.446) (-2150.714) [-2159.780] * (-2149.629) (-2164.680) [-2150.525] (-2159.672) -- 0:02:36

      Average standard deviation of split frequencies: 0.001381

      170500 -- (-2152.282) (-2152.481) (-2152.450) [-2151.756] * (-2152.717) [-2147.523] (-2149.288) (-2158.414) -- 0:02:35
      171000 -- (-2150.039) (-2151.891) (-2151.777) [-2152.413] * (-2151.054) [-2152.828] (-2145.775) (-2151.616) -- 0:02:35
      171500 -- (-2156.338) [-2149.203] (-2151.298) (-2153.081) * [-2153.710] (-2153.703) (-2151.008) (-2152.259) -- 0:02:34
      172000 -- [-2151.565] (-2153.148) (-2156.354) (-2150.542) * (-2159.199) [-2154.334] (-2155.641) (-2149.451) -- 0:02:34
      172500 -- [-2150.946] (-2154.614) (-2150.846) (-2154.926) * [-2151.836] (-2154.946) (-2155.113) (-2149.828) -- 0:02:33
      173000 -- [-2152.152] (-2153.503) (-2153.120) (-2154.834) * (-2152.307) (-2151.737) (-2156.204) [-2157.500] -- 0:02:32
      173500 -- (-2152.080) (-2148.791) (-2150.337) [-2154.771] * (-2149.879) (-2150.161) (-2153.377) [-2152.360] -- 0:02:32
      174000 -- (-2157.880) [-2149.582] (-2150.489) (-2151.251) * (-2151.278) [-2149.300] (-2159.178) (-2152.732) -- 0:02:31
      174500 -- (-2155.726) (-2156.422) (-2153.596) [-2156.057] * (-2153.831) [-2154.271] (-2157.977) (-2157.430) -- 0:02:31
      175000 -- [-2147.748] (-2158.198) (-2152.903) (-2149.163) * (-2148.603) (-2148.543) (-2149.164) [-2150.927] -- 0:02:30

      Average standard deviation of split frequencies: 0.001339

      175500 -- (-2146.920) (-2160.070) (-2149.431) [-2149.853] * [-2149.607] (-2150.466) (-2149.633) (-2152.499) -- 0:02:35
      176000 -- [-2148.727] (-2161.480) (-2154.345) (-2154.269) * (-2153.281) (-2147.861) (-2153.429) [-2154.113] -- 0:02:34
      176500 -- (-2152.789) (-2153.088) [-2149.969] (-2150.596) * (-2154.284) (-2156.326) (-2162.226) [-2153.380] -- 0:02:33
      177000 -- (-2152.448) (-2158.734) (-2156.735) [-2153.748] * [-2158.440] (-2156.450) (-2158.653) (-2158.156) -- 0:02:33
      177500 -- [-2157.343] (-2153.531) (-2157.483) (-2149.955) * (-2155.998) (-2151.242) (-2153.091) [-2155.098] -- 0:02:32
      178000 -- (-2150.254) (-2157.985) [-2153.803] (-2160.608) * (-2153.819) (-2152.416) [-2150.116] (-2155.625) -- 0:02:32
      178500 -- [-2149.866] (-2157.684) (-2153.706) (-2152.863) * (-2149.769) (-2153.503) (-2152.866) [-2157.108] -- 0:02:31
      179000 -- [-2153.985] (-2148.484) (-2154.601) (-2151.390) * (-2158.080) (-2149.718) (-2153.805) [-2154.466] -- 0:02:31
      179500 -- (-2153.560) (-2150.460) [-2153.326] (-2158.122) * (-2150.986) (-2159.689) [-2150.736] (-2151.446) -- 0:02:30
      180000 -- (-2148.327) (-2152.801) (-2157.102) [-2157.824] * [-2151.244] (-2155.026) (-2155.043) (-2148.307) -- 0:02:30

      Average standard deviation of split frequencies: 0.001305

      180500 -- [-2148.613] (-2157.845) (-2155.989) (-2156.545) * [-2150.394] (-2151.622) (-2154.115) (-2149.606) -- 0:02:29
      181000 -- (-2148.493) (-2150.910) [-2155.526] (-2165.937) * (-2149.355) (-2154.165) (-2153.650) [-2157.472] -- 0:02:33
      181500 -- (-2152.821) [-2152.371] (-2161.225) (-2152.542) * (-2156.563) (-2160.920) [-2150.552] (-2151.971) -- 0:02:33
      182000 -- (-2152.386) (-2153.179) (-2153.090) [-2154.164] * (-2151.096) (-2158.739) (-2149.582) [-2153.054] -- 0:02:32
      182500 -- (-2152.037) (-2153.499) [-2156.112] (-2157.529) * (-2155.926) [-2150.758] (-2152.919) (-2153.772) -- 0:02:32
      183000 -- (-2150.108) (-2149.980) (-2152.659) [-2150.161] * (-2152.060) [-2148.278] (-2148.717) (-2152.366) -- 0:02:31
      183500 -- (-2155.888) (-2153.882) (-2151.689) [-2155.359] * (-2150.511) [-2151.507] (-2148.732) (-2158.377) -- 0:02:31
      184000 -- (-2152.278) (-2148.497) (-2154.713) [-2156.645] * [-2149.378] (-2154.812) (-2150.857) (-2156.804) -- 0:02:30
      184500 -- (-2157.076) [-2156.102] (-2153.010) (-2151.523) * [-2151.332] (-2152.582) (-2150.651) (-2162.421) -- 0:02:30
      185000 -- [-2151.830] (-2153.495) (-2153.660) (-2157.482) * (-2149.512) [-2148.324] (-2149.345) (-2159.204) -- 0:02:29

      Average standard deviation of split frequencies: 0.001267

      185500 -- (-2154.041) (-2158.780) [-2152.336] (-2153.569) * [-2151.758] (-2155.631) (-2152.111) (-2153.025) -- 0:02:29
      186000 -- [-2155.893] (-2149.934) (-2155.874) (-2155.350) * (-2149.085) (-2154.331) [-2149.162] (-2150.354) -- 0:02:28
      186500 -- [-2152.227] (-2153.665) (-2156.504) (-2152.761) * (-2153.986) (-2153.979) (-2164.245) [-2145.966] -- 0:02:32
      187000 -- (-2148.667) [-2156.466] (-2162.779) (-2151.478) * (-2150.836) [-2158.089] (-2157.511) (-2151.202) -- 0:02:32
      187500 -- [-2147.568] (-2155.511) (-2160.194) (-2160.850) * [-2152.223] (-2150.238) (-2156.455) (-2150.394) -- 0:02:31
      188000 -- (-2152.220) [-2150.169] (-2156.394) (-2149.930) * [-2150.050] (-2155.339) (-2153.538) (-2170.605) -- 0:02:31
      188500 -- [-2149.705] (-2149.165) (-2153.410) (-2149.860) * (-2155.071) (-2152.990) (-2154.301) [-2150.953] -- 0:02:30
      189000 -- (-2149.059) (-2157.910) (-2160.214) [-2154.282] * (-2153.153) (-2154.366) (-2154.048) [-2149.394] -- 0:02:30
      189500 -- (-2158.420) (-2153.841) [-2156.918] (-2151.778) * (-2162.136) (-2154.766) (-2156.019) [-2153.250] -- 0:02:29
      190000 -- (-2162.679) [-2151.060] (-2155.811) (-2150.695) * [-2155.188] (-2152.580) (-2151.593) (-2157.966) -- 0:02:29

      Average standard deviation of split frequencies: 0.001236

      190500 -- [-2156.668] (-2158.566) (-2150.930) (-2153.479) * (-2152.504) (-2152.647) [-2149.572] (-2151.283) -- 0:02:28
      191000 -- (-2153.559) (-2154.786) [-2153.156] (-2156.762) * [-2154.226] (-2150.466) (-2151.576) (-2154.166) -- 0:02:28
      191500 -- (-2152.691) (-2152.332) (-2157.629) [-2157.444] * (-2157.524) (-2153.220) [-2151.717] (-2153.481) -- 0:02:27
      192000 -- (-2156.286) (-2154.008) [-2156.548] (-2155.464) * (-2159.008) (-2151.184) [-2148.540] (-2157.810) -- 0:02:31
      192500 -- (-2151.374) (-2156.935) [-2152.902] (-2156.060) * (-2155.273) (-2150.138) (-2155.594) [-2151.785] -- 0:02:31
      193000 -- (-2156.644) (-2155.963) (-2155.821) [-2151.291] * [-2149.806] (-2149.507) (-2151.862) (-2148.795) -- 0:02:30
      193500 -- [-2148.393] (-2153.685) (-2152.886) (-2149.149) * (-2157.391) (-2153.071) (-2156.419) [-2155.402] -- 0:02:30
      194000 -- [-2149.463] (-2154.723) (-2149.330) (-2153.692) * [-2153.950] (-2152.257) (-2151.199) (-2155.368) -- 0:02:29
      194500 -- (-2157.357) (-2153.289) [-2156.582] (-2152.453) * [-2152.837] (-2155.495) (-2152.188) (-2153.321) -- 0:02:29
      195000 -- [-2151.876] (-2151.598) (-2159.420) (-2150.247) * (-2155.075) (-2155.283) (-2152.167) [-2150.241] -- 0:02:28

      Average standard deviation of split frequencies: 0.001203

      195500 -- (-2155.227) (-2158.738) (-2154.988) [-2149.896] * (-2154.617) (-2151.992) [-2149.831] (-2148.914) -- 0:02:28
      196000 -- [-2150.610] (-2151.988) (-2153.750) (-2150.333) * (-2156.309) (-2151.573) (-2151.585) [-2149.633] -- 0:02:27
      196500 -- (-2155.205) (-2153.192) [-2154.226] (-2149.822) * (-2148.212) [-2151.369] (-2157.402) (-2151.261) -- 0:02:27
      197000 -- (-2149.424) [-2150.216] (-2154.859) (-2149.506) * (-2149.392) (-2159.431) [-2155.926] (-2156.053) -- 0:02:30
      197500 -- (-2156.984) (-2154.528) (-2153.729) [-2152.996] * (-2146.935) (-2153.674) [-2156.954] (-2151.886) -- 0:02:30
      198000 -- (-2155.298) (-2154.033) (-2158.591) [-2149.857] * (-2150.458) (-2147.203) (-2152.738) [-2155.500] -- 0:02:29
      198500 -- (-2156.000) (-2153.522) [-2152.342] (-2152.703) * [-2147.845] (-2146.944) (-2155.117) (-2150.680) -- 0:02:29
      199000 -- (-2153.192) (-2151.625) (-2151.501) [-2153.643] * (-2153.987) [-2147.669] (-2150.208) (-2153.944) -- 0:02:28
      199500 -- [-2152.174] (-2154.322) (-2149.376) (-2155.544) * (-2161.905) [-2149.680] (-2152.159) (-2152.041) -- 0:02:28
      200000 -- [-2150.187] (-2151.030) (-2154.813) (-2150.442) * (-2164.572) (-2151.279) (-2153.546) [-2150.879] -- 0:02:28

      Average standard deviation of split frequencies: 0.001175

      200500 -- (-2159.255) (-2154.174) (-2160.504) [-2151.131] * (-2155.539) [-2151.953] (-2151.032) (-2151.046) -- 0:02:27
      201000 -- (-2156.297) (-2149.193) [-2154.492] (-2156.817) * (-2152.448) [-2149.874] (-2150.912) (-2151.065) -- 0:02:27
      201500 -- [-2149.271] (-2154.942) (-2152.258) (-2153.767) * (-2151.691) (-2153.856) (-2151.972) [-2153.367] -- 0:02:26
      202000 -- (-2153.947) (-2151.134) [-2150.342] (-2152.495) * (-2151.807) (-2150.226) [-2149.611] (-2149.315) -- 0:02:26
      202500 -- (-2153.917) (-2157.328) (-2153.815) [-2148.306] * [-2151.539] (-2149.495) (-2149.335) (-2150.201) -- 0:02:29
      203000 -- [-2156.138] (-2152.132) (-2154.620) (-2154.685) * (-2160.650) (-2157.962) (-2154.859) [-2155.959] -- 0:02:29
      203500 -- (-2155.930) [-2152.926] (-2150.073) (-2150.165) * (-2151.557) (-2157.018) [-2147.551] (-2153.906) -- 0:02:28
      204000 -- (-2152.574) (-2164.084) (-2153.689) [-2153.097] * [-2150.326] (-2154.752) (-2152.605) (-2156.898) -- 0:02:28
      204500 -- (-2153.560) (-2157.328) (-2155.455) [-2153.370] * [-2156.567] (-2155.322) (-2154.510) (-2154.549) -- 0:02:27
      205000 -- (-2153.737) (-2151.447) [-2154.218] (-2158.145) * (-2150.703) [-2152.027] (-2153.404) (-2157.489) -- 0:02:27

      Average standard deviation of split frequencies: 0.001144

      205500 -- (-2153.690) [-2150.950] (-2158.461) (-2159.727) * (-2148.806) [-2152.339] (-2150.946) (-2152.854) -- 0:02:26
      206000 -- [-2150.556] (-2150.215) (-2154.740) (-2156.216) * (-2151.784) (-2155.645) [-2156.154] (-2151.810) -- 0:02:26
      206500 -- (-2158.396) (-2153.109) [-2153.212] (-2159.674) * [-2151.878] (-2152.362) (-2153.996) (-2149.987) -- 0:02:26
      207000 -- (-2151.114) [-2151.896] (-2147.292) (-2153.135) * [-2157.948] (-2152.162) (-2155.195) (-2152.041) -- 0:02:25
      207500 -- [-2153.453] (-2150.368) (-2156.710) (-2152.070) * (-2155.754) (-2158.591) (-2161.907) [-2155.976] -- 0:02:25
      208000 -- (-2153.059) (-2153.825) (-2149.704) [-2149.071] * (-2149.243) (-2150.942) (-2151.580) [-2154.840] -- 0:02:28
      208500 -- (-2155.777) [-2155.755] (-2152.723) (-2152.323) * [-2150.088] (-2152.709) (-2155.898) (-2147.900) -- 0:02:28
      209000 -- [-2150.281] (-2162.199) (-2149.812) (-2151.150) * (-2157.715) (-2158.705) (-2153.457) [-2151.729] -- 0:02:27
      209500 -- (-2156.043) (-2154.392) (-2151.902) [-2153.566] * (-2153.750) [-2150.556] (-2151.402) (-2149.177) -- 0:02:27
      210000 -- (-2150.579) (-2154.457) [-2152.775] (-2154.838) * (-2148.284) [-2148.109] (-2152.471) (-2152.663) -- 0:02:26

      Average standard deviation of split frequencies: 0.001119

      210500 -- (-2151.595) (-2153.862) [-2153.505] (-2150.124) * (-2152.245) (-2155.228) (-2152.947) [-2152.687] -- 0:02:26
      211000 -- [-2152.106] (-2149.761) (-2154.437) (-2156.853) * (-2155.560) (-2152.005) [-2152.727] (-2162.450) -- 0:02:25
      211500 -- (-2152.329) (-2151.603) [-2149.787] (-2154.965) * (-2149.827) (-2149.827) (-2161.201) [-2151.475] -- 0:02:25
      212000 -- (-2150.070) [-2149.851] (-2152.010) (-2150.050) * (-2152.422) (-2147.593) [-2150.978] (-2150.943) -- 0:02:24
      212500 -- (-2151.708) (-2155.956) [-2150.340] (-2154.548) * (-2151.845) (-2152.124) [-2152.922] (-2153.656) -- 0:02:24
      213000 -- (-2151.439) (-2158.189) (-2152.241) [-2153.303] * (-2152.658) (-2160.971) [-2149.595] (-2155.214) -- 0:02:24
      213500 -- (-2151.097) [-2150.290] (-2155.601) (-2153.733) * (-2150.126) (-2151.345) [-2152.509] (-2154.925) -- 0:02:27
      214000 -- [-2158.747] (-2155.927) (-2156.353) (-2153.541) * (-2155.056) (-2150.751) (-2152.740) [-2153.912] -- 0:02:26
      214500 -- (-2152.408) [-2156.090] (-2150.681) (-2152.924) * (-2152.497) [-2155.012] (-2154.972) (-2162.271) -- 0:02:26
      215000 -- [-2149.696] (-2160.637) (-2148.597) (-2150.351) * [-2152.149] (-2148.496) (-2153.663) (-2160.263) -- 0:02:26

      Average standard deviation of split frequencies: 0.001091

      215500 -- (-2149.727) (-2152.516) [-2152.437] (-2152.367) * (-2151.347) [-2152.962] (-2150.599) (-2152.435) -- 0:02:25
      216000 -- (-2158.935) (-2154.042) [-2149.629] (-2153.016) * (-2152.302) (-2154.314) (-2154.688) [-2148.284] -- 0:02:25
      216500 -- (-2149.379) [-2148.562] (-2161.703) (-2155.890) * [-2148.621] (-2159.508) (-2158.734) (-2155.172) -- 0:02:24
      217000 -- (-2151.152) (-2155.791) (-2164.739) [-2154.045] * (-2153.991) (-2150.062) (-2154.369) [-2149.571] -- 0:02:24
      217500 -- (-2153.148) [-2149.390] (-2159.440) (-2158.869) * (-2150.255) [-2151.201] (-2163.525) (-2149.183) -- 0:02:23
      218000 -- (-2152.010) (-2150.816) [-2151.238] (-2153.954) * [-2148.732] (-2158.843) (-2157.407) (-2159.346) -- 0:02:23
      218500 -- (-2147.195) [-2153.873] (-2150.672) (-2159.331) * (-2149.905) (-2153.942) (-2151.077) [-2154.692] -- 0:02:26
      219000 -- [-2151.579] (-2151.914) (-2154.109) (-2153.303) * [-2148.207] (-2153.164) (-2152.019) (-2158.328) -- 0:02:26
      219500 -- (-2152.015) (-2152.391) (-2152.291) [-2149.403] * [-2148.042] (-2147.116) (-2149.934) (-2155.904) -- 0:02:25
      220000 -- (-2152.072) (-2158.811) [-2151.405] (-2152.533) * (-2154.247) [-2149.177] (-2149.285) (-2155.450) -- 0:02:25

      Average standard deviation of split frequencies: 0.001068

      220500 -- [-2153.029] (-2150.246) (-2152.136) (-2157.023) * [-2151.692] (-2151.015) (-2153.716) (-2157.651) -- 0:02:24
      221000 -- (-2153.740) (-2153.564) (-2149.248) [-2151.247] * (-2149.491) [-2147.598] (-2155.972) (-2156.023) -- 0:02:24
      221500 -- [-2148.927] (-2149.338) (-2152.956) (-2151.535) * (-2157.774) (-2148.787) (-2153.367) [-2151.020] -- 0:02:24
      222000 -- (-2150.840) [-2154.205] (-2154.261) (-2157.683) * (-2151.039) (-2152.493) (-2156.188) [-2153.206] -- 0:02:23
      222500 -- (-2156.600) (-2155.968) [-2151.865] (-2157.362) * (-2152.049) (-2154.436) [-2152.268] (-2151.348) -- 0:02:23
      223000 -- (-2155.100) (-2159.059) [-2149.174] (-2157.270) * (-2155.037) [-2152.567] (-2154.345) (-2153.235) -- 0:02:22
      223500 -- (-2152.823) (-2153.655) [-2149.936] (-2154.477) * (-2155.003) (-2151.285) (-2163.260) [-2152.081] -- 0:02:22
      224000 -- [-2149.895] (-2162.251) (-2150.751) (-2157.893) * [-2154.102] (-2151.461) (-2153.816) (-2161.028) -- 0:02:25
      224500 -- (-2156.986) (-2153.401) [-2148.328] (-2151.862) * (-2155.091) [-2153.429] (-2146.491) (-2152.693) -- 0:02:25
      225000 -- (-2157.179) [-2149.334] (-2154.095) (-2151.204) * (-2153.574) (-2152.476) [-2156.917] (-2155.716) -- 0:02:24

      Average standard deviation of split frequencies: 0.001043

      225500 -- (-2151.953) (-2160.151) [-2147.411] (-2154.136) * [-2154.452] (-2153.441) (-2156.075) (-2168.913) -- 0:02:24
      226000 -- (-2155.598) (-2158.453) (-2153.179) [-2154.606] * (-2157.557) (-2150.995) [-2147.929] (-2156.765) -- 0:02:23
      226500 -- (-2157.642) (-2162.546) [-2148.231] (-2150.194) * (-2158.483) (-2151.298) [-2156.376] (-2149.686) -- 0:02:23
      227000 -- (-2150.286) (-2154.961) (-2157.671) [-2148.822] * [-2158.213] (-2155.834) (-2152.722) (-2150.994) -- 0:02:23
      227500 -- (-2154.056) [-2153.088] (-2152.118) (-2150.273) * (-2156.541) [-2157.051] (-2155.274) (-2156.933) -- 0:02:22
      228000 -- (-2154.129) [-2152.398] (-2154.250) (-2159.393) * (-2161.775) (-2156.384) [-2152.375] (-2154.923) -- 0:02:22
      228500 -- (-2156.744) (-2151.782) [-2152.587] (-2157.637) * (-2150.277) (-2154.231) (-2152.130) [-2148.581] -- 0:02:21
      229000 -- [-2151.761] (-2159.117) (-2156.749) (-2154.944) * [-2150.976] (-2152.409) (-2148.697) (-2151.112) -- 0:02:21
      229500 -- (-2149.084) (-2156.543) [-2153.875] (-2157.468) * (-2155.293) (-2153.885) (-2147.666) [-2151.898] -- 0:02:24
      230000 -- [-2156.926] (-2149.313) (-2149.436) (-2152.581) * (-2153.157) [-2155.362] (-2152.315) (-2159.703) -- 0:02:23

      Average standard deviation of split frequencies: 0.001022

      230500 -- (-2155.818) (-2150.165) [-2153.857] (-2152.291) * (-2156.812) [-2149.368] (-2155.396) (-2151.984) -- 0:02:23
      231000 -- (-2150.753) (-2149.356) (-2158.672) [-2147.409] * (-2155.122) [-2147.009] (-2148.819) (-2153.821) -- 0:02:23
      231500 -- (-2158.247) [-2149.873] (-2148.954) (-2153.194) * (-2156.374) [-2148.689] (-2156.625) (-2151.550) -- 0:02:22
      232000 -- (-2152.534) [-2150.201] (-2159.625) (-2151.110) * [-2153.621] (-2152.635) (-2154.548) (-2152.591) -- 0:02:22
      232500 -- (-2153.114) (-2146.840) (-2151.097) [-2152.246] * (-2153.623) [-2153.148] (-2159.227) (-2156.823) -- 0:02:21
      233000 -- [-2153.904] (-2149.241) (-2152.567) (-2152.158) * (-2155.791) (-2157.893) (-2150.213) [-2149.439] -- 0:02:21
      233500 -- (-2150.902) [-2150.034] (-2158.732) (-2159.007) * (-2155.845) (-2149.257) [-2151.064] (-2153.368) -- 0:02:21
      234000 -- (-2156.213) (-2160.553) [-2161.065] (-2150.845) * (-2151.693) (-2156.121) (-2152.346) [-2151.888] -- 0:02:20
      234500 -- (-2155.068) (-2156.996) (-2157.546) [-2150.626] * (-2151.470) [-2155.097] (-2152.784) (-2157.970) -- 0:02:20
      235000 -- (-2157.406) (-2153.371) (-2158.550) [-2150.123] * [-2149.778] (-2153.999) (-2152.147) (-2150.279) -- 0:02:23

      Average standard deviation of split frequencies: 0.000999

      235500 -- (-2156.657) (-2156.318) [-2150.602] (-2155.905) * (-2152.021) (-2153.294) (-2154.378) [-2149.698] -- 0:02:22
      236000 -- (-2160.010) (-2151.174) [-2150.431] (-2161.732) * (-2155.262) (-2153.765) [-2151.290] (-2146.534) -- 0:02:22
      236500 -- [-2160.128] (-2150.110) (-2151.290) (-2153.854) * (-2151.911) (-2153.325) [-2150.651] (-2152.990) -- 0:02:22
      237000 -- [-2159.423] (-2155.195) (-2151.509) (-2151.178) * (-2152.146) (-2157.680) (-2155.436) [-2154.861] -- 0:02:21
      237500 -- (-2152.652) (-2159.615) (-2152.849) [-2149.240] * [-2150.551] (-2164.442) (-2155.539) (-2154.071) -- 0:02:21
      238000 -- (-2155.473) (-2155.910) [-2152.645] (-2153.197) * (-2153.439) (-2161.476) [-2156.331] (-2152.550) -- 0:02:20
      238500 -- (-2155.688) (-2162.241) [-2152.085] (-2152.908) * [-2151.084] (-2150.892) (-2158.587) (-2147.635) -- 0:02:20
      239000 -- (-2148.682) (-2158.944) (-2148.145) [-2152.411] * [-2147.050] (-2153.813) (-2153.789) (-2158.982) -- 0:02:20
      239500 -- [-2148.760] (-2147.910) (-2147.574) (-2155.298) * [-2150.870] (-2157.079) (-2151.700) (-2151.267) -- 0:02:19
      240000 -- [-2149.020] (-2152.938) (-2152.208) (-2151.799) * (-2155.795) (-2152.957) (-2158.954) [-2149.673] -- 0:02:19

      Average standard deviation of split frequencies: 0.000979

      240500 -- (-2161.746) [-2151.379] (-2150.689) (-2149.888) * [-2152.849] (-2157.014) (-2154.183) (-2148.388) -- 0:02:22
      241000 -- [-2153.761] (-2154.999) (-2164.996) (-2156.215) * (-2159.582) (-2147.480) (-2151.945) [-2150.496] -- 0:02:21
      241500 -- [-2154.436] (-2150.742) (-2152.478) (-2158.056) * (-2152.392) [-2151.683] (-2153.313) (-2151.699) -- 0:02:21
      242000 -- (-2153.563) (-2157.410) (-2156.126) [-2150.604] * (-2150.891) (-2154.257) (-2149.034) [-2149.724] -- 0:02:20
      242500 -- (-2151.904) (-2152.319) [-2149.677] (-2149.987) * (-2155.779) (-2155.270) [-2157.427] (-2152.845) -- 0:02:20
      243000 -- (-2149.608) [-2158.331] (-2150.525) (-2150.713) * (-2156.118) [-2155.822] (-2150.799) (-2153.939) -- 0:02:20
      243500 -- [-2152.370] (-2154.568) (-2149.097) (-2154.210) * [-2158.701] (-2154.064) (-2152.839) (-2155.458) -- 0:02:19
      244000 -- (-2148.920) (-2152.975) (-2150.140) [-2150.516] * [-2154.143] (-2158.885) (-2146.880) (-2155.271) -- 0:02:19
      244500 -- [-2153.721] (-2151.694) (-2155.460) (-2150.062) * (-2154.163) (-2152.507) (-2148.227) [-2156.088] -- 0:02:19
      245000 -- (-2154.477) (-2152.289) (-2148.923) [-2151.097] * (-2156.823) (-2157.404) [-2155.178] (-2158.800) -- 0:02:18

      Average standard deviation of split frequencies: 0.000958

      245500 -- (-2157.742) (-2164.148) [-2151.186] (-2148.462) * (-2150.804) (-2151.413) (-2155.472) [-2156.786] -- 0:02:18
      246000 -- (-2165.249) (-2153.008) [-2151.456] (-2158.426) * (-2146.979) (-2152.624) [-2148.255] (-2146.709) -- 0:02:20
      246500 -- (-2157.060) [-2154.754] (-2151.162) (-2158.401) * (-2154.208) (-2155.204) (-2149.004) [-2150.309] -- 0:02:20
      247000 -- [-2151.753] (-2150.980) (-2156.068) (-2156.204) * (-2154.317) (-2150.802) [-2152.579] (-2150.975) -- 0:02:20
      247500 -- [-2149.856] (-2152.379) (-2154.695) (-2154.790) * (-2154.970) [-2154.392] (-2150.053) (-2154.189) -- 0:02:19
      248000 -- [-2157.250] (-2154.664) (-2157.399) (-2150.929) * (-2157.886) (-2152.930) (-2156.106) [-2153.822] -- 0:02:19
      248500 -- (-2154.400) [-2150.833] (-2153.477) (-2152.946) * (-2153.033) [-2150.379] (-2158.082) (-2158.308) -- 0:02:19
      249000 -- (-2153.347) [-2149.263] (-2154.990) (-2159.104) * (-2153.471) [-2148.736] (-2154.260) (-2153.441) -- 0:02:18
      249500 -- (-2150.997) (-2150.633) (-2154.014) [-2154.995] * (-2151.032) (-2151.958) [-2151.847] (-2149.770) -- 0:02:18
      250000 -- [-2153.333] (-2153.921) (-2152.392) (-2149.761) * (-2153.813) (-2153.399) [-2149.703] (-2154.960) -- 0:02:18

      Average standard deviation of split frequencies: 0.000940

      250500 -- (-2150.697) (-2158.833) (-2154.577) [-2148.917] * (-2158.072) [-2150.228] (-2153.123) (-2148.233) -- 0:02:17
      251000 -- (-2155.118) (-2156.608) (-2152.642) [-2155.767] * (-2156.311) [-2148.676] (-2157.391) (-2148.767) -- 0:02:17
      251500 -- (-2159.770) (-2152.143) [-2154.212] (-2150.382) * [-2149.463] (-2154.016) (-2159.949) (-2149.955) -- 0:02:19
      252000 -- (-2154.446) (-2147.234) (-2150.048) [-2152.595] * [-2147.912] (-2154.566) (-2151.895) (-2155.331) -- 0:02:19
      252500 -- (-2151.250) [-2148.146] (-2149.028) (-2154.408) * [-2148.539] (-2152.378) (-2157.453) (-2151.769) -- 0:02:19
      253000 -- (-2149.907) [-2148.828] (-2151.479) (-2152.779) * (-2155.292) (-2155.910) [-2151.225] (-2150.186) -- 0:02:18
      253500 -- (-2155.101) (-2152.328) (-2150.995) [-2154.331] * (-2152.392) [-2150.659] (-2155.105) (-2150.541) -- 0:02:18
      254000 -- (-2149.408) (-2156.166) (-2151.202) [-2154.426] * (-2149.076) (-2145.529) [-2154.452] (-2152.714) -- 0:02:18
      254500 -- [-2150.261] (-2155.300) (-2155.831) (-2153.536) * (-2154.556) [-2149.626] (-2155.490) (-2150.142) -- 0:02:17
      255000 -- (-2150.709) (-2148.030) [-2151.620] (-2153.473) * (-2154.653) (-2150.880) [-2152.692] (-2153.232) -- 0:02:17

      Average standard deviation of split frequencies: 0.000921

      255500 -- (-2154.156) (-2152.351) [-2157.264] (-2149.440) * (-2154.812) (-2163.687) [-2154.992] (-2155.564) -- 0:02:16
      256000 -- (-2153.778) [-2147.804] (-2151.176) (-2151.482) * (-2159.588) (-2153.933) [-2153.752] (-2150.628) -- 0:02:16
      256500 -- (-2152.024) [-2151.215] (-2153.969) (-2151.187) * (-2165.803) (-2148.510) [-2150.847] (-2154.453) -- 0:02:19
      257000 -- [-2155.163] (-2151.153) (-2153.129) (-2151.559) * [-2158.548] (-2151.692) (-2153.138) (-2152.853) -- 0:02:18
      257500 -- [-2154.832] (-2152.468) (-2151.152) (-2152.813) * (-2157.624) (-2151.258) [-2155.109] (-2154.765) -- 0:02:18
      258000 -- (-2155.627) (-2153.072) [-2150.957] (-2153.445) * (-2154.430) [-2155.553] (-2149.920) (-2158.998) -- 0:02:18
      258500 -- (-2152.649) (-2156.580) [-2154.555] (-2153.441) * (-2152.136) [-2155.528] (-2155.543) (-2154.478) -- 0:02:17
      259000 -- (-2160.351) (-2152.337) [-2151.619] (-2153.396) * [-2150.467] (-2157.545) (-2153.468) (-2152.889) -- 0:02:17
      259500 -- (-2148.786) [-2153.213] (-2152.371) (-2152.467) * [-2153.326] (-2153.889) (-2148.395) (-2152.752) -- 0:02:16
      260000 -- (-2149.313) [-2153.914] (-2148.876) (-2151.137) * (-2150.720) (-2154.084) (-2153.259) [-2149.381] -- 0:02:16

      Average standard deviation of split frequencies: 0.000904

      260500 -- (-2151.470) (-2149.146) [-2152.247] (-2157.652) * (-2150.615) (-2163.466) (-2154.393) [-2149.563] -- 0:02:16
      261000 -- (-2154.017) [-2149.293] (-2151.712) (-2151.796) * (-2151.585) (-2149.039) [-2157.121] (-2153.152) -- 0:02:15
      261500 -- (-2158.362) (-2148.346) [-2147.976] (-2152.036) * (-2149.254) [-2158.618] (-2152.389) (-2152.419) -- 0:02:15
      262000 -- [-2150.822] (-2152.443) (-2154.722) (-2155.714) * [-2152.668] (-2162.131) (-2156.465) (-2150.549) -- 0:02:18
      262500 -- (-2148.195) (-2152.698) [-2153.870] (-2153.061) * (-2149.981) (-2155.345) (-2156.674) [-2149.532] -- 0:02:17
      263000 -- (-2153.910) (-2150.404) [-2156.157] (-2158.091) * (-2154.412) (-2157.127) [-2151.889] (-2153.589) -- 0:02:17
      263500 -- (-2147.733) (-2157.815) [-2149.015] (-2161.795) * (-2149.269) [-2150.288] (-2156.636) (-2152.041) -- 0:02:16
      264000 -- (-2155.698) [-2149.824] (-2152.976) (-2156.103) * [-2148.681] (-2149.765) (-2153.453) (-2152.763) -- 0:02:16
      264500 -- (-2162.175) [-2153.646] (-2148.394) (-2160.399) * [-2147.493] (-2151.986) (-2152.548) (-2161.172) -- 0:02:16
      265000 -- [-2155.618] (-2157.201) (-2152.818) (-2156.323) * (-2153.279) [-2152.681] (-2152.557) (-2157.569) -- 0:02:15

      Average standard deviation of split frequencies: 0.000886

      265500 -- (-2156.152) (-2153.680) [-2155.744] (-2155.690) * [-2153.631] (-2155.146) (-2153.405) (-2159.400) -- 0:02:15
      266000 -- [-2152.759] (-2155.542) (-2150.873) (-2150.143) * [-2155.710] (-2149.499) (-2151.107) (-2156.480) -- 0:02:15
      266500 -- (-2152.874) (-2148.835) (-2149.499) [-2153.285] * (-2156.600) (-2147.620) [-2148.692] (-2157.831) -- 0:02:14
      267000 -- [-2147.846] (-2151.661) (-2154.402) (-2149.990) * [-2153.808] (-2148.824) (-2162.027) (-2159.514) -- 0:02:14
      267500 -- [-2148.646] (-2151.266) (-2151.171) (-2156.522) * (-2155.487) [-2149.231] (-2151.415) (-2166.760) -- 0:02:16
      268000 -- [-2150.625] (-2155.278) (-2159.999) (-2151.299) * [-2152.303] (-2153.756) (-2152.708) (-2154.626) -- 0:02:16
      268500 -- (-2151.447) (-2150.253) [-2156.377] (-2147.763) * (-2152.142) [-2150.275] (-2153.097) (-2155.199) -- 0:02:16
      269000 -- (-2156.471) (-2155.833) (-2156.135) [-2148.584] * (-2152.521) [-2151.416] (-2155.535) (-2150.807) -- 0:02:15
      269500 -- [-2148.515] (-2157.356) (-2156.570) (-2151.994) * (-2153.801) [-2151.987] (-2149.133) (-2153.086) -- 0:02:15
      270000 -- [-2151.988] (-2149.711) (-2152.452) (-2153.062) * (-2150.620) [-2150.991] (-2161.492) (-2158.718) -- 0:02:15

      Average standard deviation of split frequencies: 0.000871

      270500 -- (-2154.753) (-2151.790) (-2153.599) [-2150.966] * (-2157.726) (-2148.893) [-2156.724] (-2153.196) -- 0:02:14
      271000 -- (-2151.774) [-2151.611] (-2154.659) (-2158.655) * [-2149.576] (-2150.457) (-2150.541) (-2158.737) -- 0:02:14
      271500 -- (-2154.297) (-2152.929) (-2161.453) [-2149.041] * (-2149.334) (-2154.752) [-2152.804] (-2151.053) -- 0:02:14
      272000 -- [-2156.766] (-2160.463) (-2151.402) (-2152.709) * [-2149.867] (-2157.507) (-2149.750) (-2154.424) -- 0:02:13
      272500 -- (-2153.600) (-2153.322) (-2158.209) [-2153.009] * (-2151.386) (-2153.610) (-2155.567) [-2152.736] -- 0:02:13
      273000 -- (-2153.149) [-2151.230] (-2152.995) (-2150.306) * [-2149.932] (-2156.939) (-2155.121) (-2151.138) -- 0:02:15
      273500 -- (-2159.073) (-2148.909) [-2150.027] (-2157.207) * [-2154.988] (-2151.944) (-2154.530) (-2149.214) -- 0:02:15
      274000 -- [-2150.483] (-2155.585) (-2155.404) (-2151.600) * (-2155.507) (-2152.934) (-2151.999) [-2150.590] -- 0:02:15
      274500 -- (-2151.376) (-2151.078) [-2149.949] (-2148.436) * [-2152.221] (-2160.025) (-2156.059) (-2154.651) -- 0:02:14
      275000 -- [-2147.814] (-2154.942) (-2147.925) (-2151.079) * (-2156.795) (-2157.165) (-2152.495) [-2155.220] -- 0:02:14

      Average standard deviation of split frequencies: 0.000854

      275500 -- (-2151.244) [-2155.891] (-2150.593) (-2152.354) * (-2162.245) (-2156.557) [-2148.616] (-2153.263) -- 0:02:14
      276000 -- (-2155.829) (-2151.416) (-2150.570) [-2150.122] * (-2162.314) (-2158.442) (-2158.981) [-2153.751] -- 0:02:13
      276500 -- (-2159.913) [-2152.299] (-2150.704) (-2150.356) * (-2152.516) (-2151.232) [-2152.879] (-2155.140) -- 0:02:13
      277000 -- [-2153.102] (-2161.017) (-2157.459) (-2153.422) * [-2153.526] (-2154.078) (-2154.650) (-2154.991) -- 0:02:13
      277500 -- (-2150.827) [-2155.779] (-2151.644) (-2149.844) * (-2156.543) (-2150.135) (-2156.441) [-2151.217] -- 0:02:12
      278000 -- (-2151.818) (-2154.059) (-2152.396) [-2149.989] * (-2154.161) [-2155.594] (-2152.946) (-2153.963) -- 0:02:12
      278500 -- [-2150.429] (-2154.453) (-2160.066) (-2153.635) * (-2157.446) (-2153.748) (-2153.298) [-2150.086] -- 0:02:14
      279000 -- [-2151.734] (-2158.049) (-2150.177) (-2155.066) * [-2156.116] (-2155.673) (-2156.742) (-2156.391) -- 0:02:14
      279500 -- [-2150.875] (-2157.106) (-2149.523) (-2150.698) * (-2151.151) (-2153.797) (-2154.507) [-2153.114] -- 0:02:14
      280000 -- [-2151.588] (-2155.574) (-2159.204) (-2150.651) * (-2160.330) (-2151.976) [-2153.417] (-2151.916) -- 0:02:13

      Average standard deviation of split frequencies: 0.000840

      280500 -- [-2150.918] (-2160.323) (-2152.117) (-2159.963) * (-2155.596) [-2149.020] (-2146.774) (-2155.284) -- 0:02:13
      281000 -- (-2151.419) (-2168.513) [-2149.577] (-2158.563) * (-2155.793) [-2160.040] (-2156.417) (-2156.933) -- 0:02:13
      281500 -- (-2155.319) (-2158.131) [-2151.141] (-2157.615) * (-2150.316) (-2152.535) [-2155.401] (-2153.704) -- 0:02:12
      282000 -- (-2157.015) (-2150.057) (-2153.824) [-2149.575] * (-2149.105) (-2152.196) [-2150.618] (-2152.484) -- 0:02:12
      282500 -- (-2151.335) (-2147.918) [-2151.612] (-2156.976) * (-2149.881) [-2157.154] (-2150.549) (-2155.185) -- 0:02:12
      283000 -- (-2151.299) (-2152.098) (-2149.434) [-2148.989] * [-2146.417] (-2155.838) (-2150.896) (-2153.195) -- 0:02:11
      283500 -- (-2150.776) (-2152.555) [-2154.386] (-2153.178) * [-2151.798] (-2153.355) (-2152.393) (-2156.264) -- 0:02:11
      284000 -- (-2148.849) (-2157.580) [-2153.679] (-2155.890) * (-2154.779) [-2149.266] (-2153.658) (-2150.383) -- 0:02:13
      284500 -- (-2151.230) (-2153.291) [-2153.832] (-2149.444) * (-2152.512) (-2157.627) [-2154.571] (-2152.276) -- 0:02:13
      285000 -- (-2150.048) (-2152.580) (-2155.773) [-2151.886] * [-2151.385] (-2157.463) (-2148.963) (-2152.548) -- 0:02:12

      Average standard deviation of split frequencies: 0.000824

      285500 -- [-2153.272] (-2155.742) (-2155.493) (-2149.646) * (-2150.510) (-2161.173) [-2152.595] (-2153.307) -- 0:02:12
      286000 -- [-2149.717] (-2149.864) (-2153.749) (-2153.470) * [-2150.316] (-2155.096) (-2157.144) (-2153.183) -- 0:02:12
      286500 -- [-2147.380] (-2152.485) (-2165.067) (-2150.951) * [-2149.985] (-2165.911) (-2149.700) (-2157.066) -- 0:02:11
      287000 -- [-2148.925] (-2149.449) (-2157.577) (-2152.012) * [-2152.385] (-2150.837) (-2153.829) (-2155.266) -- 0:02:11
      287500 -- (-2159.904) (-2159.827) (-2150.848) [-2150.578] * (-2153.193) [-2151.248] (-2151.864) (-2156.090) -- 0:02:11
      288000 -- (-2151.858) [-2152.881] (-2156.373) (-2152.998) * (-2149.472) (-2154.442) [-2149.117] (-2157.272) -- 0:02:11
      288500 -- (-2149.318) [-2152.513] (-2159.443) (-2161.398) * [-2149.961] (-2151.786) (-2153.236) (-2155.862) -- 0:02:10
      289000 -- (-2153.319) [-2149.687] (-2154.636) (-2155.805) * (-2152.215) (-2155.112) (-2151.906) [-2150.428] -- 0:02:10
      289500 -- [-2149.434] (-2164.510) (-2149.150) (-2160.743) * (-2152.173) (-2152.979) (-2152.341) [-2153.073] -- 0:02:12
      290000 -- (-2153.571) [-2149.196] (-2150.860) (-2156.903) * (-2155.137) [-2157.321] (-2154.628) (-2162.020) -- 0:02:12

      Average standard deviation of split frequencies: 0.000811

      290500 -- (-2153.826) (-2153.490) [-2149.099] (-2153.909) * (-2160.162) [-2153.422] (-2152.028) (-2156.336) -- 0:02:11
      291000 -- (-2156.958) [-2150.163] (-2152.440) (-2159.043) * (-2151.434) (-2151.247) [-2150.917] (-2155.008) -- 0:02:11
      291500 -- (-2159.079) [-2150.011] (-2152.236) (-2154.074) * (-2152.766) (-2149.970) (-2152.892) [-2153.166] -- 0:02:11
      292000 -- [-2155.021] (-2154.374) (-2156.974) (-2155.926) * (-2154.417) (-2157.719) [-2150.609] (-2154.385) -- 0:02:10
      292500 -- [-2151.957] (-2154.281) (-2151.513) (-2148.934) * (-2152.099) (-2153.544) (-2151.356) [-2152.648] -- 0:02:10
      293000 -- (-2153.200) [-2152.799] (-2156.767) (-2151.689) * (-2149.429) (-2160.164) [-2151.348] (-2154.868) -- 0:02:10
      293500 -- [-2151.608] (-2161.078) (-2155.907) (-2152.344) * (-2149.817) (-2151.884) (-2155.146) [-2152.605] -- 0:02:09
      294000 -- (-2157.939) (-2162.641) (-2149.700) [-2154.030] * (-2150.163) [-2149.707] (-2156.791) (-2152.482) -- 0:02:09
      294500 -- (-2153.420) [-2156.553] (-2152.223) (-2148.855) * [-2154.438] (-2155.686) (-2154.081) (-2153.724) -- 0:02:11
      295000 -- [-2149.852] (-2154.409) (-2157.417) (-2151.340) * (-2155.663) [-2154.537] (-2152.589) (-2152.137) -- 0:02:11

      Average standard deviation of split frequencies: 0.000796

      295500 -- [-2147.647] (-2154.317) (-2150.397) (-2157.079) * [-2161.184] (-2153.660) (-2151.071) (-2152.056) -- 0:02:11
      296000 -- (-2153.741) [-2154.948] (-2149.915) (-2158.095) * (-2150.296) (-2152.749) [-2152.356] (-2147.523) -- 0:02:10
      296500 -- [-2147.749] (-2150.674) (-2152.852) (-2149.754) * (-2152.345) (-2151.473) (-2146.660) [-2151.981] -- 0:02:10
      297000 -- [-2150.507] (-2159.454) (-2151.171) (-2146.831) * [-2154.086] (-2152.424) (-2152.228) (-2160.361) -- 0:02:10
      297500 -- (-2157.518) [-2152.120] (-2156.309) (-2152.958) * (-2152.759) (-2147.628) [-2149.526] (-2155.533) -- 0:02:09
      298000 -- [-2150.102] (-2153.323) (-2154.865) (-2154.037) * (-2151.225) (-2152.240) [-2148.360] (-2158.784) -- 0:02:09
      298500 -- (-2152.971) (-2151.386) [-2157.705] (-2151.901) * (-2153.416) (-2150.876) [-2153.795] (-2154.965) -- 0:02:09
      299000 -- (-2151.599) [-2149.844] (-2153.858) (-2154.547) * (-2150.216) (-2150.606) [-2153.883] (-2154.022) -- 0:02:08
      299500 -- [-2148.622] (-2153.348) (-2153.969) (-2150.164) * (-2154.010) [-2157.445] (-2154.364) (-2157.115) -- 0:02:08
      300000 -- [-2149.906] (-2157.706) (-2164.574) (-2150.488) * (-2151.208) (-2152.034) (-2156.774) [-2157.853] -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-2155.669) (-2151.606) [-2150.924] (-2155.993) * (-2156.007) (-2151.172) [-2150.291] (-2159.659) -- 0:02:10
      301000 -- [-2151.015] (-2159.624) (-2152.391) (-2156.984) * (-2158.878) (-2149.990) (-2153.375) [-2160.903] -- 0:02:10
      301500 -- [-2152.089] (-2152.094) (-2154.798) (-2156.262) * (-2151.995) [-2147.545] (-2157.781) (-2155.785) -- 0:02:09
      302000 -- (-2150.297) [-2158.963] (-2151.401) (-2154.724) * (-2148.046) (-2156.102) (-2157.620) [-2153.675] -- 0:02:09
      302500 -- (-2151.096) [-2158.079] (-2148.718) (-2154.556) * (-2154.339) (-2152.276) (-2156.103) [-2150.940] -- 0:02:09
      303000 -- (-2162.378) (-2158.703) (-2151.138) [-2153.878] * [-2149.687] (-2156.064) (-2158.655) (-2153.307) -- 0:02:08
      303500 -- (-2150.492) (-2160.880) (-2158.452) [-2148.793] * [-2152.320] (-2153.842) (-2162.618) (-2150.104) -- 0:02:08
      304000 -- (-2150.279) (-2152.895) (-2147.286) [-2150.836] * [-2151.462] (-2150.708) (-2159.304) (-2151.487) -- 0:02:08
      304500 -- (-2150.148) (-2159.439) (-2151.408) [-2153.891] * (-2147.173) [-2148.898] (-2158.634) (-2156.948) -- 0:02:07
      305000 -- (-2151.222) (-2152.844) [-2151.077] (-2154.595) * (-2152.989) (-2152.669) (-2161.894) [-2162.182] -- 0:02:07

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-2153.928) [-2151.374] (-2155.966) (-2155.951) * [-2149.523] (-2155.731) (-2153.951) (-2153.953) -- 0:02:09
      306000 -- [-2151.188] (-2155.311) (-2149.816) (-2153.192) * [-2151.636] (-2153.600) (-2152.944) (-2149.131) -- 0:02:09
      306500 -- (-2148.255) (-2156.639) [-2151.869] (-2150.212) * (-2151.245) (-2154.866) (-2155.561) [-2149.258] -- 0:02:08
      307000 -- (-2150.839) (-2154.801) (-2149.545) [-2150.098] * (-2158.596) (-2157.097) [-2150.503] (-2150.534) -- 0:02:08
      307500 -- (-2155.596) (-2150.558) (-2150.505) [-2153.729] * (-2156.732) [-2151.406] (-2151.631) (-2155.804) -- 0:02:08
      308000 -- (-2157.334) (-2150.609) (-2151.709) [-2153.013] * (-2156.686) (-2154.368) (-2158.101) [-2147.231] -- 0:02:08
      308500 -- (-2154.077) [-2151.196] (-2156.916) (-2153.667) * (-2155.273) (-2158.394) [-2150.608] (-2148.981) -- 0:02:07
      309000 -- (-2154.988) (-2154.051) [-2150.760] (-2158.903) * (-2157.707) (-2155.626) (-2147.454) [-2146.917] -- 0:02:07
      309500 -- (-2157.654) [-2150.859] (-2151.418) (-2161.469) * (-2158.397) [-2151.991] (-2153.250) (-2154.297) -- 0:02:07
      310000 -- (-2165.723) [-2152.596] (-2153.109) (-2159.726) * [-2149.155] (-2168.592) (-2157.451) (-2152.780) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-2156.826) (-2153.741) (-2154.456) [-2151.384] * [-2151.097] (-2157.260) (-2148.045) (-2152.321) -- 0:02:06
      311000 -- (-2152.991) (-2151.253) (-2157.361) [-2149.950] * (-2150.807) [-2156.741] (-2153.726) (-2154.529) -- 0:02:08
      311500 -- (-2148.643) (-2157.825) [-2152.738] (-2147.878) * (-2152.400) (-2156.686) (-2155.342) [-2149.767] -- 0:02:08
      312000 -- [-2161.349] (-2149.880) (-2159.112) (-2148.552) * [-2155.987] (-2152.083) (-2153.146) (-2148.706) -- 0:02:07
      312500 -- (-2153.833) (-2150.208) (-2150.903) [-2151.485] * (-2148.963) (-2154.588) (-2157.010) [-2152.441] -- 0:02:07
      313000 -- (-2150.128) [-2150.984] (-2147.781) (-2150.761) * (-2153.453) [-2153.860] (-2151.534) (-2151.488) -- 0:02:07
      313500 -- [-2146.793] (-2152.258) (-2151.388) (-2151.104) * (-2156.134) (-2153.126) (-2151.633) [-2151.839] -- 0:02:07
      314000 -- (-2149.721) (-2154.064) [-2147.012] (-2149.534) * [-2154.121] (-2148.049) (-2153.307) (-2152.617) -- 0:02:06
      314500 -- (-2154.266) (-2152.241) (-2151.256) [-2150.265] * [-2149.367] (-2149.322) (-2149.649) (-2151.164) -- 0:02:06
      315000 -- [-2156.194] (-2154.404) (-2152.896) (-2157.495) * (-2152.841) [-2153.131] (-2155.942) (-2151.696) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-2155.641) (-2151.748) (-2154.001) [-2155.277] * [-2147.630] (-2150.147) (-2156.345) (-2154.010) -- 0:02:05
      316000 -- (-2159.220) (-2153.607) [-2159.916] (-2155.876) * (-2154.308) (-2158.752) (-2152.902) [-2156.305] -- 0:02:05
      316500 -- [-2149.109] (-2156.895) (-2153.828) (-2153.570) * (-2148.168) (-2152.388) [-2150.232] (-2157.012) -- 0:02:07
      317000 -- (-2156.414) (-2156.691) (-2151.831) [-2151.188] * (-2153.227) [-2151.206] (-2159.126) (-2152.409) -- 0:02:07
      317500 -- (-2153.794) [-2156.778] (-2161.609) (-2154.360) * (-2152.233) (-2156.615) (-2151.052) [-2156.309] -- 0:02:06
      318000 -- [-2153.464] (-2154.612) (-2155.983) (-2149.161) * (-2154.648) [-2149.007] (-2151.555) (-2158.447) -- 0:02:06
      318500 -- (-2152.589) [-2151.616] (-2154.454) (-2151.507) * [-2155.729] (-2148.069) (-2152.997) (-2157.202) -- 0:02:06
      319000 -- [-2150.845] (-2151.486) (-2158.577) (-2153.555) * (-2155.348) [-2155.970] (-2152.928) (-2159.919) -- 0:02:05
      319500 -- [-2151.320] (-2154.773) (-2159.128) (-2150.399) * [-2152.008] (-2156.059) (-2151.167) (-2156.128) -- 0:02:05
      320000 -- [-2148.893] (-2159.394) (-2156.274) (-2150.829) * (-2157.097) (-2157.397) [-2155.145] (-2150.575) -- 0:02:05

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-2149.951) (-2152.977) [-2152.446] (-2151.622) * (-2161.324) [-2152.151] (-2154.937) (-2160.546) -- 0:02:05
      321000 -- (-2149.052) (-2156.523) [-2148.937] (-2147.511) * (-2151.009) (-2152.060) (-2158.784) [-2154.450] -- 0:02:04
      321500 -- [-2155.761] (-2152.910) (-2148.787) (-2152.159) * [-2150.772] (-2151.711) (-2151.396) (-2149.221) -- 0:02:04
      322000 -- (-2151.887) [-2155.978] (-2149.340) (-2153.681) * (-2148.177) (-2154.906) (-2150.367) [-2147.594] -- 0:02:06
      322500 -- (-2154.244) [-2151.753] (-2157.030) (-2149.403) * (-2152.920) [-2155.266] (-2151.000) (-2154.742) -- 0:02:06
      323000 -- [-2160.600] (-2150.264) (-2155.507) (-2149.136) * (-2152.492) (-2156.489) (-2151.379) [-2151.013] -- 0:02:05
      323500 -- (-2154.281) (-2152.093) [-2159.326] (-2149.198) * [-2154.627] (-2155.872) (-2155.155) (-2146.412) -- 0:02:05
      324000 -- (-2150.327) (-2151.871) [-2152.177] (-2150.627) * [-2146.562] (-2151.653) (-2157.908) (-2149.155) -- 0:02:05
      324500 -- (-2154.335) [-2149.293] (-2158.228) (-2152.467) * (-2149.840) [-2152.858] (-2152.069) (-2156.356) -- 0:02:04
      325000 -- (-2154.418) (-2152.899) (-2159.642) [-2154.937] * (-2154.749) (-2152.617) (-2154.295) [-2151.576] -- 0:02:04

      Average standard deviation of split frequencies: 0.000723

      325500 -- [-2149.235] (-2147.772) (-2155.614) (-2155.434) * [-2157.577] (-2151.841) (-2153.419) (-2153.437) -- 0:02:04
      326000 -- (-2150.146) [-2150.878] (-2154.287) (-2154.506) * (-2155.051) (-2155.490) (-2154.274) [-2155.753] -- 0:02:04
      326500 -- (-2151.391) (-2156.300) [-2152.595] (-2153.430) * (-2156.491) (-2151.056) (-2154.353) [-2151.561] -- 0:02:03
      327000 -- (-2153.735) (-2156.122) (-2152.356) [-2154.157] * [-2151.285] (-2150.007) (-2148.696) (-2154.049) -- 0:02:05
      327500 -- (-2155.410) [-2152.681] (-2162.097) (-2150.185) * (-2154.657) (-2153.836) [-2155.642] (-2151.681) -- 0:02:05
      328000 -- [-2150.029] (-2165.672) (-2152.721) (-2158.305) * (-2152.113) [-2151.618] (-2154.598) (-2157.748) -- 0:02:04
      328500 -- [-2150.423] (-2157.849) (-2161.308) (-2157.957) * (-2156.410) (-2154.325) [-2153.005] (-2152.360) -- 0:02:04
      329000 -- (-2150.475) (-2154.324) (-2156.090) [-2150.476] * (-2149.067) (-2155.368) [-2151.894] (-2160.001) -- 0:02:04
      329500 -- (-2149.553) (-2148.069) [-2154.664] (-2152.687) * [-2148.332] (-2156.393) (-2155.370) (-2152.898) -- 0:02:04
      330000 -- (-2150.974) (-2151.651) (-2153.286) [-2150.082] * [-2149.738] (-2149.474) (-2151.745) (-2148.596) -- 0:02:03

      Average standard deviation of split frequencies: 0.000713

      330500 -- (-2154.327) (-2152.482) [-2152.214] (-2154.225) * (-2154.618) [-2153.860] (-2152.109) (-2156.861) -- 0:02:03
      331000 -- [-2149.483] (-2159.266) (-2152.522) (-2151.379) * (-2153.903) (-2147.262) (-2156.106) [-2152.099] -- 0:02:03
      331500 -- (-2149.166) (-2156.862) (-2153.515) [-2156.760] * (-2149.879) [-2154.542] (-2153.538) (-2154.791) -- 0:02:03
      332000 -- (-2150.847) (-2161.342) [-2155.332] (-2148.593) * (-2154.556) [-2152.827] (-2152.093) (-2152.657) -- 0:02:02
      332500 -- (-2155.472) (-2152.287) [-2154.320] (-2150.016) * (-2153.090) [-2151.367] (-2156.646) (-2150.215) -- 0:02:04
      333000 -- [-2152.166] (-2161.829) (-2154.342) (-2160.214) * (-2153.045) (-2154.771) (-2162.844) [-2158.740] -- 0:02:04
      333500 -- (-2150.804) (-2157.750) [-2146.957] (-2153.654) * (-2158.882) (-2155.130) [-2154.387] (-2156.866) -- 0:02:03
      334000 -- [-2150.531] (-2158.768) (-2153.632) (-2152.419) * (-2153.485) (-2152.981) (-2154.505) [-2153.534] -- 0:02:03
      334500 -- (-2151.745) (-2154.371) (-2154.315) [-2160.594] * [-2154.972] (-2151.638) (-2152.463) (-2155.938) -- 0:02:03
      335000 -- (-2155.749) (-2155.956) [-2147.950] (-2156.930) * [-2151.360] (-2153.336) (-2153.111) (-2153.880) -- 0:02:03

      Average standard deviation of split frequencies: 0.000701

      335500 -- [-2153.495] (-2151.926) (-2152.952) (-2160.723) * (-2148.148) (-2149.437) (-2153.530) [-2155.031] -- 0:02:02
      336000 -- (-2160.061) (-2159.566) (-2154.525) [-2152.066] * [-2152.801] (-2161.603) (-2151.605) (-2155.355) -- 0:02:02
      336500 -- (-2153.618) (-2155.200) (-2159.966) [-2153.334] * (-2156.307) (-2150.886) [-2148.140] (-2152.366) -- 0:02:02
      337000 -- [-2151.613] (-2156.389) (-2154.987) (-2149.739) * [-2152.669] (-2150.944) (-2154.617) (-2154.484) -- 0:02:01
      337500 -- (-2153.311) (-2150.991) [-2153.235] (-2152.716) * (-2152.238) [-2153.257] (-2148.923) (-2158.578) -- 0:02:01
      338000 -- [-2150.854] (-2149.347) (-2152.427) (-2151.941) * (-2152.385) [-2148.160] (-2160.909) (-2156.825) -- 0:02:03
      338500 -- (-2156.395) (-2153.847) [-2150.829] (-2151.456) * (-2157.882) (-2155.444) (-2161.309) [-2157.157] -- 0:02:03
      339000 -- (-2152.374) (-2155.262) [-2151.359] (-2150.134) * (-2156.823) (-2155.329) (-2156.569) [-2162.636] -- 0:02:02
      339500 -- (-2152.394) (-2153.678) (-2151.969) [-2150.891] * [-2156.058] (-2161.712) (-2151.468) (-2153.376) -- 0:02:02
      340000 -- (-2159.459) (-2151.776) (-2151.163) [-2153.770] * (-2152.942) (-2156.611) [-2150.572] (-2150.263) -- 0:02:02

      Average standard deviation of split frequencies: 0.000692

      340500 -- (-2153.667) (-2151.571) [-2151.212] (-2155.843) * (-2167.303) (-2156.585) [-2154.875] (-2152.375) -- 0:02:02
      341000 -- [-2153.361] (-2151.255) (-2150.610) (-2166.478) * (-2151.154) (-2152.401) [-2155.600] (-2153.673) -- 0:02:01
      341500 -- (-2158.505) (-2153.121) [-2147.693] (-2159.228) * [-2152.743] (-2152.322) (-2158.166) (-2158.981) -- 0:02:01
      342000 -- (-2153.493) [-2161.225] (-2151.549) (-2148.901) * (-2149.288) [-2150.525] (-2162.491) (-2151.678) -- 0:02:01
      342500 -- (-2150.403) [-2153.836] (-2156.956) (-2152.607) * [-2148.841] (-2149.581) (-2159.723) (-2152.384) -- 0:02:00
      343000 -- (-2153.712) (-2157.575) (-2154.531) [-2158.599] * (-2148.306) (-2158.359) (-2154.658) [-2154.110] -- 0:02:00
      343500 -- (-2152.331) [-2152.070] (-2155.151) (-2151.288) * [-2152.615] (-2168.424) (-2153.726) (-2156.249) -- 0:02:02
      344000 -- [-2158.583] (-2154.696) (-2159.037) (-2151.734) * (-2155.138) (-2156.313) [-2153.978] (-2151.057) -- 0:02:02
      344500 -- (-2154.776) (-2152.858) [-2162.397] (-2152.860) * (-2152.398) (-2154.358) [-2147.763] (-2150.078) -- 0:02:01
      345000 -- (-2155.621) (-2158.668) [-2150.069] (-2153.645) * [-2149.578] (-2153.897) (-2149.178) (-2153.917) -- 0:02:01

      Average standard deviation of split frequencies: 0.000681

      345500 -- (-2153.878) (-2151.876) [-2150.221] (-2154.864) * (-2156.218) (-2151.195) [-2152.289] (-2156.799) -- 0:02:01
      346000 -- [-2158.272] (-2152.628) (-2152.129) (-2157.847) * [-2152.142] (-2149.408) (-2152.516) (-2154.227) -- 0:02:00
      346500 -- (-2159.850) (-2157.401) (-2154.160) [-2151.896] * (-2149.778) (-2149.395) (-2148.902) [-2151.781] -- 0:02:00
      347000 -- (-2148.575) (-2154.544) [-2156.643] (-2149.662) * (-2148.652) (-2152.052) [-2154.209] (-2152.739) -- 0:02:00
      347500 -- (-2146.996) (-2166.479) (-2153.455) [-2158.937] * (-2152.866) (-2155.486) (-2157.600) [-2153.779] -- 0:02:00
      348000 -- (-2152.289) (-2155.277) (-2159.838) [-2155.157] * (-2150.586) [-2147.007] (-2154.880) (-2155.179) -- 0:01:59
      348500 -- (-2152.711) (-2150.334) (-2160.720) [-2153.522] * [-2152.650] (-2162.417) (-2154.203) (-2154.559) -- 0:01:59
      349000 -- (-2148.866) (-2160.030) [-2153.938] (-2151.796) * (-2150.238) [-2153.315] (-2159.183) (-2149.855) -- 0:02:01
      349500 -- (-2153.968) (-2155.235) [-2152.037] (-2156.047) * (-2156.651) [-2151.876] (-2155.182) (-2157.039) -- 0:02:00
      350000 -- [-2151.812] (-2152.305) (-2151.650) (-2155.913) * (-2158.111) [-2150.823] (-2160.236) (-2154.581) -- 0:02:00

      Average standard deviation of split frequencies: 0.000672

      350500 -- (-2150.199) [-2151.015] (-2149.689) (-2159.635) * [-2147.610] (-2158.767) (-2159.617) (-2151.226) -- 0:02:00
      351000 -- (-2153.352) (-2150.953) [-2150.682] (-2158.465) * (-2153.469) (-2153.495) (-2158.425) [-2151.377] -- 0:02:00
      351500 -- (-2150.386) [-2152.518] (-2158.060) (-2155.944) * (-2152.173) [-2152.093] (-2156.339) (-2154.563) -- 0:01:59
      352000 -- (-2151.294) (-2159.066) [-2149.912] (-2151.549) * (-2154.741) (-2162.415) (-2161.182) [-2150.712] -- 0:01:59
      352500 -- (-2157.765) (-2156.851) [-2154.863] (-2157.202) * (-2154.878) (-2160.163) (-2153.308) [-2151.570] -- 0:01:59
      353000 -- (-2153.632) [-2160.379] (-2152.859) (-2151.978) * (-2158.163) [-2157.644] (-2154.993) (-2151.268) -- 0:01:59
      353500 -- [-2148.080] (-2155.233) (-2154.745) (-2149.785) * (-2158.228) [-2147.852] (-2153.996) (-2154.980) -- 0:01:58
      354000 -- [-2147.707] (-2150.307) (-2158.598) (-2153.268) * (-2157.625) (-2150.808) (-2160.980) [-2149.620] -- 0:01:58
      354500 -- (-2151.023) [-2149.105] (-2151.876) (-2151.869) * (-2158.296) (-2154.988) (-2156.691) [-2157.184] -- 0:02:00
      355000 -- [-2152.212] (-2153.236) (-2156.466) (-2154.392) * (-2155.370) (-2153.365) (-2153.565) [-2151.124] -- 0:01:59

      Average standard deviation of split frequencies: 0.000662

      355500 -- [-2153.334] (-2154.328) (-2150.411) (-2152.563) * (-2153.264) [-2152.338] (-2158.221) (-2151.161) -- 0:01:59
      356000 -- (-2156.073) (-2152.250) [-2147.901] (-2150.516) * (-2157.291) (-2149.056) (-2165.416) [-2153.838] -- 0:01:59
      356500 -- [-2155.739] (-2156.159) (-2154.937) (-2147.901) * (-2164.388) (-2150.931) (-2159.025) [-2154.146] -- 0:01:59
      357000 -- [-2150.816] (-2153.305) (-2150.738) (-2153.873) * [-2154.653] (-2156.946) (-2171.375) (-2152.936) -- 0:01:58
      357500 -- (-2152.723) (-2150.487) (-2149.987) [-2153.186] * (-2159.014) (-2149.586) (-2164.457) [-2147.801] -- 0:01:58
      358000 -- [-2152.383] (-2150.635) (-2153.224) (-2149.702) * [-2151.098] (-2159.321) (-2154.299) (-2155.471) -- 0:01:58
      358500 -- (-2148.723) (-2150.269) [-2153.316] (-2155.460) * [-2151.317] (-2152.298) (-2155.566) (-2152.988) -- 0:01:58
      359000 -- (-2150.551) [-2156.336] (-2150.720) (-2157.805) * (-2155.419) (-2154.291) [-2152.812] (-2153.007) -- 0:01:57
      359500 -- (-2149.085) [-2155.195] (-2149.909) (-2155.023) * (-2156.878) (-2155.082) (-2150.163) [-2147.543] -- 0:01:57
      360000 -- (-2154.795) [-2149.358] (-2149.166) (-2148.334) * (-2154.873) (-2150.430) [-2155.458] (-2148.835) -- 0:01:59

      Average standard deviation of split frequencies: 0.000654

      360500 -- (-2152.950) (-2158.384) (-2152.289) [-2150.080] * (-2152.895) [-2149.889] (-2152.050) (-2151.204) -- 0:01:58
      361000 -- (-2153.910) (-2165.529) [-2150.692] (-2149.719) * [-2151.390] (-2150.701) (-2150.854) (-2153.956) -- 0:01:58
      361500 -- (-2149.779) [-2147.076] (-2156.603) (-2151.975) * (-2151.959) [-2148.635] (-2151.865) (-2150.174) -- 0:01:58
      362000 -- (-2156.842) [-2151.686] (-2151.381) (-2150.731) * (-2155.177) (-2152.525) [-2150.853] (-2148.604) -- 0:01:58
      362500 -- (-2156.636) (-2147.604) [-2147.560] (-2149.554) * (-2153.111) (-2152.624) (-2149.973) [-2157.817] -- 0:01:57
      363000 -- (-2151.756) (-2148.788) [-2151.329] (-2151.560) * (-2148.894) (-2153.998) [-2155.321] (-2151.358) -- 0:01:57
      363500 -- (-2147.719) [-2150.741] (-2151.791) (-2150.934) * (-2148.310) (-2154.756) [-2150.634] (-2152.210) -- 0:01:57
      364000 -- (-2159.613) (-2154.455) (-2150.939) [-2151.557] * (-2153.925) (-2156.541) (-2153.084) [-2152.463] -- 0:01:57
      364500 -- [-2150.048] (-2156.832) (-2148.898) (-2152.531) * (-2156.280) (-2164.420) (-2158.478) [-2152.526] -- 0:01:56
      365000 -- (-2156.315) (-2157.983) (-2155.466) [-2153.664] * [-2152.487] (-2159.768) (-2161.401) (-2152.247) -- 0:01:56

      Average standard deviation of split frequencies: 0.000644

      365500 -- (-2154.911) [-2154.760] (-2152.917) (-2149.803) * (-2162.097) (-2156.096) (-2149.696) [-2150.347] -- 0:01:58
      366000 -- [-2151.774] (-2155.359) (-2150.339) (-2153.561) * (-2159.115) (-2160.727) [-2149.240] (-2151.198) -- 0:01:57
      366500 -- (-2158.861) (-2151.624) [-2153.345] (-2156.203) * [-2150.517] (-2156.702) (-2152.551) (-2165.003) -- 0:01:57
      367000 -- [-2149.740] (-2157.373) (-2150.541) (-2152.029) * (-2152.326) [-2149.775] (-2152.562) (-2158.418) -- 0:01:57
      367500 -- (-2149.927) [-2158.520] (-2148.436) (-2154.367) * [-2154.316] (-2153.568) (-2155.058) (-2154.383) -- 0:01:57
      368000 -- (-2150.033) (-2150.664) (-2151.505) [-2149.418] * [-2152.690] (-2157.133) (-2155.706) (-2152.262) -- 0:01:56
      368500 -- (-2150.907) (-2157.417) (-2151.442) [-2150.801] * (-2152.320) (-2151.486) [-2153.420] (-2151.240) -- 0:01:56
      369000 -- (-2154.126) (-2151.805) (-2146.058) [-2150.951] * (-2150.730) (-2149.911) [-2148.455] (-2158.774) -- 0:01:56
      369500 -- [-2160.233] (-2153.393) (-2152.285) (-2153.136) * (-2156.350) [-2154.102] (-2149.600) (-2150.863) -- 0:01:56
      370000 -- (-2158.318) (-2149.588) (-2149.587) [-2151.433] * (-2149.630) (-2154.796) [-2152.529] (-2151.372) -- 0:01:55

      Average standard deviation of split frequencies: 0.000636

      370500 -- (-2152.020) (-2151.447) (-2152.894) [-2157.177] * (-2156.114) (-2154.341) [-2148.859] (-2151.688) -- 0:01:57
      371000 -- (-2160.272) (-2150.720) [-2151.953] (-2149.223) * (-2155.112) (-2156.188) (-2150.466) [-2154.032] -- 0:01:56
      371500 -- (-2155.478) (-2152.806) (-2156.147) [-2146.982] * (-2152.870) (-2156.723) [-2154.736] (-2151.498) -- 0:01:56
      372000 -- (-2152.167) (-2149.417) (-2149.821) [-2150.698] * (-2153.943) (-2155.927) (-2150.813) [-2152.095] -- 0:01:56
      372500 -- (-2155.089) (-2151.195) (-2152.460) [-2154.765] * (-2150.157) (-2155.085) (-2150.519) [-2150.803] -- 0:01:56
      373000 -- (-2155.874) (-2148.880) (-2153.851) [-2149.795] * [-2155.021] (-2153.887) (-2149.862) (-2152.701) -- 0:01:55
      373500 -- (-2153.096) (-2155.508) (-2151.675) [-2151.639] * [-2147.432] (-2151.735) (-2155.479) (-2155.791) -- 0:01:55
      374000 -- (-2157.179) (-2153.514) (-2151.085) [-2152.962] * [-2153.022] (-2152.627) (-2157.803) (-2150.611) -- 0:01:55
      374500 -- (-2160.585) (-2151.601) (-2152.376) [-2155.836] * [-2153.684] (-2157.616) (-2151.015) (-2148.953) -- 0:01:55
      375000 -- [-2152.234] (-2158.630) (-2154.884) (-2151.226) * (-2156.369) (-2152.808) (-2156.913) [-2149.623] -- 0:01:55

      Average standard deviation of split frequencies: 0.000627

      375500 -- (-2156.388) [-2153.978] (-2157.133) (-2158.224) * (-2158.424) (-2153.124) (-2160.222) [-2152.279] -- 0:01:54
      376000 -- (-2155.753) (-2153.246) (-2153.984) [-2151.916] * (-2155.371) (-2156.861) (-2157.678) [-2151.327] -- 0:01:56
      376500 -- (-2159.297) (-2147.026) (-2152.900) [-2153.869] * (-2157.673) [-2149.287] (-2156.259) (-2163.740) -- 0:01:55
      377000 -- (-2157.150) (-2158.149) (-2155.219) [-2158.524] * [-2157.582] (-2154.637) (-2156.138) (-2151.473) -- 0:01:55
      377500 -- (-2152.138) [-2147.931] (-2161.373) (-2156.609) * (-2155.007) [-2150.728] (-2154.909) (-2154.473) -- 0:01:55
      378000 -- (-2149.972) (-2146.323) (-2161.413) [-2152.527] * (-2154.212) [-2148.931] (-2153.417) (-2156.615) -- 0:01:55
      378500 -- (-2151.337) (-2153.852) (-2157.949) [-2153.498] * (-2164.939) [-2149.924] (-2149.741) (-2156.759) -- 0:01:54
      379000 -- (-2156.218) (-2155.555) (-2159.620) [-2152.997] * (-2165.567) [-2148.868] (-2149.852) (-2154.610) -- 0:01:54
      379500 -- (-2150.353) [-2151.451] (-2158.176) (-2158.287) * (-2161.279) [-2152.288] (-2151.437) (-2152.811) -- 0:01:54
      380000 -- (-2148.021) (-2155.070) (-2151.008) [-2150.469] * (-2153.139) (-2152.210) (-2151.606) [-2152.388] -- 0:01:54

      Average standard deviation of split frequencies: 0.000619

      380500 -- (-2151.041) [-2153.830] (-2154.470) (-2153.062) * (-2146.772) (-2154.873) (-2149.676) [-2152.625] -- 0:01:53
      381000 -- (-2156.807) [-2147.494] (-2153.073) (-2151.339) * [-2152.229] (-2153.910) (-2149.607) (-2155.286) -- 0:01:53
      381500 -- [-2151.519] (-2150.078) (-2148.258) (-2154.095) * (-2152.203) [-2153.914] (-2159.837) (-2153.784) -- 0:01:55
      382000 -- (-2151.267) (-2149.207) (-2158.704) [-2153.587] * [-2152.567] (-2154.788) (-2153.814) (-2166.093) -- 0:01:54
      382500 -- (-2153.567) (-2154.743) [-2147.962] (-2151.726) * (-2159.049) (-2150.220) (-2155.247) [-2156.580] -- 0:01:54
      383000 -- (-2153.968) (-2152.067) [-2153.269] (-2154.337) * (-2154.875) [-2150.741] (-2156.872) (-2153.338) -- 0:01:54
      383500 -- (-2150.030) [-2151.959] (-2153.821) (-2151.452) * (-2149.363) [-2153.885] (-2149.785) (-2153.258) -- 0:01:54
      384000 -- (-2149.587) (-2156.120) [-2151.021] (-2152.978) * (-2152.657) (-2151.047) [-2153.372] (-2154.339) -- 0:01:53
      384500 -- (-2149.709) (-2153.658) [-2151.005] (-2152.889) * (-2148.251) (-2152.216) [-2150.201] (-2158.716) -- 0:01:53
      385000 -- (-2156.647) [-2152.295] (-2154.061) (-2152.902) * [-2149.945] (-2151.818) (-2149.296) (-2151.651) -- 0:01:53

      Average standard deviation of split frequencies: 0.000611

      385500 -- [-2149.813] (-2159.112) (-2153.197) (-2150.394) * (-2151.970) [-2154.482] (-2153.285) (-2158.186) -- 0:01:53
      386000 -- [-2149.991] (-2156.365) (-2149.355) (-2154.057) * [-2149.365] (-2155.377) (-2152.073) (-2158.221) -- 0:01:52
      386500 -- (-2151.839) (-2157.704) (-2152.496) [-2152.636] * (-2153.136) (-2157.448) (-2153.631) [-2154.368] -- 0:01:52
      387000 -- (-2149.878) (-2148.928) [-2155.479] (-2159.213) * [-2156.605] (-2158.308) (-2155.640) (-2150.823) -- 0:01:54
      387500 -- (-2149.324) (-2160.118) [-2151.366] (-2150.821) * (-2149.292) (-2159.962) (-2151.969) [-2149.948] -- 0:01:53
      388000 -- (-2151.842) (-2161.822) (-2155.502) [-2149.200] * (-2156.830) [-2154.169] (-2155.466) (-2154.645) -- 0:01:53
      388500 -- [-2149.493] (-2158.415) (-2149.775) (-2152.211) * (-2153.703) (-2154.583) [-2148.143] (-2152.244) -- 0:01:53
      389000 -- (-2159.772) (-2150.525) [-2157.262] (-2150.260) * (-2149.606) [-2149.304] (-2157.356) (-2149.999) -- 0:01:53
      389500 -- (-2153.686) (-2156.521) (-2151.752) [-2149.606] * [-2149.142] (-2150.489) (-2153.365) (-2156.393) -- 0:01:52
      390000 -- [-2149.312] (-2147.928) (-2151.999) (-2155.353) * [-2155.984] (-2147.676) (-2148.342) (-2150.355) -- 0:01:52

      Average standard deviation of split frequencies: 0.000603

      390500 -- (-2158.969) (-2155.006) (-2151.377) [-2159.111] * (-2153.557) (-2157.210) [-2155.503] (-2149.918) -- 0:01:52
      391000 -- (-2155.729) (-2163.948) [-2152.633] (-2153.314) * (-2154.863) (-2158.953) (-2158.637) [-2149.609] -- 0:01:52
      391500 -- (-2161.603) (-2156.245) (-2156.939) [-2152.452] * (-2151.057) (-2153.359) (-2160.118) [-2149.569] -- 0:01:51
      392000 -- (-2161.975) (-2156.196) (-2158.688) [-2156.397] * (-2154.623) (-2153.936) (-2156.528) [-2150.581] -- 0:01:51
      392500 -- (-2157.661) (-2153.612) [-2158.861] (-2151.281) * (-2151.472) (-2151.994) [-2152.767] (-2152.338) -- 0:01:52
      393000 -- (-2156.244) (-2154.629) (-2163.661) [-2147.764] * (-2152.867) [-2147.752] (-2156.480) (-2151.129) -- 0:01:52
      393500 -- (-2157.769) (-2156.107) (-2159.494) [-2149.792] * (-2152.776) (-2148.803) [-2157.117] (-2151.215) -- 0:01:52
      394000 -- (-2153.424) (-2149.621) [-2152.588] (-2151.023) * (-2150.674) (-2153.502) (-2157.989) [-2152.618] -- 0:01:52
      394500 -- (-2150.574) (-2149.125) [-2154.498] (-2159.218) * (-2147.880) (-2151.426) [-2156.178] (-2150.736) -- 0:01:52
      395000 -- (-2159.067) [-2149.073] (-2155.515) (-2150.848) * (-2149.998) (-2152.611) [-2150.550] (-2153.024) -- 0:01:51

      Average standard deviation of split frequencies: 0.000595

      395500 -- [-2152.360] (-2151.047) (-2152.173) (-2147.100) * (-2153.698) (-2153.758) [-2156.874] (-2152.339) -- 0:01:51
      396000 -- [-2151.795] (-2160.418) (-2147.748) (-2149.571) * (-2150.125) [-2150.002] (-2151.951) (-2156.239) -- 0:01:51
      396500 -- (-2147.778) (-2154.363) (-2159.352) [-2152.143] * (-2151.469) [-2154.461] (-2149.569) (-2155.262) -- 0:01:51
      397000 -- (-2154.421) (-2151.743) (-2156.930) [-2152.305] * (-2153.262) (-2150.163) [-2149.745] (-2156.263) -- 0:01:50
      397500 -- (-2151.284) (-2157.970) (-2158.222) [-2154.686] * (-2151.541) (-2155.880) [-2149.738] (-2149.661) -- 0:01:50
      398000 -- (-2149.924) (-2158.243) (-2151.829) [-2154.215] * (-2153.259) (-2152.895) (-2153.078) [-2149.179] -- 0:01:51
      398500 -- (-2151.057) (-2155.911) (-2153.774) [-2150.722] * [-2153.820] (-2153.045) (-2153.740) (-2152.418) -- 0:01:51
      399000 -- (-2154.870) (-2155.462) [-2151.250] (-2154.947) * (-2148.914) [-2152.399] (-2155.726) (-2151.673) -- 0:01:51
      399500 -- (-2150.953) [-2155.490] (-2153.597) (-2158.404) * (-2153.936) (-2152.922) (-2150.077) [-2152.172] -- 0:01:51
      400000 -- (-2157.459) (-2157.557) (-2157.132) [-2151.291] * [-2148.136] (-2156.769) (-2152.841) (-2154.074) -- 0:01:51

      Average standard deviation of split frequencies: 0.000588

      400500 -- [-2150.074] (-2153.958) (-2152.248) (-2158.615) * [-2150.788] (-2153.720) (-2152.934) (-2150.571) -- 0:01:50
      401000 -- (-2151.135) (-2161.849) [-2155.405] (-2154.948) * [-2151.104] (-2160.356) (-2156.947) (-2153.470) -- 0:01:50
      401500 -- (-2150.283) [-2154.389] (-2150.789) (-2153.852) * (-2155.068) (-2160.362) [-2152.267] (-2152.061) -- 0:01:50
      402000 -- (-2155.940) (-2153.336) (-2149.871) [-2155.484] * (-2151.928) (-2149.653) (-2153.146) [-2155.494] -- 0:01:50
      402500 -- (-2152.138) (-2152.258) (-2152.616) [-2151.928] * [-2152.281] (-2151.373) (-2153.396) (-2152.893) -- 0:01:49
      403000 -- (-2155.301) [-2152.167] (-2154.158) (-2159.871) * [-2149.649] (-2150.058) (-2152.134) (-2153.937) -- 0:01:51
      403500 -- [-2150.673] (-2152.929) (-2151.051) (-2152.437) * (-2152.143) [-2151.000] (-2148.538) (-2151.341) -- 0:01:50
      404000 -- (-2160.395) (-2157.001) (-2157.123) [-2155.944] * [-2148.150] (-2152.538) (-2154.351) (-2153.216) -- 0:01:50
      404500 -- (-2155.199) (-2153.879) [-2152.744] (-2155.941) * (-2150.424) [-2149.389] (-2156.991) (-2154.777) -- 0:01:50
      405000 -- (-2159.169) (-2152.315) (-2158.291) [-2152.451] * (-2160.498) (-2153.567) (-2149.168) [-2153.132] -- 0:01:50

      Average standard deviation of split frequencies: 0.000581

      405500 -- (-2159.378) (-2149.287) [-2152.296] (-2156.479) * (-2152.788) (-2152.952) (-2169.546) [-2150.074] -- 0:01:49
      406000 -- (-2153.642) [-2148.374] (-2152.936) (-2156.507) * [-2150.922] (-2150.212) (-2157.411) (-2155.809) -- 0:01:49
      406500 -- (-2152.891) [-2150.743] (-2154.666) (-2151.888) * (-2151.024) (-2149.748) (-2154.686) [-2150.967] -- 0:01:49
      407000 -- (-2151.802) (-2153.692) (-2152.698) [-2151.280] * (-2148.196) (-2147.560) (-2156.917) [-2147.137] -- 0:01:49
      407500 -- (-2160.248) (-2147.813) [-2153.067] (-2151.910) * (-2152.644) (-2153.885) (-2148.235) [-2154.230] -- 0:01:49
      408000 -- (-2155.357) (-2157.991) (-2152.770) [-2157.471] * (-2153.001) (-2153.696) (-2158.614) [-2153.498] -- 0:01:48
      408500 -- (-2157.517) [-2153.739] (-2156.023) (-2152.595) * [-2161.242] (-2149.813) (-2158.940) (-2155.999) -- 0:01:50
      409000 -- (-2154.017) (-2156.743) (-2153.774) [-2152.703] * (-2169.172) [-2150.469] (-2154.073) (-2151.449) -- 0:01:49
      409500 -- (-2154.139) (-2149.334) [-2157.589] (-2159.211) * (-2154.713) (-2150.267) (-2154.496) [-2151.056] -- 0:01:49
      410000 -- (-2160.689) [-2151.513] (-2158.722) (-2164.511) * (-2157.612) [-2153.287] (-2154.446) (-2153.617) -- 0:01:49

      Average standard deviation of split frequencies: 0.000574

      410500 -- (-2163.446) [-2152.486] (-2154.457) (-2164.241) * (-2153.200) (-2155.422) (-2153.868) [-2151.581] -- 0:01:49
      411000 -- (-2156.829) [-2150.997] (-2152.798) (-2154.109) * (-2155.819) [-2149.737] (-2154.738) (-2154.777) -- 0:01:48
      411500 -- [-2148.938] (-2160.505) (-2155.026) (-2154.132) * (-2158.626) (-2147.670) (-2153.645) [-2153.917] -- 0:01:48
      412000 -- (-2152.261) (-2152.862) (-2152.062) [-2154.633] * (-2159.272) [-2156.965] (-2158.819) (-2159.007) -- 0:01:48
      412500 -- (-2149.466) (-2157.809) [-2152.421] (-2148.592) * (-2161.172) (-2154.867) [-2156.079] (-2154.891) -- 0:01:48
      413000 -- [-2157.097] (-2150.546) (-2154.962) (-2156.480) * (-2159.274) (-2158.969) [-2147.943] (-2158.051) -- 0:01:48
      413500 -- (-2154.267) (-2151.203) [-2148.521] (-2148.835) * [-2155.782] (-2156.010) (-2153.063) (-2151.296) -- 0:01:47
      414000 -- (-2149.231) [-2152.757] (-2154.623) (-2149.663) * (-2151.683) (-2152.586) [-2151.478] (-2155.976) -- 0:01:48
      414500 -- (-2156.773) (-2151.836) [-2150.511] (-2151.285) * (-2154.921) (-2154.809) (-2148.605) [-2149.064] -- 0:01:48
      415000 -- (-2162.574) (-2150.654) [-2154.479] (-2150.819) * [-2147.342] (-2154.580) (-2152.408) (-2156.279) -- 0:01:48

      Average standard deviation of split frequencies: 0.000567

      415500 -- (-2151.179) [-2146.961] (-2153.805) (-2151.954) * (-2150.866) [-2151.861] (-2153.166) (-2154.224) -- 0:01:48
      416000 -- (-2154.141) (-2147.331) (-2154.635) [-2156.403] * [-2151.981] (-2150.249) (-2152.871) (-2148.807) -- 0:01:48
      416500 -- [-2148.654] (-2151.673) (-2155.519) (-2155.834) * (-2152.942) (-2158.404) [-2153.795] (-2149.503) -- 0:01:47
      417000 -- (-2151.257) (-2152.106) [-2151.683] (-2153.133) * (-2156.229) [-2161.787] (-2150.126) (-2162.466) -- 0:01:47
      417500 -- (-2152.234) (-2152.712) [-2153.782] (-2154.660) * (-2164.454) [-2154.868] (-2147.190) (-2154.468) -- 0:01:47
      418000 -- (-2155.180) (-2148.500) (-2153.040) [-2151.101] * (-2158.494) (-2158.080) [-2152.780] (-2158.158) -- 0:01:47
      418500 -- (-2158.747) (-2149.367) (-2152.454) [-2152.883] * (-2154.792) [-2155.099] (-2149.232) (-2156.081) -- 0:01:46
      419000 -- (-2153.665) (-2157.933) [-2154.057] (-2152.864) * (-2155.476) (-2159.596) [-2156.153] (-2157.907) -- 0:01:46
      419500 -- (-2156.356) (-2150.633) [-2151.364] (-2150.464) * (-2155.281) (-2163.420) [-2149.266] (-2161.353) -- 0:01:47
      420000 -- (-2150.073) [-2149.951] (-2151.976) (-2153.648) * (-2150.848) (-2156.528) (-2152.546) [-2149.722] -- 0:01:47

      Average standard deviation of split frequencies: 0.000560

      420500 -- [-2152.551] (-2152.102) (-2157.723) (-2152.545) * [-2151.293] (-2155.468) (-2156.687) (-2157.072) -- 0:01:47
      421000 -- [-2151.910] (-2157.464) (-2150.046) (-2154.578) * (-2153.211) [-2150.625] (-2154.614) (-2152.340) -- 0:01:47
      421500 -- (-2154.717) (-2157.403) (-2146.763) [-2161.091] * (-2148.573) [-2154.484] (-2152.522) (-2152.293) -- 0:01:47
      422000 -- [-2150.395] (-2156.821) (-2152.628) (-2152.230) * (-2151.678) (-2153.819) [-2152.061] (-2153.397) -- 0:01:46
      422500 -- (-2151.682) [-2150.039] (-2152.298) (-2159.143) * [-2147.317] (-2153.429) (-2158.613) (-2157.398) -- 0:01:46
      423000 -- (-2149.566) [-2149.970] (-2152.549) (-2154.134) * (-2154.156) [-2155.331] (-2153.961) (-2160.773) -- 0:01:46
      423500 -- (-2150.570) [-2150.699] (-2160.774) (-2150.539) * (-2151.843) (-2150.509) (-2150.897) [-2156.159] -- 0:01:46
      424000 -- (-2153.098) (-2154.310) [-2148.568] (-2150.797) * (-2148.257) (-2155.151) [-2153.371] (-2164.449) -- 0:01:45
      424500 -- (-2157.811) (-2160.032) (-2146.668) [-2151.206] * (-2148.946) [-2149.788] (-2152.687) (-2151.802) -- 0:01:45
      425000 -- (-2157.551) (-2153.191) (-2146.944) [-2154.622] * [-2150.897] (-2161.084) (-2150.927) (-2147.084) -- 0:01:46

      Average standard deviation of split frequencies: 0.000553

      425500 -- (-2153.937) [-2152.056] (-2152.118) (-2149.900) * (-2150.444) (-2155.115) (-2154.938) [-2147.052] -- 0:01:46
      426000 -- (-2155.126) (-2162.166) [-2152.202] (-2149.731) * (-2155.348) (-2153.333) [-2151.384] (-2153.736) -- 0:01:46
      426500 -- (-2153.782) (-2156.786) [-2154.355] (-2155.553) * (-2156.592) (-2155.831) (-2153.956) [-2149.550] -- 0:01:46
      427000 -- [-2151.301] (-2156.456) (-2156.545) (-2158.253) * [-2150.351] (-2149.235) (-2151.096) (-2148.825) -- 0:01:46
      427500 -- (-2149.465) (-2151.859) (-2153.436) [-2151.359] * [-2154.649] (-2152.886) (-2155.500) (-2152.636) -- 0:01:45
      428000 -- (-2150.776) (-2160.032) [-2154.132] (-2153.031) * [-2150.794] (-2160.242) (-2154.715) (-2154.166) -- 0:01:45
      428500 -- [-2156.475] (-2153.804) (-2157.345) (-2148.894) * (-2150.137) (-2155.878) [-2150.472] (-2151.889) -- 0:01:45
      429000 -- (-2148.825) (-2158.150) (-2156.514) [-2151.318] * [-2151.586] (-2157.621) (-2151.331) (-2160.785) -- 0:01:45
      429500 -- (-2152.681) (-2149.294) [-2156.710] (-2156.771) * (-2149.422) (-2166.991) (-2152.265) [-2155.259] -- 0:01:44
      430000 -- [-2151.038] (-2152.576) (-2154.309) (-2150.710) * (-2148.838) [-2161.156] (-2150.985) (-2160.565) -- 0:01:44

      Average standard deviation of split frequencies: 0.000547

      430500 -- (-2154.777) [-2150.808] (-2148.049) (-2155.049) * (-2149.593) (-2163.068) [-2158.458] (-2154.997) -- 0:01:45
      431000 -- (-2166.800) (-2156.989) (-2154.568) [-2151.622] * (-2155.450) (-2159.433) (-2166.473) [-2150.559] -- 0:01:45
      431500 -- (-2153.110) (-2150.725) [-2154.417] (-2161.199) * [-2152.802] (-2149.627) (-2156.095) (-2145.313) -- 0:01:45
      432000 -- (-2157.123) [-2150.002] (-2152.090) (-2152.718) * [-2147.379] (-2150.190) (-2148.058) (-2153.562) -- 0:01:45
      432500 -- (-2149.992) [-2146.445] (-2152.999) (-2152.284) * (-2147.331) (-2154.022) [-2151.648] (-2150.214) -- 0:01:44
      433000 -- [-2149.880] (-2149.627) (-2156.045) (-2151.926) * (-2155.549) (-2149.041) [-2150.490] (-2149.741) -- 0:01:44
      433500 -- (-2150.739) (-2155.618) [-2149.119] (-2158.889) * (-2154.963) [-2149.521] (-2154.537) (-2160.231) -- 0:01:44
      434000 -- (-2152.562) (-2154.913) (-2162.368) [-2152.247] * (-2152.479) (-2149.894) (-2156.751) [-2155.038] -- 0:01:44
      434500 -- (-2153.722) (-2158.333) (-2158.565) [-2147.517] * (-2148.793) (-2147.080) [-2154.671] (-2149.963) -- 0:01:44
      435000 -- (-2150.941) (-2163.964) (-2152.880) [-2150.867] * (-2152.366) [-2147.123] (-2153.649) (-2151.301) -- 0:01:43

      Average standard deviation of split frequencies: 0.000541

      435500 -- [-2154.068] (-2153.500) (-2155.419) (-2151.694) * (-2157.080) [-2154.425] (-2162.598) (-2149.970) -- 0:01:43
      436000 -- (-2150.655) (-2151.657) [-2159.898] (-2148.643) * [-2154.864] (-2156.580) (-2157.978) (-2154.978) -- 0:01:44
      436500 -- (-2151.367) (-2152.106) (-2156.375) [-2151.856] * (-2149.161) [-2154.392] (-2161.438) (-2151.282) -- 0:01:44
      437000 -- (-2151.986) (-2149.357) (-2158.657) [-2154.361] * (-2158.288) (-2156.168) (-2156.239) [-2152.843] -- 0:01:44
      437500 -- (-2156.047) (-2152.593) [-2149.451] (-2152.926) * (-2152.365) (-2148.717) (-2162.433) [-2154.752] -- 0:01:44
      438000 -- [-2153.473] (-2153.008) (-2158.932) (-2160.074) * (-2149.331) (-2150.762) [-2154.403] (-2162.287) -- 0:01:43
      438500 -- (-2154.921) (-2153.302) (-2153.439) [-2153.191] * (-2151.304) (-2151.463) [-2152.949] (-2155.207) -- 0:01:43
      439000 -- (-2150.086) (-2154.478) (-2151.905) [-2154.216] * (-2155.981) [-2152.485] (-2150.670) (-2153.424) -- 0:01:43
      439500 -- (-2153.968) (-2153.877) [-2149.666] (-2158.148) * (-2158.113) (-2152.186) [-2155.001] (-2160.884) -- 0:01:43
      440000 -- (-2158.234) [-2154.597] (-2151.342) (-2151.946) * [-2152.000] (-2159.668) (-2157.474) (-2155.381) -- 0:01:43

      Average standard deviation of split frequencies: 0.000535

      440500 -- (-2154.035) [-2150.207] (-2151.476) (-2149.713) * (-2149.749) (-2159.480) [-2152.464] (-2153.464) -- 0:01:42
      441000 -- (-2148.041) [-2153.621] (-2152.523) (-2148.027) * (-2157.964) (-2153.590) [-2153.013] (-2153.116) -- 0:01:42
      441500 -- (-2148.315) [-2152.169] (-2157.297) (-2153.830) * [-2153.294] (-2151.440) (-2150.255) (-2155.683) -- 0:01:43
      442000 -- [-2148.424] (-2161.372) (-2157.581) (-2154.963) * [-2150.813] (-2155.332) (-2155.264) (-2149.658) -- 0:01:43
      442500 -- (-2153.132) [-2148.373] (-2149.439) (-2154.738) * (-2155.344) (-2148.695) (-2152.605) [-2150.751] -- 0:01:43
      443000 -- [-2152.789] (-2148.884) (-2151.098) (-2151.205) * (-2156.989) (-2147.848) [-2164.677] (-2151.336) -- 0:01:43
      443500 -- (-2152.731) (-2158.831) (-2155.102) [-2153.717] * (-2151.491) (-2151.613) (-2159.774) [-2150.669] -- 0:01:42
      444000 -- (-2151.733) (-2150.509) [-2156.144] (-2151.808) * (-2154.441) [-2154.958] (-2153.170) (-2149.080) -- 0:01:42
      444500 -- (-2150.636) (-2151.324) [-2152.302] (-2147.800) * (-2154.423) (-2152.765) (-2161.191) [-2157.316] -- 0:01:42
      445000 -- (-2153.221) (-2151.698) (-2155.192) [-2148.454] * (-2154.547) (-2154.560) [-2153.808] (-2151.012) -- 0:01:42

      Average standard deviation of split frequencies: 0.000528

      445500 -- (-2151.944) [-2150.933] (-2152.877) (-2148.850) * (-2153.083) (-2152.028) [-2152.438] (-2151.685) -- 0:01:42
      446000 -- [-2153.498] (-2153.868) (-2160.212) (-2156.601) * (-2156.570) (-2155.411) (-2153.587) [-2149.133] -- 0:01:41
      446500 -- (-2157.818) (-2153.941) (-2154.037) [-2157.943] * [-2151.497] (-2151.141) (-2147.788) (-2154.291) -- 0:01:42
      447000 -- (-2149.860) (-2152.016) (-2149.691) [-2152.375] * (-2152.281) [-2150.399] (-2151.917) (-2161.916) -- 0:01:42
      447500 -- (-2151.785) (-2150.701) [-2150.416] (-2149.144) * (-2150.744) (-2150.342) (-2150.481) [-2153.656] -- 0:01:42
      448000 -- (-2151.887) (-2149.907) (-2152.717) [-2154.933] * (-2152.484) [-2148.829] (-2160.008) (-2156.029) -- 0:01:42
      448500 -- (-2150.253) (-2153.573) [-2148.596] (-2154.509) * [-2151.353] (-2156.812) (-2151.469) (-2150.975) -- 0:01:42
      449000 -- [-2159.261] (-2147.249) (-2156.666) (-2153.038) * (-2155.752) (-2154.649) (-2155.902) [-2148.927] -- 0:01:41
      449500 -- [-2152.451] (-2153.969) (-2156.889) (-2151.837) * (-2156.056) (-2150.793) (-2155.382) [-2147.362] -- 0:01:41
      450000 -- (-2156.918) (-2150.560) (-2155.942) [-2149.651] * (-2152.491) (-2150.864) [-2153.667] (-2156.456) -- 0:01:41

      Average standard deviation of split frequencies: 0.000523

      450500 -- [-2149.910] (-2155.987) (-2153.298) (-2150.885) * [-2152.150] (-2150.117) (-2147.066) (-2148.975) -- 0:01:41
      451000 -- (-2154.641) (-2158.138) (-2153.318) [-2149.043] * [-2154.530] (-2150.939) (-2160.758) (-2148.969) -- 0:01:41
      451500 -- (-2151.943) [-2149.724] (-2161.064) (-2155.320) * (-2157.791) (-2154.226) [-2154.406] (-2151.206) -- 0:01:40
      452000 -- [-2155.502] (-2148.707) (-2154.014) (-2150.470) * (-2158.308) (-2154.011) (-2154.127) [-2156.193] -- 0:01:41
      452500 -- (-2162.010) [-2156.403] (-2154.586) (-2150.356) * (-2158.057) (-2150.291) [-2157.512] (-2152.318) -- 0:01:41
      453000 -- (-2159.440) (-2156.956) [-2152.261] (-2155.189) * (-2161.532) (-2151.400) [-2155.631] (-2152.085) -- 0:01:41
      453500 -- (-2152.751) [-2150.786] (-2151.499) (-2154.403) * (-2157.418) [-2151.201] (-2152.920) (-2150.319) -- 0:01:41
      454000 -- (-2159.373) [-2154.666] (-2153.440) (-2151.773) * (-2151.842) (-2151.207) (-2153.963) [-2155.965] -- 0:01:41
      454500 -- [-2153.269] (-2153.365) (-2162.049) (-2158.016) * (-2160.961) [-2147.353] (-2156.497) (-2159.985) -- 0:01:40
      455000 -- (-2152.783) [-2155.078] (-2151.802) (-2149.117) * (-2156.819) [-2151.978] (-2155.581) (-2158.728) -- 0:01:40

      Average standard deviation of split frequencies: 0.000517

      455500 -- [-2147.871] (-2149.038) (-2148.377) (-2155.147) * (-2149.935) (-2154.612) (-2149.703) [-2155.670] -- 0:01:40
      456000 -- (-2151.695) (-2156.394) [-2150.965] (-2152.662) * (-2146.795) (-2157.598) (-2150.383) [-2153.306] -- 0:01:40
      456500 -- (-2150.151) (-2163.198) [-2151.541] (-2156.881) * [-2155.905] (-2158.547) (-2149.209) (-2157.475) -- 0:01:40
      457000 -- [-2151.552] (-2151.732) (-2146.969) (-2154.701) * (-2151.133) (-2147.835) (-2151.754) [-2152.540] -- 0:01:39
      457500 -- (-2155.892) (-2155.008) (-2154.017) [-2151.240] * (-2159.732) [-2148.286] (-2160.799) (-2159.884) -- 0:01:40
      458000 -- (-2154.707) [-2151.937] (-2147.743) (-2159.801) * (-2153.914) [-2157.066] (-2153.227) (-2154.148) -- 0:01:40
      458500 -- [-2152.023] (-2152.764) (-2150.772) (-2155.954) * (-2156.557) (-2156.092) (-2155.333) [-2156.127] -- 0:01:40
      459000 -- (-2156.282) (-2152.871) [-2148.381] (-2153.199) * (-2155.383) (-2151.620) (-2160.102) [-2151.845] -- 0:01:40
      459500 -- [-2156.019] (-2152.663) (-2154.638) (-2153.142) * (-2153.735) (-2159.633) [-2154.381] (-2162.638) -- 0:01:39
      460000 -- (-2152.112) (-2156.560) (-2151.977) [-2150.422] * [-2152.148] (-2159.437) (-2150.540) (-2155.111) -- 0:01:39

      Average standard deviation of split frequencies: 0.000512

      460500 -- (-2165.291) (-2148.114) [-2152.805] (-2154.531) * (-2154.847) (-2154.251) (-2159.858) [-2151.141] -- 0:01:39
      461000 -- (-2164.463) [-2149.127] (-2151.320) (-2161.480) * (-2149.425) (-2153.229) (-2152.202) [-2151.991] -- 0:01:39
      461500 -- (-2156.962) (-2152.186) [-2151.175] (-2155.721) * (-2150.209) [-2151.570] (-2154.691) (-2152.299) -- 0:01:39
      462000 -- [-2153.859] (-2150.284) (-2153.023) (-2153.495) * (-2150.782) (-2161.863) (-2153.124) [-2156.972] -- 0:01:38
      462500 -- (-2160.771) (-2151.405) (-2153.954) [-2147.697] * [-2148.186] (-2154.702) (-2152.555) (-2154.845) -- 0:01:38
      463000 -- (-2152.066) (-2155.796) (-2161.735) [-2152.626] * [-2156.253] (-2152.984) (-2162.433) (-2151.588) -- 0:01:39
      463500 -- (-2151.496) (-2155.928) [-2153.072] (-2157.715) * (-2155.659) (-2154.178) (-2153.299) [-2155.656] -- 0:01:39
      464000 -- (-2154.142) [-2149.905] (-2153.913) (-2156.178) * [-2147.566] (-2160.093) (-2154.497) (-2153.235) -- 0:01:39
      464500 -- (-2152.384) (-2150.673) [-2149.990] (-2152.252) * (-2149.901) (-2151.786) [-2153.720] (-2155.355) -- 0:01:39
      465000 -- (-2154.191) (-2152.822) [-2150.018] (-2151.535) * [-2148.574] (-2147.597) (-2150.544) (-2157.326) -- 0:01:38

      Average standard deviation of split frequencies: 0.000506

      465500 -- (-2154.578) (-2157.285) (-2149.025) [-2151.078] * (-2150.572) [-2153.412] (-2159.556) (-2160.643) -- 0:01:38
      466000 -- (-2156.681) (-2159.185) (-2155.398) [-2150.768] * (-2153.601) [-2151.831] (-2154.515) (-2154.450) -- 0:01:38
      466500 -- [-2154.731] (-2150.430) (-2149.459) (-2150.596) * [-2151.598] (-2158.638) (-2152.517) (-2156.475) -- 0:01:38
      467000 -- (-2157.118) (-2150.926) [-2153.777] (-2149.176) * (-2154.363) [-2153.612] (-2154.640) (-2159.833) -- 0:01:38
      467500 -- (-2152.963) [-2150.258] (-2153.415) (-2148.179) * (-2153.770) (-2152.074) [-2151.122] (-2148.570) -- 0:01:37
      468000 -- [-2151.483] (-2150.708) (-2157.841) (-2158.636) * (-2151.408) (-2148.904) (-2154.235) [-2149.406] -- 0:01:38
      468500 -- [-2156.368] (-2151.090) (-2164.002) (-2156.700) * [-2151.992] (-2154.069) (-2152.401) (-2150.186) -- 0:01:38
      469000 -- (-2152.376) [-2152.786] (-2153.048) (-2155.386) * (-2148.122) [-2149.131] (-2161.308) (-2149.552) -- 0:01:38
      469500 -- [-2153.165] (-2154.486) (-2156.879) (-2154.059) * (-2150.825) (-2156.416) (-2155.378) [-2151.093] -- 0:01:38
      470000 -- (-2155.107) (-2155.847) (-2154.349) [-2153.745] * (-2153.177) [-2152.976] (-2154.248) (-2156.613) -- 0:01:38

      Average standard deviation of split frequencies: 0.000501

      470500 -- (-2156.614) [-2154.530] (-2161.162) (-2153.082) * (-2154.044) (-2154.525) [-2153.761] (-2161.744) -- 0:01:37
      471000 -- [-2158.669] (-2152.502) (-2157.811) (-2153.608) * (-2150.021) (-2154.912) [-2155.544] (-2154.445) -- 0:01:37
      471500 -- [-2157.571] (-2149.499) (-2153.776) (-2154.956) * (-2152.682) [-2157.676] (-2152.975) (-2156.572) -- 0:01:37
      472000 -- [-2158.796] (-2152.770) (-2156.701) (-2147.761) * (-2153.768) (-2152.940) [-2153.065] (-2159.768) -- 0:01:37
      472500 -- (-2153.476) (-2150.104) [-2153.153] (-2155.582) * (-2157.763) [-2154.288] (-2155.003) (-2154.847) -- 0:01:37
      473000 -- (-2156.279) [-2151.542] (-2158.302) (-2153.478) * (-2158.086) [-2149.414] (-2150.028) (-2149.491) -- 0:01:36
      473500 -- (-2156.322) [-2150.313] (-2149.707) (-2155.089) * (-2154.729) [-2156.996] (-2150.330) (-2156.959) -- 0:01:37
      474000 -- [-2157.158] (-2151.710) (-2149.309) (-2153.247) * [-2156.733] (-2155.093) (-2149.883) (-2154.258) -- 0:01:37
      474500 -- (-2152.725) (-2149.287) [-2151.084] (-2150.491) * (-2148.098) [-2159.451] (-2150.629) (-2156.970) -- 0:01:37
      475000 -- [-2150.565] (-2151.928) (-2149.328) (-2146.275) * (-2151.852) (-2149.167) [-2153.080] (-2153.099) -- 0:01:37

      Average standard deviation of split frequencies: 0.000495

      475500 -- (-2152.043) (-2153.532) (-2157.226) [-2147.140] * [-2149.590] (-2154.702) (-2155.334) (-2149.291) -- 0:01:37
      476000 -- [-2148.441] (-2148.094) (-2152.553) (-2153.576) * (-2150.785) (-2151.467) [-2149.041] (-2154.814) -- 0:01:36
      476500 -- (-2155.397) [-2146.244] (-2159.404) (-2154.365) * (-2152.075) (-2154.980) [-2154.003] (-2152.098) -- 0:01:36
      477000 -- (-2153.223) (-2154.704) [-2150.390] (-2153.176) * (-2155.528) [-2153.865] (-2158.441) (-2151.149) -- 0:01:36
      477500 -- (-2147.669) (-2149.327) (-2152.419) [-2155.989] * [-2152.321] (-2157.660) (-2155.827) (-2152.469) -- 0:01:36
      478000 -- [-2150.357] (-2154.571) (-2153.518) (-2154.797) * (-2152.122) (-2159.942) [-2148.591] (-2149.726) -- 0:01:36
      478500 -- [-2147.774] (-2150.688) (-2159.448) (-2152.061) * [-2157.727] (-2155.107) (-2149.637) (-2152.634) -- 0:01:35
      479000 -- (-2153.979) (-2153.110) [-2154.358] (-2153.117) * (-2152.167) (-2156.043) (-2149.876) [-2149.883] -- 0:01:36
      479500 -- (-2149.271) (-2156.733) [-2153.151] (-2153.740) * [-2150.035] (-2153.632) (-2150.594) (-2160.818) -- 0:01:36
      480000 -- (-2151.434) [-2149.414] (-2154.025) (-2158.031) * (-2152.355) (-2147.510) (-2151.610) [-2157.246] -- 0:01:36

      Average standard deviation of split frequencies: 0.000490

      480500 -- (-2151.022) [-2154.384] (-2150.904) (-2162.361) * (-2159.735) (-2149.283) (-2154.564) [-2154.033] -- 0:01:36
      481000 -- (-2156.901) [-2158.999] (-2158.791) (-2160.676) * (-2160.700) (-2153.827) (-2156.376) [-2153.037] -- 0:01:36
      481500 -- (-2149.573) (-2159.214) [-2155.464] (-2155.657) * (-2158.924) (-2151.062) [-2160.320] (-2156.887) -- 0:01:35
      482000 -- (-2149.069) (-2147.889) (-2151.158) [-2161.048] * (-2159.341) (-2155.629) [-2156.334] (-2150.644) -- 0:01:35
      482500 -- [-2162.698] (-2152.516) (-2149.581) (-2154.601) * (-2157.040) [-2152.396] (-2149.666) (-2151.882) -- 0:01:35
      483000 -- [-2151.692] (-2150.583) (-2149.116) (-2149.034) * (-2150.619) (-2157.828) [-2149.337] (-2149.642) -- 0:01:35
      483500 -- (-2152.809) (-2157.730) [-2152.028] (-2150.545) * (-2158.278) (-2157.060) [-2152.922] (-2150.280) -- 0:01:35
      484000 -- (-2150.828) [-2152.084] (-2153.877) (-2157.617) * (-2153.755) (-2152.387) [-2149.561] (-2162.053) -- 0:01:34
      484500 -- (-2151.676) [-2147.933] (-2146.358) (-2153.127) * [-2149.954] (-2151.876) (-2149.752) (-2148.813) -- 0:01:35
      485000 -- [-2148.840] (-2150.277) (-2159.410) (-2148.422) * [-2152.126] (-2154.779) (-2153.485) (-2154.219) -- 0:01:35

      Average standard deviation of split frequencies: 0.000485

      485500 -- (-2157.015) [-2148.535] (-2157.218) (-2155.942) * (-2154.801) (-2162.184) [-2154.871] (-2162.125) -- 0:01:35
      486000 -- (-2153.819) (-2156.395) [-2155.284] (-2150.933) * (-2159.808) [-2147.765] (-2154.340) (-2158.897) -- 0:01:35
      486500 -- (-2152.009) (-2156.683) (-2158.590) [-2151.990] * (-2154.419) [-2152.369] (-2155.046) (-2152.586) -- 0:01:34
      487000 -- (-2154.515) (-2154.251) (-2149.059) [-2150.512] * (-2154.068) (-2153.726) [-2152.611] (-2152.894) -- 0:01:34
      487500 -- (-2153.276) [-2152.984] (-2152.367) (-2151.760) * (-2153.935) (-2154.747) [-2147.390] (-2148.362) -- 0:01:34
      488000 -- [-2151.457] (-2151.046) (-2152.500) (-2152.830) * [-2151.628] (-2156.590) (-2158.460) (-2152.977) -- 0:01:34
      488500 -- [-2152.595] (-2160.515) (-2151.930) (-2157.555) * (-2149.675) [-2156.105] (-2151.674) (-2151.445) -- 0:01:34
      489000 -- [-2149.964] (-2156.581) (-2159.455) (-2150.531) * (-2150.255) (-2160.202) [-2149.311] (-2153.900) -- 0:01:34
      489500 -- (-2153.546) (-2155.935) [-2155.591] (-2151.399) * (-2151.735) (-2150.321) (-2151.270) [-2151.806] -- 0:01:33
      490000 -- [-2153.470] (-2158.770) (-2156.038) (-2150.749) * (-2153.455) (-2151.461) (-2149.550) [-2152.155] -- 0:01:34

      Average standard deviation of split frequencies: 0.000480

      490500 -- (-2150.670) [-2149.148] (-2150.778) (-2152.736) * (-2159.586) (-2152.947) (-2156.966) [-2152.927] -- 0:01:34
      491000 -- [-2150.215] (-2154.828) (-2147.109) (-2152.426) * (-2151.846) (-2153.131) [-2155.349] (-2155.738) -- 0:01:34
      491500 -- (-2153.988) (-2158.106) [-2152.451] (-2153.626) * (-2151.630) [-2151.890] (-2157.273) (-2161.871) -- 0:01:34
      492000 -- [-2156.886] (-2153.136) (-2156.963) (-2156.348) * (-2150.711) (-2155.026) [-2154.581] (-2151.190) -- 0:01:33
      492500 -- (-2154.254) [-2157.574] (-2148.914) (-2148.536) * [-2151.179] (-2152.212) (-2154.371) (-2154.119) -- 0:01:33
      493000 -- [-2152.862] (-2148.454) (-2153.657) (-2152.565) * (-2153.323) [-2157.262] (-2153.803) (-2159.386) -- 0:01:33
      493500 -- (-2148.654) [-2148.980] (-2152.590) (-2159.938) * (-2154.244) (-2156.365) (-2151.861) [-2156.682] -- 0:01:33
      494000 -- (-2148.861) [-2152.017] (-2150.760) (-2163.763) * (-2155.410) (-2153.992) [-2153.968] (-2161.560) -- 0:01:33
      494500 -- [-2149.694] (-2154.899) (-2151.589) (-2160.656) * (-2154.037) (-2151.491) (-2155.360) [-2150.332] -- 0:01:33
      495000 -- (-2150.613) (-2150.973) (-2150.147) [-2152.279] * [-2153.175] (-2153.096) (-2152.258) (-2152.765) -- 0:01:32

      Average standard deviation of split frequencies: 0.000475

      495500 -- [-2153.517] (-2153.921) (-2150.768) (-2150.994) * (-2152.279) [-2153.699] (-2158.267) (-2147.264) -- 0:01:33
      496000 -- [-2150.453] (-2155.148) (-2155.623) (-2151.684) * (-2152.380) (-2159.204) [-2154.525] (-2150.518) -- 0:01:33
      496500 -- (-2160.140) (-2151.260) [-2155.738] (-2149.752) * (-2154.818) (-2160.589) (-2155.984) [-2157.747] -- 0:01:33
      497000 -- (-2148.720) (-2152.380) (-2150.224) [-2148.642] * (-2150.114) (-2156.424) (-2153.054) [-2152.791] -- 0:01:33
      497500 -- (-2154.121) (-2151.592) [-2151.614] (-2152.040) * [-2157.178] (-2157.150) (-2149.312) (-2151.038) -- 0:01:32
      498000 -- (-2153.485) (-2155.078) [-2153.728] (-2151.567) * (-2148.154) [-2152.678] (-2150.225) (-2150.064) -- 0:01:32
      498500 -- [-2155.331] (-2156.204) (-2154.768) (-2155.475) * (-2153.188) (-2148.868) [-2153.343] (-2154.108) -- 0:01:32
      499000 -- (-2154.256) (-2159.091) [-2152.937] (-2154.064) * (-2152.530) (-2153.996) (-2154.845) [-2151.261] -- 0:01:32
      499500 -- (-2151.916) (-2162.484) (-2159.213) [-2151.868] * [-2151.517] (-2158.411) (-2153.437) (-2151.934) -- 0:01:32
      500000 -- (-2153.124) (-2156.252) [-2154.024] (-2151.510) * (-2156.147) (-2152.420) (-2151.326) [-2155.003] -- 0:01:32

      Average standard deviation of split frequencies: 0.000471

      500500 -- (-2152.428) [-2149.404] (-2162.310) (-2153.487) * (-2159.562) [-2150.555] (-2149.554) (-2150.059) -- 0:01:31
      501000 -- (-2149.728) [-2152.011] (-2156.701) (-2152.001) * (-2151.098) (-2154.374) [-2157.855] (-2157.376) -- 0:01:32
      501500 -- (-2150.809) (-2148.188) (-2154.971) [-2151.346] * (-2154.249) [-2150.361] (-2155.664) (-2153.295) -- 0:01:32
      502000 -- (-2156.180) (-2153.377) [-2150.954] (-2149.567) * (-2153.565) (-2153.310) (-2154.825) [-2156.204] -- 0:01:32
      502500 -- [-2153.821] (-2152.552) (-2157.173) (-2152.656) * (-2160.555) (-2150.596) (-2160.380) [-2151.224] -- 0:01:32
      503000 -- (-2148.407) (-2155.760) (-2153.659) [-2156.800] * (-2157.155) [-2152.541] (-2152.898) (-2151.801) -- 0:01:31
      503500 -- (-2153.611) (-2155.966) (-2153.372) [-2151.283] * [-2156.198] (-2155.842) (-2154.668) (-2155.767) -- 0:01:31
      504000 -- (-2158.465) [-2152.602] (-2150.649) (-2150.946) * [-2149.510] (-2152.487) (-2152.955) (-2156.711) -- 0:01:31
      504500 -- (-2156.258) [-2155.597] (-2151.841) (-2151.569) * (-2159.502) (-2155.686) [-2153.504] (-2155.018) -- 0:01:31
      505000 -- (-2155.671) (-2150.475) (-2153.569) [-2152.154] * (-2163.114) (-2148.627) [-2152.366] (-2149.658) -- 0:01:31

      Average standard deviation of split frequencies: 0.000466

      505500 -- (-2147.727) (-2152.311) (-2156.288) [-2151.473] * (-2153.080) (-2150.145) [-2153.261] (-2153.062) -- 0:01:30
      506000 -- [-2150.843] (-2158.685) (-2158.878) (-2149.499) * [-2151.162] (-2154.265) (-2160.316) (-2151.701) -- 0:01:30
      506500 -- (-2156.069) (-2158.006) (-2159.520) [-2152.734] * (-2148.147) (-2154.442) (-2156.375) [-2159.590] -- 0:01:31
      507000 -- (-2151.492) (-2161.178) (-2158.429) [-2154.588] * (-2150.398) [-2152.258] (-2154.529) (-2153.360) -- 0:01:31
      507500 -- (-2154.225) (-2156.855) [-2158.670] (-2148.290) * [-2153.831] (-2155.191) (-2155.717) (-2147.438) -- 0:01:31
      508000 -- [-2148.199] (-2155.597) (-2159.565) (-2150.107) * (-2152.499) (-2156.591) (-2152.432) [-2152.379] -- 0:01:31
      508500 -- (-2156.674) [-2154.380] (-2155.986) (-2162.394) * (-2155.527) (-2153.779) (-2150.770) [-2148.893] -- 0:01:30
      509000 -- (-2154.707) (-2155.180) [-2149.805] (-2153.753) * (-2156.470) (-2153.984) [-2155.974] (-2159.677) -- 0:01:30
      509500 -- [-2158.106] (-2151.321) (-2151.089) (-2151.285) * [-2152.061] (-2161.956) (-2154.753) (-2151.914) -- 0:01:30
      510000 -- (-2159.167) (-2150.440) (-2152.985) [-2156.266] * [-2149.329] (-2149.337) (-2152.824) (-2151.854) -- 0:01:30

      Average standard deviation of split frequencies: 0.000462

      510500 -- (-2149.454) (-2154.240) [-2150.246] (-2152.914) * (-2151.046) [-2149.961] (-2149.741) (-2153.921) -- 0:01:30
      511000 -- (-2151.606) (-2151.487) [-2149.370] (-2153.433) * [-2155.630] (-2151.194) (-2153.384) (-2152.188) -- 0:01:29
      511500 -- (-2149.950) (-2154.237) (-2149.749) [-2156.429] * (-2153.113) (-2157.202) [-2150.233] (-2156.167) -- 0:01:29
      512000 -- (-2152.629) (-2154.560) [-2151.260] (-2152.706) * (-2151.663) [-2150.769] (-2152.214) (-2160.256) -- 0:01:30
      512500 -- (-2149.215) (-2150.205) [-2155.129] (-2156.583) * (-2157.612) [-2150.009] (-2156.754) (-2156.807) -- 0:01:30
      513000 -- (-2160.768) (-2157.878) (-2152.486) [-2155.209] * (-2153.595) [-2153.614] (-2151.508) (-2155.999) -- 0:01:30
      513500 -- (-2150.651) (-2158.238) (-2148.923) [-2152.209] * (-2147.276) (-2156.548) (-2147.819) [-2151.984] -- 0:01:30
      514000 -- (-2148.420) (-2154.957) (-2155.517) [-2152.864] * (-2155.453) [-2148.539] (-2155.195) (-2150.559) -- 0:01:29
      514500 -- (-2155.239) (-2150.171) (-2154.463) [-2152.637] * [-2147.847] (-2150.323) (-2153.586) (-2149.339) -- 0:01:29
      515000 -- (-2152.067) [-2149.044] (-2150.695) (-2154.381) * [-2149.983] (-2155.059) (-2155.310) (-2154.166) -- 0:01:29

      Average standard deviation of split frequencies: 0.000457

      515500 -- [-2149.641] (-2157.353) (-2152.305) (-2157.168) * [-2151.184] (-2153.884) (-2150.677) (-2158.624) -- 0:01:29
      516000 -- (-2153.358) [-2162.905] (-2156.023) (-2150.343) * (-2151.325) [-2156.677] (-2158.454) (-2162.353) -- 0:01:29
      516500 -- (-2158.244) (-2157.640) [-2158.951] (-2153.575) * (-2149.684) [-2152.296] (-2156.729) (-2159.107) -- 0:01:28
      517000 -- (-2153.584) (-2149.511) (-2157.082) [-2155.572] * (-2157.027) (-2153.093) (-2150.807) [-2163.082] -- 0:01:29
      517500 -- [-2155.063] (-2152.695) (-2152.323) (-2149.056) * (-2152.280) (-2159.887) [-2152.349] (-2156.933) -- 0:01:29
      518000 -- (-2158.843) [-2150.382] (-2147.917) (-2152.274) * (-2153.804) (-2152.906) [-2153.028] (-2158.548) -- 0:01:29
      518500 -- (-2156.278) [-2153.226] (-2149.498) (-2149.865) * (-2151.645) (-2153.209) (-2157.142) [-2155.470] -- 0:01:29
      519000 -- (-2160.618) (-2150.255) [-2154.290] (-2153.623) * (-2152.039) (-2153.864) [-2159.799] (-2150.373) -- 0:01:28
      519500 -- (-2158.964) [-2150.725] (-2154.353) (-2157.613) * (-2151.300) [-2151.614] (-2153.670) (-2150.364) -- 0:01:28
      520000 -- (-2156.932) [-2152.895] (-2153.053) (-2153.134) * (-2151.885) [-2148.820] (-2155.360) (-2154.767) -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      520500 -- [-2153.589] (-2156.498) (-2152.198) (-2158.141) * (-2148.691) (-2150.169) [-2158.880] (-2156.883) -- 0:01:28
      521000 -- (-2150.080) (-2162.221) [-2150.277] (-2147.357) * (-2154.377) (-2149.206) (-2156.846) [-2150.346] -- 0:01:28
      521500 -- (-2148.653) (-2158.909) [-2149.585] (-2151.311) * (-2153.217) (-2154.013) (-2161.200) [-2148.175] -- 0:01:28
      522000 -- (-2153.118) (-2154.228) (-2163.342) [-2147.916] * [-2151.051] (-2153.122) (-2159.562) (-2158.755) -- 0:01:27
      522500 -- [-2151.002] (-2155.014) (-2155.591) (-2157.728) * (-2153.602) [-2149.643] (-2152.754) (-2151.524) -- 0:01:28
      523000 -- (-2154.989) (-2152.019) (-2155.100) [-2157.916] * (-2150.798) (-2158.062) (-2155.282) [-2151.196] -- 0:01:28
      523500 -- (-2160.375) (-2150.436) [-2151.026] (-2156.843) * (-2152.678) [-2151.863] (-2158.784) (-2150.038) -- 0:01:28
      524000 -- (-2154.520) (-2151.446) (-2153.026) [-2146.874] * (-2151.194) [-2153.236] (-2152.966) (-2153.580) -- 0:01:28
      524500 -- (-2149.487) [-2154.202] (-2153.419) (-2156.477) * [-2146.825] (-2154.727) (-2158.447) (-2147.448) -- 0:01:27
      525000 -- [-2149.930] (-2154.400) (-2154.179) (-2150.417) * [-2149.486] (-2153.345) (-2154.135) (-2147.619) -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-2161.153) (-2151.941) [-2153.505] (-2148.379) * (-2158.139) [-2152.345] (-2148.276) (-2149.696) -- 0:01:27
      526000 -- (-2150.903) [-2151.754] (-2153.409) (-2150.880) * (-2156.215) (-2152.908) (-2147.026) [-2151.534] -- 0:01:27
      526500 -- (-2153.779) (-2150.860) (-2154.201) [-2153.764] * (-2148.980) (-2148.770) (-2148.451) [-2149.293] -- 0:01:27
      527000 -- (-2151.132) [-2152.910] (-2155.365) (-2148.066) * [-2155.239] (-2153.773) (-2146.588) (-2152.723) -- 0:01:27
      527500 -- (-2151.857) (-2155.746) [-2152.555] (-2151.339) * (-2155.146) (-2155.484) (-2151.863) [-2155.749] -- 0:01:26
      528000 -- (-2159.247) (-2146.906) (-2149.987) [-2150.346] * (-2157.343) (-2155.844) (-2153.094) [-2149.987] -- 0:01:27
      528500 -- (-2157.773) [-2148.266] (-2152.987) (-2148.597) * (-2152.892) (-2163.873) (-2149.779) [-2150.695] -- 0:01:27
      529000 -- [-2158.947] (-2153.900) (-2146.853) (-2151.306) * (-2150.542) (-2161.075) [-2155.653] (-2156.820) -- 0:01:27
      529500 -- (-2150.011) (-2153.167) [-2155.252] (-2155.492) * (-2156.424) (-2158.642) (-2157.699) [-2152.374] -- 0:01:27
      530000 -- [-2151.774] (-2153.316) (-2157.327) (-2150.529) * (-2149.732) (-2152.317) (-2156.929) [-2153.184] -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      530500 -- [-2150.714] (-2149.839) (-2156.927) (-2154.033) * (-2152.665) (-2154.518) (-2148.226) [-2155.048] -- 0:01:26
      531000 -- [-2154.165] (-2149.147) (-2154.945) (-2153.885) * (-2152.401) [-2152.483] (-2150.614) (-2154.962) -- 0:01:26
      531500 -- (-2152.208) [-2151.213] (-2152.890) (-2158.094) * (-2161.343) (-2156.647) [-2148.781] (-2155.258) -- 0:01:26
      532000 -- (-2159.724) (-2148.937) (-2158.142) [-2150.601] * (-2151.111) (-2153.869) (-2152.420) [-2159.865] -- 0:01:26
      532500 -- (-2154.276) (-2155.394) [-2152.228] (-2151.402) * [-2152.037] (-2150.715) (-2154.376) (-2149.471) -- 0:01:26
      533000 -- (-2152.055) (-2150.279) [-2151.237] (-2150.024) * (-2150.442) (-2156.788) [-2149.748] (-2151.955) -- 0:01:25
      533500 -- (-2153.066) (-2150.497) [-2147.590] (-2153.736) * (-2150.107) (-2158.326) (-2154.529) [-2157.943] -- 0:01:26
      534000 -- (-2155.590) (-2157.460) [-2151.390] (-2156.910) * [-2150.033] (-2149.122) (-2157.177) (-2163.540) -- 0:01:26
      534500 -- (-2161.282) [-2150.853] (-2151.186) (-2150.368) * (-2148.852) (-2150.635) [-2149.340] (-2153.208) -- 0:01:26
      535000 -- [-2148.080] (-2159.478) (-2149.962) (-2153.135) * (-2150.282) (-2161.995) [-2149.443] (-2153.129) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      535500 -- (-2154.634) (-2162.476) [-2151.618] (-2156.670) * (-2162.522) [-2149.722] (-2151.228) (-2155.471) -- 0:01:25
      536000 -- (-2151.056) (-2158.927) (-2148.932) [-2149.508] * (-2164.591) (-2151.683) (-2147.687) [-2149.535] -- 0:01:25
      536500 -- [-2150.909] (-2154.628) (-2153.859) (-2156.063) * [-2154.573] (-2152.336) (-2154.558) (-2149.979) -- 0:01:25
      537000 -- (-2149.374) [-2153.477] (-2147.809) (-2152.880) * (-2149.770) [-2156.152] (-2154.804) (-2151.464) -- 0:01:25
      537500 -- (-2153.318) [-2153.324] (-2156.037) (-2157.689) * [-2152.701] (-2150.187) (-2150.299) (-2155.468) -- 0:01:25
      538000 -- (-2151.139) (-2152.157) (-2153.371) [-2152.628] * [-2152.689] (-2150.847) (-2153.690) (-2153.876) -- 0:01:25
      538500 -- (-2158.137) (-2155.909) [-2151.088] (-2151.297) * [-2152.793] (-2150.622) (-2157.178) (-2154.425) -- 0:01:24
      539000 -- (-2157.403) [-2159.931] (-2151.994) (-2156.214) * (-2148.692) [-2152.693] (-2155.629) (-2149.809) -- 0:01:25
      539500 -- (-2152.919) (-2150.780) [-2153.406] (-2164.275) * (-2157.544) (-2156.475) (-2152.762) [-2152.813] -- 0:01:25
      540000 -- (-2153.153) [-2158.725] (-2154.903) (-2155.834) * (-2154.649) [-2148.555] (-2161.969) (-2152.438) -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      540500 -- [-2155.947] (-2157.761) (-2151.840) (-2154.825) * (-2151.739) (-2155.828) (-2157.248) [-2151.573] -- 0:01:25
      541000 -- [-2151.650] (-2158.416) (-2148.821) (-2155.502) * (-2163.428) (-2157.093) (-2153.577) [-2152.396] -- 0:01:24
      541500 -- (-2154.898) (-2153.186) (-2156.547) [-2150.060] * [-2158.221] (-2154.808) (-2155.656) (-2154.034) -- 0:01:24
      542000 -- [-2151.471] (-2148.317) (-2154.501) (-2151.876) * (-2150.743) (-2149.590) (-2152.372) [-2149.038] -- 0:01:24
      542500 -- (-2155.876) [-2159.511] (-2159.273) (-2151.628) * (-2155.447) (-2151.882) [-2153.445] (-2150.624) -- 0:01:24
      543000 -- [-2149.411] (-2157.606) (-2151.237) (-2154.783) * (-2161.317) (-2156.920) [-2150.594] (-2163.328) -- 0:01:24
      543500 -- (-2154.791) (-2164.748) (-2156.341) [-2148.417] * (-2150.076) [-2151.310] (-2152.520) (-2163.408) -- 0:01:23
      544000 -- [-2156.134] (-2152.738) (-2153.653) (-2153.457) * (-2149.064) [-2155.074] (-2147.171) (-2154.696) -- 0:01:23
      544500 -- (-2149.828) (-2150.981) [-2150.381] (-2150.848) * (-2152.440) [-2147.516] (-2149.897) (-2158.632) -- 0:01:24
      545000 -- (-2147.782) (-2154.664) (-2155.583) [-2152.076] * (-2150.224) [-2153.250] (-2153.314) (-2154.852) -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-2154.221) [-2158.523] (-2152.582) (-2155.728) * (-2152.711) (-2148.246) [-2160.743] (-2151.518) -- 0:01:24
      546000 -- (-2150.490) [-2150.638] (-2149.998) (-2159.231) * (-2153.356) (-2153.516) (-2156.276) [-2152.382] -- 0:01:23
      546500 -- (-2153.090) [-2147.735] (-2158.059) (-2155.700) * [-2150.932] (-2154.762) (-2154.145) (-2155.992) -- 0:01:23
      547000 -- (-2147.903) (-2156.530) [-2152.615] (-2157.345) * [-2152.650] (-2158.837) (-2149.659) (-2159.110) -- 0:01:23
      547500 -- (-2147.101) (-2158.272) [-2153.325] (-2151.669) * (-2155.695) (-2154.400) [-2152.176] (-2154.113) -- 0:01:23
      548000 -- (-2154.647) (-2153.319) (-2156.702) [-2150.606] * (-2151.724) (-2153.365) [-2153.026] (-2152.461) -- 0:01:23
      548500 -- (-2155.483) (-2152.993) (-2150.753) [-2150.773] * (-2154.205) (-2157.569) [-2150.103] (-2157.629) -- 0:01:23
      549000 -- (-2152.467) (-2152.250) [-2149.634] (-2150.325) * (-2154.812) (-2153.866) (-2152.556) [-2156.255] -- 0:01:22
      549500 -- [-2151.944] (-2154.023) (-2150.427) (-2150.047) * [-2151.007] (-2161.358) (-2148.918) (-2159.574) -- 0:01:22
      550000 -- [-2147.849] (-2155.409) (-2155.087) (-2154.284) * (-2152.663) [-2150.566] (-2148.684) (-2155.585) -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      550500 -- (-2150.155) (-2153.769) (-2151.094) [-2155.084] * (-2151.180) (-2149.253) [-2147.083] (-2154.254) -- 0:01:23
      551000 -- (-2149.553) [-2154.127] (-2149.006) (-2150.607) * (-2148.294) (-2154.428) [-2150.097] (-2156.507) -- 0:01:23
      551500 -- [-2149.798] (-2153.808) (-2147.497) (-2150.164) * [-2147.386] (-2155.086) (-2152.019) (-2150.966) -- 0:01:22
      552000 -- (-2147.472) (-2154.527) [-2147.487] (-2157.224) * [-2150.694] (-2151.626) (-2150.476) (-2151.043) -- 0:01:22
      552500 -- (-2157.266) [-2150.198] (-2152.443) (-2148.510) * (-2156.631) (-2152.259) [-2152.611] (-2149.374) -- 0:01:22
      553000 -- (-2162.903) (-2152.137) [-2153.543] (-2157.806) * (-2152.189) (-2153.998) (-2151.520) [-2150.659] -- 0:01:22
      553500 -- (-2157.042) [-2154.691] (-2149.999) (-2152.589) * (-2152.330) [-2149.477] (-2152.124) (-2158.006) -- 0:01:22
      554000 -- (-2151.753) [-2153.090] (-2152.444) (-2150.681) * [-2150.612] (-2151.723) (-2154.212) (-2157.470) -- 0:01:22
      554500 -- (-2151.253) (-2153.269) [-2154.116] (-2149.043) * (-2150.731) (-2152.422) (-2148.902) [-2149.299] -- 0:01:21
      555000 -- (-2155.712) [-2155.978] (-2156.719) (-2151.776) * (-2154.591) [-2151.188] (-2156.999) (-2155.009) -- 0:01:22

      Average standard deviation of split frequencies: 0.000000

      555500 -- (-2162.319) (-2152.981) (-2152.054) [-2150.042] * (-2152.183) (-2150.438) (-2158.644) [-2153.840] -- 0:01:22
      556000 -- [-2147.836] (-2164.007) (-2163.407) (-2159.392) * (-2152.891) (-2151.214) (-2155.768) [-2151.485] -- 0:01:22
      556500 -- [-2150.967] (-2153.535) (-2155.182) (-2159.859) * (-2151.496) (-2152.558) [-2150.766] (-2153.608) -- 0:01:22
      557000 -- (-2149.361) [-2158.622] (-2149.267) (-2161.465) * (-2155.766) (-2156.703) [-2152.621] (-2150.817) -- 0:01:21
      557500 -- (-2154.438) (-2152.341) (-2151.309) [-2161.128] * [-2152.678] (-2155.449) (-2157.953) (-2147.445) -- 0:01:21
      558000 -- [-2157.419] (-2157.221) (-2156.655) (-2158.361) * [-2156.222] (-2153.141) (-2153.616) (-2154.328) -- 0:01:21
      558500 -- (-2154.196) [-2153.542] (-2159.103) (-2155.314) * (-2152.428) (-2156.723) (-2155.713) [-2152.315] -- 0:01:21
      559000 -- [-2152.754] (-2154.922) (-2156.749) (-2150.822) * (-2152.254) (-2150.358) (-2151.652) [-2153.390] -- 0:01:21
      559500 -- (-2151.123) (-2151.138) [-2153.956] (-2152.012) * (-2149.410) [-2154.961] (-2155.302) (-2161.341) -- 0:01:21
      560000 -- [-2160.499] (-2154.239) (-2153.748) (-2150.442) * (-2150.103) [-2154.946] (-2158.190) (-2150.063) -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      560500 -- [-2154.858] (-2155.883) (-2155.828) (-2155.286) * (-2163.176) (-2157.533) (-2159.199) [-2150.193] -- 0:01:21
      561000 -- [-2151.333] (-2155.955) (-2149.956) (-2152.592) * (-2159.384) (-2155.647) (-2156.884) [-2152.946] -- 0:01:21
      561500 -- (-2157.591) (-2153.713) [-2154.858] (-2156.710) * [-2150.452] (-2153.436) (-2163.008) (-2149.187) -- 0:01:21
      562000 -- [-2150.434] (-2154.219) (-2153.901) (-2156.940) * [-2157.193] (-2153.834) (-2158.729) (-2151.225) -- 0:01:21
      562500 -- (-2150.416) (-2149.745) [-2152.243] (-2157.715) * (-2150.480) (-2153.808) (-2157.613) [-2152.194] -- 0:01:20
      563000 -- (-2156.464) (-2151.387) [-2149.929] (-2155.216) * (-2160.509) (-2156.180) (-2160.208) [-2152.704] -- 0:01:20
      563500 -- (-2147.179) (-2147.945) (-2154.232) [-2153.405] * (-2154.426) [-2151.132] (-2166.640) (-2151.862) -- 0:01:20
      564000 -- (-2150.581) [-2149.999] (-2160.069) (-2163.828) * [-2148.740] (-2150.321) (-2166.650) (-2158.033) -- 0:01:20
      564500 -- [-2151.007] (-2145.535) (-2158.406) (-2156.152) * [-2153.734] (-2151.262) (-2161.234) (-2151.295) -- 0:01:20
      565000 -- (-2154.075) [-2150.603] (-2159.761) (-2159.894) * (-2150.580) (-2149.357) (-2150.441) [-2147.003] -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      565500 -- [-2157.005] (-2151.833) (-2161.770) (-2158.505) * (-2153.588) [-2147.691] (-2150.798) (-2148.759) -- 0:01:19
      566000 -- (-2154.409) [-2152.078] (-2166.718) (-2160.838) * (-2153.812) [-2152.875] (-2151.322) (-2156.323) -- 0:01:20
      566500 -- (-2150.454) (-2153.591) (-2158.449) [-2152.812] * (-2153.407) (-2150.737) [-2145.618] (-2155.456) -- 0:01:20
      567000 -- [-2155.788] (-2150.843) (-2155.776) (-2155.852) * (-2159.018) (-2151.931) [-2151.150] (-2159.174) -- 0:01:20
      567500 -- (-2157.875) [-2152.035] (-2157.710) (-2157.234) * (-2150.224) [-2149.190] (-2149.751) (-2152.085) -- 0:01:20
      568000 -- (-2160.081) (-2154.875) [-2149.815] (-2159.466) * (-2160.589) [-2150.844] (-2152.140) (-2153.068) -- 0:01:19
      568500 -- (-2157.800) [-2147.984] (-2153.849) (-2155.051) * (-2161.622) (-2161.269) [-2156.298] (-2149.420) -- 0:01:19
      569000 -- (-2150.517) (-2147.478) [-2157.507] (-2153.061) * (-2150.884) [-2155.333] (-2152.298) (-2156.266) -- 0:01:19
      569500 -- (-2155.834) (-2150.728) (-2155.352) [-2149.358] * (-2150.268) (-2153.832) [-2150.222] (-2150.037) -- 0:01:19
      570000 -- (-2152.050) [-2150.979] (-2155.786) (-2154.839) * (-2146.877) (-2154.619) (-2151.833) [-2153.798] -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      570500 -- (-2150.782) [-2146.591] (-2156.868) (-2154.479) * [-2156.701] (-2155.199) (-2152.639) (-2150.215) -- 0:01:19
      571000 -- (-2153.076) (-2160.304) [-2152.655] (-2149.188) * (-2158.206) (-2149.549) [-2148.583] (-2153.709) -- 0:01:18
      571500 -- [-2152.413] (-2156.289) (-2150.116) (-2160.073) * [-2151.621] (-2150.869) (-2154.026) (-2152.483) -- 0:01:19
      572000 -- (-2151.124) [-2159.160] (-2151.772) (-2156.467) * (-2155.615) (-2164.206) (-2153.672) [-2150.671] -- 0:01:19
      572500 -- (-2153.343) (-2157.647) (-2153.869) [-2150.276] * (-2157.049) (-2157.682) (-2156.350) [-2152.594] -- 0:01:19
      573000 -- (-2155.514) (-2152.158) (-2154.989) [-2154.100] * (-2160.326) (-2152.964) [-2153.835] (-2153.620) -- 0:01:18
      573500 -- (-2155.290) (-2159.408) (-2149.418) [-2153.050] * (-2151.880) [-2151.414] (-2154.941) (-2156.988) -- 0:01:18
      574000 -- (-2160.157) (-2154.102) (-2156.160) [-2152.482] * (-2153.112) (-2164.031) [-2151.742] (-2151.528) -- 0:01:18
      574500 -- (-2154.323) [-2147.243] (-2166.826) (-2156.207) * [-2159.536] (-2158.169) (-2156.802) (-2150.686) -- 0:01:18
      575000 -- (-2151.262) [-2153.441] (-2157.529) (-2155.103) * (-2159.650) (-2153.191) (-2159.004) [-2152.804] -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-2154.204) (-2153.561) (-2164.199) [-2153.900] * (-2153.574) (-2154.036) [-2153.498] (-2150.949) -- 0:01:18
      576000 -- [-2157.190] (-2156.866) (-2150.768) (-2159.651) * [-2151.440] (-2152.964) (-2158.242) (-2153.026) -- 0:01:18
      576500 -- [-2153.422] (-2154.731) (-2155.795) (-2168.165) * (-2150.853) (-2150.840) [-2151.036] (-2152.719) -- 0:01:17
      577000 -- (-2150.848) (-2150.951) (-2153.329) [-2155.227] * (-2152.622) (-2153.169) [-2150.179] (-2151.252) -- 0:01:18
      577500 -- [-2154.136] (-2153.751) (-2159.930) (-2149.640) * (-2153.962) (-2151.892) [-2151.752] (-2153.726) -- 0:01:18
      578000 -- (-2158.956) [-2150.538] (-2158.503) (-2148.389) * (-2149.276) [-2156.352] (-2154.405) (-2148.171) -- 0:01:18
      578500 -- (-2155.589) (-2148.590) [-2157.247] (-2151.353) * (-2150.647) (-2153.195) [-2154.105] (-2148.354) -- 0:01:17
      579000 -- (-2157.864) [-2152.017] (-2156.335) (-2154.399) * [-2153.840] (-2155.436) (-2152.001) (-2151.488) -- 0:01:17
      579500 -- (-2155.007) (-2156.089) (-2148.919) [-2151.321] * (-2155.477) (-2158.831) [-2151.749] (-2155.207) -- 0:01:17
      580000 -- [-2158.248] (-2152.361) (-2156.176) (-2152.638) * [-2150.414] (-2154.607) (-2152.180) (-2150.343) -- 0:01:17

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-2155.644) [-2157.137] (-2154.640) (-2153.393) * (-2149.776) (-2156.995) [-2151.251] (-2156.635) -- 0:01:17
      581000 -- (-2154.435) (-2154.154) (-2154.806) [-2156.042] * [-2157.417] (-2161.592) (-2156.278) (-2156.928) -- 0:01:17
      581500 -- [-2160.515] (-2150.188) (-2149.931) (-2150.945) * (-2159.515) [-2156.045] (-2150.814) (-2155.796) -- 0:01:17
      582000 -- (-2148.517) (-2147.561) [-2151.676] (-2157.073) * (-2152.719) (-2160.302) [-2150.256] (-2153.544) -- 0:01:16
      582500 -- (-2163.809) [-2152.241] (-2153.790) (-2152.587) * (-2149.772) [-2148.658] (-2155.829) (-2150.643) -- 0:01:17
      583000 -- (-2155.162) (-2149.400) (-2150.713) [-2146.454] * (-2150.321) [-2153.009] (-2154.655) (-2153.854) -- 0:01:17
      583500 -- (-2154.312) [-2152.710] (-2152.985) (-2150.969) * (-2153.469) [-2153.683] (-2152.416) (-2156.469) -- 0:01:17
      584000 -- (-2156.702) (-2154.166) [-2155.066] (-2157.985) * [-2153.353] (-2162.861) (-2152.889) (-2152.033) -- 0:01:16
      584500 -- (-2155.480) (-2156.025) [-2151.786] (-2148.173) * (-2151.379) (-2149.286) (-2151.039) [-2154.350] -- 0:01:16
      585000 -- [-2158.004] (-2159.467) (-2149.546) (-2155.183) * [-2153.479] (-2148.357) (-2159.916) (-2159.582) -- 0:01:16

      Average standard deviation of split frequencies: 0.000000

      585500 -- [-2155.463] (-2153.700) (-2151.159) (-2154.479) * (-2149.567) [-2150.784] (-2155.398) (-2153.161) -- 0:01:16
      586000 -- (-2150.063) [-2154.433] (-2154.094) (-2150.671) * (-2153.304) (-2155.315) (-2152.286) [-2153.003] -- 0:01:16
      586500 -- (-2149.843) (-2158.657) (-2151.681) [-2157.295] * (-2148.963) (-2153.019) (-2151.720) [-2151.552] -- 0:01:16
      587000 -- [-2147.357] (-2154.991) (-2157.567) (-2159.303) * [-2150.825] (-2155.343) (-2154.514) (-2152.350) -- 0:01:15
      587500 -- (-2152.833) (-2158.356) [-2154.111] (-2162.708) * (-2150.197) [-2151.672] (-2153.826) (-2153.177) -- 0:01:15
      588000 -- (-2157.194) [-2150.959] (-2151.499) (-2156.346) * [-2154.637] (-2152.995) (-2157.078) (-2150.798) -- 0:01:16
      588500 -- (-2154.590) [-2155.068] (-2153.421) (-2159.674) * (-2152.124) (-2153.981) [-2152.949] (-2155.892) -- 0:01:16
      589000 -- (-2155.298) (-2147.372) (-2153.801) [-2154.228] * (-2151.742) [-2151.632] (-2150.500) (-2149.185) -- 0:01:16
      589500 -- [-2152.981] (-2151.929) (-2156.433) (-2157.438) * (-2150.950) [-2150.496] (-2151.341) (-2153.563) -- 0:01:15
      590000 -- (-2151.833) (-2153.207) (-2156.143) [-2155.900] * (-2152.542) (-2164.469) (-2151.192) [-2148.561] -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-2153.382) (-2156.888) (-2149.958) [-2152.757] * [-2152.261] (-2162.834) (-2159.206) (-2147.759) -- 0:01:15
      591000 -- [-2149.106] (-2153.007) (-2153.632) (-2152.965) * (-2155.036) (-2150.303) [-2149.132] (-2154.360) -- 0:01:15
      591500 -- (-2157.296) [-2154.025] (-2152.804) (-2149.659) * (-2152.681) (-2155.101) (-2153.964) [-2154.219] -- 0:01:15
      592000 -- (-2153.371) (-2154.844) (-2162.840) [-2151.456] * (-2150.234) [-2148.141] (-2150.885) (-2151.489) -- 0:01:15
      592500 -- (-2157.277) (-2157.342) (-2153.322) [-2146.472] * (-2154.889) (-2150.834) (-2154.404) [-2151.982] -- 0:01:14
      593000 -- (-2149.154) (-2157.488) [-2154.193] (-2154.179) * (-2160.401) (-2155.347) (-2149.507) [-2149.777] -- 0:01:15
      593500 -- (-2154.982) [-2157.497] (-2151.483) (-2154.270) * (-2156.460) [-2152.553] (-2150.585) (-2153.999) -- 0:01:15
      594000 -- (-2150.345) [-2155.008] (-2152.438) (-2152.220) * [-2150.028] (-2157.456) (-2150.743) (-2158.123) -- 0:01:15
      594500 -- [-2152.290] (-2151.180) (-2149.895) (-2149.247) * (-2150.617) (-2161.095) (-2151.754) [-2149.548] -- 0:01:15
      595000 -- (-2150.325) [-2155.816] (-2154.094) (-2155.374) * (-2156.652) (-2157.246) (-2153.290) [-2156.688] -- 0:01:14

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-2153.705) [-2154.756] (-2156.540) (-2153.316) * (-2150.511) (-2154.518) (-2151.996) [-2153.799] -- 0:01:14
      596000 -- (-2151.401) [-2152.720] (-2154.097) (-2155.363) * (-2155.309) [-2150.432] (-2152.586) (-2151.728) -- 0:01:14
      596500 -- [-2150.138] (-2151.165) (-2148.519) (-2157.975) * [-2154.471] (-2150.189) (-2149.217) (-2152.533) -- 0:01:14
      597000 -- [-2152.607] (-2154.332) (-2152.669) (-2153.748) * (-2150.996) [-2153.508] (-2150.933) (-2152.812) -- 0:01:14
      597500 -- (-2153.633) (-2149.119) (-2152.598) [-2151.728] * (-2161.866) [-2154.584] (-2150.335) (-2158.996) -- 0:01:14
      598000 -- [-2150.796] (-2155.178) (-2158.802) (-2155.314) * (-2162.793) (-2154.099) (-2151.499) [-2154.134] -- 0:01:13
      598500 -- [-2154.742] (-2152.459) (-2150.444) (-2152.249) * (-2151.701) [-2157.936] (-2155.245) (-2151.336) -- 0:01:14
      599000 -- (-2154.705) (-2147.269) [-2151.345] (-2150.316) * (-2151.364) (-2155.659) [-2158.638] (-2157.345) -- 0:01:14
      599500 -- (-2164.403) [-2151.216] (-2149.789) (-2151.046) * [-2152.740] (-2153.220) (-2161.975) (-2152.729) -- 0:01:14
      600000 -- [-2153.418] (-2150.640) (-2149.943) (-2153.358) * (-2150.495) (-2154.949) [-2153.518] (-2157.484) -- 0:01:14

      Average standard deviation of split frequencies: 0.000000

      600500 -- (-2152.992) (-2154.972) [-2154.419] (-2152.286) * (-2156.810) (-2155.764) [-2153.408] (-2154.323) -- 0:01:13
      601000 -- (-2154.496) (-2150.334) [-2153.677] (-2149.824) * (-2157.667) (-2153.480) [-2155.023] (-2156.262) -- 0:01:13
      601500 -- (-2158.810) [-2156.722] (-2154.580) (-2150.633) * (-2157.513) (-2152.263) (-2152.514) [-2146.586] -- 0:01:13
      602000 -- (-2156.417) [-2148.721] (-2157.188) (-2155.546) * (-2156.723) (-2149.796) [-2148.652] (-2151.534) -- 0:01:13
      602500 -- (-2156.741) [-2151.425] (-2157.674) (-2147.444) * (-2152.111) [-2153.317] (-2150.673) (-2154.561) -- 0:01:13
      603000 -- (-2151.190) (-2154.928) [-2151.751] (-2154.038) * (-2148.937) [-2150.180] (-2157.854) (-2151.752) -- 0:01:13
      603500 -- [-2149.213] (-2146.323) (-2155.466) (-2151.983) * (-2159.260) (-2157.086) (-2155.829) [-2152.964] -- 0:01:12
      604000 -- (-2157.375) (-2147.207) (-2157.491) [-2152.649] * (-2152.989) (-2154.180) (-2163.815) [-2151.859] -- 0:01:13
      604500 -- (-2154.730) (-2149.830) [-2157.347] (-2153.407) * [-2153.322] (-2151.218) (-2159.177) (-2156.028) -- 0:01:13
      605000 -- [-2150.076] (-2153.422) (-2156.450) (-2154.490) * (-2158.893) [-2157.818] (-2157.469) (-2151.332) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      605500 -- [-2154.065] (-2151.695) (-2160.531) (-2153.462) * [-2153.712] (-2151.052) (-2149.852) (-2153.282) -- 0:01:12
      606000 -- (-2152.885) [-2154.344] (-2156.583) (-2151.566) * [-2146.993] (-2149.264) (-2157.623) (-2153.016) -- 0:01:12
      606500 -- (-2165.028) (-2149.455) [-2153.411] (-2151.982) * [-2149.885] (-2150.603) (-2149.375) (-2147.928) -- 0:01:12
      607000 -- (-2150.889) [-2150.929] (-2148.870) (-2151.138) * (-2156.613) [-2147.627] (-2149.571) (-2154.959) -- 0:01:12
      607500 -- (-2146.697) [-2149.058] (-2150.338) (-2156.830) * [-2151.748] (-2161.112) (-2157.250) (-2151.653) -- 0:01:12
      608000 -- (-2153.020) (-2153.002) [-2151.532] (-2154.837) * (-2161.393) (-2156.094) (-2151.067) [-2145.976] -- 0:01:12
      608500 -- (-2156.700) (-2154.513) (-2148.058) [-2154.695] * (-2153.901) (-2152.340) [-2151.324] (-2149.591) -- 0:01:12
      609000 -- (-2151.530) (-2152.509) (-2154.916) [-2151.321] * [-2147.165] (-2150.006) (-2152.106) (-2150.012) -- 0:01:11
      609500 -- (-2150.210) (-2159.328) [-2148.919] (-2151.706) * (-2153.991) (-2147.665) (-2147.714) [-2152.245] -- 0:01:12
      610000 -- (-2157.435) [-2149.637] (-2149.755) (-2152.348) * (-2159.973) [-2154.827] (-2154.553) (-2155.052) -- 0:01:12

      Average standard deviation of split frequencies: 0.000000

      610500 -- (-2153.552) (-2148.748) [-2150.172] (-2152.449) * (-2154.601) (-2154.997) (-2153.274) [-2151.461] -- 0:01:12
      611000 -- (-2148.481) [-2149.971] (-2154.171) (-2152.258) * (-2151.190) (-2155.948) [-2150.658] (-2156.590) -- 0:01:11
      611500 -- (-2149.660) (-2153.399) [-2149.991] (-2152.897) * [-2152.929] (-2153.088) (-2151.396) (-2150.959) -- 0:01:11
      612000 -- (-2154.949) (-2150.897) [-2156.233] (-2151.074) * (-2150.600) (-2151.228) [-2150.882] (-2155.350) -- 0:01:11
      612500 -- (-2149.325) (-2150.799) (-2152.952) [-2151.027] * (-2156.225) (-2156.589) (-2148.236) [-2149.160] -- 0:01:11
      613000 -- (-2155.866) (-2152.081) (-2154.434) [-2152.590] * [-2157.020] (-2148.959) (-2151.657) (-2150.717) -- 0:01:11
      613500 -- [-2153.360] (-2150.921) (-2153.986) (-2156.723) * (-2158.177) [-2148.527] (-2148.668) (-2148.453) -- 0:01:11
      614000 -- (-2158.061) (-2149.415) [-2154.225] (-2155.540) * (-2153.468) [-2153.277] (-2159.531) (-2149.379) -- 0:01:11
      614500 -- (-2148.620) [-2151.906] (-2151.975) (-2162.244) * (-2160.685) (-2151.993) (-2153.368) [-2156.317] -- 0:01:10
      615000 -- (-2153.920) (-2149.801) [-2153.305] (-2153.270) * (-2150.696) (-2157.207) [-2150.810] (-2158.872) -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      615500 -- (-2149.463) [-2151.417] (-2154.382) (-2154.529) * (-2149.870) [-2151.200] (-2151.901) (-2150.980) -- 0:01:11
      616000 -- (-2152.579) [-2147.388] (-2150.976) (-2154.432) * [-2154.551] (-2152.631) (-2151.779) (-2148.415) -- 0:01:11
      616500 -- (-2153.970) (-2155.446) [-2153.037] (-2157.232) * [-2158.317] (-2153.590) (-2149.262) (-2153.831) -- 0:01:10
      617000 -- (-2152.944) (-2158.456) [-2156.676] (-2154.447) * (-2151.664) (-2153.299) [-2152.931] (-2150.888) -- 0:01:10
      617500 -- (-2150.001) (-2155.438) [-2152.453] (-2152.111) * (-2153.669) (-2150.209) (-2156.051) [-2146.350] -- 0:01:10
      618000 -- [-2152.677] (-2152.561) (-2157.932) (-2149.936) * (-2153.522) (-2149.302) [-2155.697] (-2148.721) -- 0:01:10
      618500 -- (-2153.332) (-2156.680) (-2152.406) [-2154.091] * (-2150.437) [-2150.689] (-2152.087) (-2150.749) -- 0:01:10
      619000 -- (-2161.144) (-2149.333) (-2148.162) [-2148.689] * [-2152.313] (-2153.865) (-2153.430) (-2155.390) -- 0:01:10
      619500 -- (-2149.444) (-2153.872) [-2150.498] (-2152.029) * [-2151.197] (-2151.717) (-2154.028) (-2160.409) -- 0:01:10
      620000 -- [-2147.617] (-2155.061) (-2159.222) (-2159.046) * (-2148.592) (-2153.766) [-2157.399] (-2154.855) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-2154.368) (-2152.667) [-2152.900] (-2171.728) * (-2146.361) (-2153.461) [-2150.475] (-2155.376) -- 0:01:10
      621000 -- (-2153.604) [-2154.769] (-2150.301) (-2151.225) * (-2151.225) (-2153.932) [-2149.624] (-2159.119) -- 0:01:10
      621500 -- [-2152.292] (-2154.302) (-2157.182) (-2151.072) * [-2154.336] (-2145.971) (-2147.708) (-2153.719) -- 0:01:10
      622000 -- (-2153.211) (-2151.393) [-2157.974] (-2151.689) * (-2155.909) [-2152.815] (-2148.502) (-2156.677) -- 0:01:09
      622500 -- [-2149.037] (-2154.300) (-2161.527) (-2154.035) * (-2156.563) (-2155.336) [-2149.424] (-2148.462) -- 0:01:09
      623000 -- [-2153.539] (-2154.485) (-2150.970) (-2153.229) * (-2154.526) (-2153.448) [-2151.191] (-2153.750) -- 0:01:09
      623500 -- (-2150.315) (-2159.989) [-2151.097] (-2153.328) * (-2149.439) [-2152.054] (-2157.647) (-2147.633) -- 0:01:09
      624000 -- [-2147.003] (-2153.813) (-2154.031) (-2155.602) * [-2153.945] (-2155.278) (-2152.960) (-2152.132) -- 0:01:09
      624500 -- (-2151.350) (-2153.651) (-2155.515) [-2154.652] * (-2150.057) [-2151.676] (-2159.215) (-2151.643) -- 0:01:09
      625000 -- (-2157.508) [-2155.113] (-2149.343) (-2154.170) * (-2151.795) (-2153.153) [-2156.902] (-2148.981) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      625500 -- (-2163.813) (-2160.274) (-2154.385) [-2152.003] * (-2150.349) [-2152.698] (-2152.349) (-2146.993) -- 0:01:08
      626000 -- (-2161.801) (-2146.843) [-2154.123] (-2155.679) * [-2153.734] (-2154.940) (-2158.222) (-2153.348) -- 0:01:09
      626500 -- (-2156.608) [-2148.626] (-2152.162) (-2151.765) * (-2152.304) (-2149.005) [-2157.953] (-2150.926) -- 0:01:09
      627000 -- (-2157.991) (-2150.166) [-2154.644] (-2150.992) * (-2154.852) [-2154.467] (-2151.747) (-2150.815) -- 0:01:09
      627500 -- [-2151.166] (-2148.999) (-2151.578) (-2151.