--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 10 13:04:32 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/zetaCOP-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1268.65 -1288.77
2 -1269.10 -1288.52
--------------------------------------
TOTAL -1268.85 -1288.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.597175 0.010589 0.414757 0.807198 0.586482 1356.58 1373.95 1.001
r(A<->C){all} 0.070146 0.000767 0.018002 0.124506 0.067771 669.45 758.23 1.002
r(A<->G){all} 0.192573 0.004000 0.081809 0.319676 0.185741 297.94 463.39 1.000
r(A<->T){all} 0.176646 0.004723 0.054089 0.313885 0.168674 674.68 756.99 1.004
r(C<->G){all} 0.106215 0.000915 0.051155 0.165961 0.103492 939.79 990.41 1.000
r(C<->T){all} 0.415162 0.005956 0.265335 0.564465 0.415464 429.81 458.13 1.002
r(G<->T){all} 0.039257 0.000797 0.000006 0.093596 0.033561 733.18 776.33 1.001
pi(A){all} 0.261266 0.000361 0.225538 0.298512 0.260944 1187.66 1205.31 1.000
pi(C){all} 0.286420 0.000365 0.250574 0.324394 0.286059 1077.56 1159.49 1.000
pi(G){all} 0.246841 0.000323 0.212079 0.280494 0.247058 1217.33 1220.34 1.000
pi(T){all} 0.205473 0.000299 0.173392 0.240658 0.204950 1223.44 1247.52 1.000
alpha{1,2} 0.053358 0.001032 0.000120 0.105918 0.053610 726.78 908.71 1.000
alpha{3} 2.303848 0.657002 0.902346 3.883531 2.171919 1227.80 1364.40 1.000
pinvar{all} 0.568607 0.002934 0.460516 0.673115 0.571043 721.17 796.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1158.89464
Model 2: PositiveSelection -1158.894641
Model 0: one-ratio -1166.087332
Model 3: discrete -1158.842604
Model 7: beta -1160.150898
Model 8: beta&w>1 -1158.932845
Model 0 vs 1 14.385384000000158
Model 2 vs 1 2.000000222324161E-6
Model 8 vs 7 2.436106000000109
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTSTLNGLFW
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=169
C1 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C2 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C3 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C4 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C5 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C6 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C7 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C8 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C9 MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C10 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
*******************:******************************
C1 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C2 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C3 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C4 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C5 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C6 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C7 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C8 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C9 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C10 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
**************************************************
C1 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C2 ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C3 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C4 ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C5 ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C6 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
C7 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C8 ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
C9 ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
C10 ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
************: ***************:********:***********
C1 PIAEQTVAQVTNTLNGLFW
C2 PIAEQTVAQVTNTLNGLFW
C3 PIAEQTVAQVTNTLNGLFW
C4 PIAEQTVAQVTNTLNGIFW
C5 PIAEQTVAQVTNTLNGIFW
C6 PIAEQTVAQVTNTLNGLFW
C7 PIAEQTVAQVTNTLNGLFW
C8 PIAEQTVAQVTSTLNGLFW
C9 PIAEQTVAQVTNTLNGLFW
C10 PIAEQTVAQVTNTLNGLFW
***********.****:**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 169 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 169 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15210]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [15210]--->[15210]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.528 Mb, Max= 30.925 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTSTLNGLFW
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
FORMAT of file /tmp/tmp3336005239149342730aln Not Supported[FATAL:T-COFFEE]
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTSTLNGLFW
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:169 S:100 BS:169
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 99.41 C1 C2 99.41
TOP 1 0 99.41 C2 C1 99.41
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 98.82 C1 C4 98.82
TOP 3 0 98.82 C4 C1 98.82
BOT 0 4 98.82 C1 C5 98.82
TOP 4 0 98.82 C5 C1 98.82
BOT 0 5 99.41 C1 C6 99.41
TOP 5 0 99.41 C6 C1 99.41
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 98.82 C1 C8 98.82
TOP 7 0 98.82 C8 C1 98.82
BOT 0 8 98.22 C1 C9 98.22
TOP 8 0 98.22 C9 C1 98.22
BOT 0 9 99.41 C1 C10 99.41
TOP 9 0 99.41 C10 C1 99.41
BOT 1 2 99.41 C2 C3 99.41
TOP 2 1 99.41 C3 C2 99.41
BOT 1 3 99.41 C2 C4 99.41
TOP 3 1 99.41 C4 C2 99.41
BOT 1 4 98.22 C2 C5 98.22
TOP 4 1 98.22 C5 C2 98.22
BOT 1 5 98.82 C2 C6 98.82
TOP 5 1 98.82 C6 C2 98.82
BOT 1 6 99.41 C2 C7 99.41
TOP 6 1 99.41 C7 C2 99.41
BOT 1 7 98.22 C2 C8 98.22
TOP 7 1 98.22 C8 C2 98.22
BOT 1 8 98.82 C2 C9 98.82
TOP 8 1 98.82 C9 C2 98.82
BOT 1 9 98.82 C2 C10 98.82
TOP 9 1 98.82 C10 C2 98.82
BOT 2 3 98.82 C3 C4 98.82
TOP 3 2 98.82 C4 C3 98.82
BOT 2 4 98.82 C3 C5 98.82
TOP 4 2 98.82 C5 C3 98.82
BOT 2 5 99.41 C3 C6 99.41
TOP 5 2 99.41 C6 C3 99.41
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 98.82 C3 C8 98.82
TOP 7 2 98.82 C8 C3 98.82
BOT 2 8 98.22 C3 C9 98.22
TOP 8 2 98.22 C9 C3 98.22
BOT 2 9 99.41 C3 C10 99.41
TOP 9 2 99.41 C10 C3 99.41
BOT 3 4 98.82 C4 C5 98.82
TOP 4 3 98.82 C5 C4 98.82
BOT 3 5 98.22 C4 C6 98.22
TOP 5 3 98.22 C6 C4 98.22
BOT 3 6 98.82 C4 C7 98.82
TOP 6 3 98.82 C7 C4 98.82
BOT 3 7 97.63 C4 C8 97.63
TOP 7 3 97.63 C8 C4 97.63
BOT 3 8 98.22 C4 C9 98.22
TOP 8 3 98.22 C9 C4 98.22
BOT 3 9 98.22 C4 C10 98.22
TOP 9 3 98.22 C10 C4 98.22
BOT 4 5 98.22 C5 C6 98.22
TOP 5 4 98.22 C6 C5 98.22
BOT 4 6 98.82 C5 C7 98.82
TOP 6 4 98.82 C7 C5 98.82
BOT 4 7 97.63 C5 C8 97.63
TOP 7 4 97.63 C8 C5 97.63
BOT 4 8 97.04 C5 C9 97.04
TOP 8 4 97.04 C9 C5 97.04
BOT 4 9 98.22 C5 C10 98.22
TOP 9 4 98.22 C10 C5 98.22
BOT 5 6 99.41 C6 C7 99.41
TOP 6 5 99.41 C7 C6 99.41
BOT 5 7 98.22 C6 C8 98.22
TOP 7 5 98.22 C8 C6 98.22
BOT 5 8 97.63 C6 C9 97.63
TOP 8 5 97.63 C9 C6 97.63
BOT 5 9 98.82 C6 C10 98.82
TOP 9 5 98.82 C10 C6 98.82
BOT 6 7 98.82 C7 C8 98.82
TOP 7 6 98.82 C8 C7 98.82
BOT 6 8 98.22 C7 C9 98.22
TOP 8 6 98.22 C9 C7 98.22
BOT 6 9 99.41 C7 C10 99.41
TOP 9 6 99.41 C10 C7 99.41
BOT 7 8 98.22 C8 C9 98.22
TOP 8 7 98.22 C9 C8 98.22
BOT 7 9 99.41 C8 C10 99.41
TOP 9 7 99.41 C10 C8 99.41
BOT 8 9 98.82 C9 C10 98.82
TOP 9 8 98.82 C10 C9 98.82
AVG 0 C1 * 99.21
AVG 1 C2 * 98.95
AVG 2 C3 * 99.21
AVG 3 C4 * 98.55
AVG 4 C5 * 98.29
AVG 5 C6 * 98.69
AVG 6 C7 * 99.21
AVG 7 C8 * 98.42
AVG 8 C9 * 98.16
AVG 9 C10 * 98.95
TOT TOT * 98.76
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
C2 ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
C3 ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
C4 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C5 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C6 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C7 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C8 ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C9 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C10 ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
*********** ******** *****************************
C1 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C2 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C3 CGATGGCAACCGCATCCTGGCCAAGTATTACGACAAGAACATCCTGTCCA
C4 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C5 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCTTGTCCA
C6 CGACGGCAACCGCATCCTGGCCAAGTACTACGACAAAAACATTCTGTCCA
C7 CGACGGGAACCGCATCCTGGCCAAGTACTACGACAAGAACATACTGTCCA
C8 CGATGGAAACCGCATCCTGGCCAAATACTACGATAAAAACATCTTGTCCA
C9 TGATGGAGACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C10 TGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
** ** .****************.** ***** **.***** ******
C1 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C2 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C3 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C4 CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
C5 CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
C6 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
C7 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
C8 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
C9 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C10 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
********************** ***************** *********
C1 CGCTCCAACACGGAGATCATTATGCTGGACGGACTCACCTGCGTGTACAA
C2 CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
C3 CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
C4 CGCTCCAACACGGAGATCATCATGCTGGATGGACTTACCTGCGTCTACAA
C5 CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTCTACAA
C6 CGCTCCAACACGGAGATCATAATGCTGGACGGGCTCACCTGCGTCTACAA
C7 CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
C8 CGCTCCAACACGGAGATCATAATGCTGGACGGACTCACCTGCGTCTACAA
C9 CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
C10 CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
******************** ******** **.** ******** *****
C1 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C2 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C3 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C4 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C5 GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C6 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C7 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C8 AAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C9 GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAATGCCTACGAGAATG
C10 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
.************** ******************** *********** *
C1 AGCTCATCCTGCTGTCCGTGCTCAACTGCCTCTACGATTCCATTAGCCTG
C2 AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
C3 AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
C4 AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCCATCAGCCTG
C5 AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCTATCAGCCTG
C6 AGCTCATCCTGCTCTCGGTGCTCAACTGCCTGTACGACTCCATCAGCCTG
C7 AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
C8 AGCTGATCCTGCTGTCTGTGCTCAACTGCCTGTACGACTCCATCAGCCTA
C9 AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTA
C10 AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
**** ***** ** ** *****.******** ***** ** ** *****.
C1 ATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
C2 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
C3 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
C4 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
C5 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAATACCTGGAGAT
C6 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
C7 ATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
C8 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
C9 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGACAACCTGGAGAT
C10 ATCCTCAAGAAGAACGTGGAGAAGCGACTGGTGCTGGAGAACCTGGAGAT
** *********** ** ********.*********** :**********
C1 CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
C2 CATCATGCTGGCTTTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
C3 CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
C4 CATCATGCTGGCCTTTGACGAGATCTGCGACGGAGGCATAATTCTGGATG
C5 CATCATGCTGGCCTTTGACGAGATCTGCGATGGAGGCATAATTCTGGATG
C6 CATCATGCTGGCCTTCGATGAGATCTGCGACGGAGGCATAATCCTGGATG
C7 CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATTATCCTGGACG
C8 CATCATGCTGGCCTTTGATGAAATCTGCGACGGAGGCATGATTCTGGATG
C9 CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATGATCCTGGATG
C10 CATCATGCTCGCCTTCGACGAGATCTGTGACGGAGGAATGATCCTGGATG
********* ** ** ** **.***** ** *****.** ** ***** *
C1 CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C2 CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C3 CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C4 CCGATCCGTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C5 CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C6 CCGATCCATCGTCCATTGTGAAACGTGTCGATCTGCGCAACGATGACATT
C7 CGGATCCCTCGTCCGTGGTGAAACGCGTCGATCTGCGCAACGATGACATT
C8 CGGATCCCTCCTCCGTAGTGAAACGCGTCGATCTGCGCAACGATGACATT
C9 CGGATCCCTCGTCCGTGGTGAAACGAGTCGATCTGCGCAACGATGACATT
C10 CGGATCCCTCATCCGTCGTGAAACGAGTCGATCTGCGCAACGATGACATT
* ***** ** ** .* ******** ** *********************
C1 CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT
C2 CCCATTGCCGAACAAACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT
C3 CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT
C4 CCAATTGCCGAACAGACCGTCGCCCAGGTAACTAATACCCTTAATGGTAT
C5 CCAATTGCCGAACAGACCGTTGCCCAGGTAACTAATACCCTTAATGGTAT
C6 CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTAAATGGTCT
C7 CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACTCTAAATGGTCT
C8 CCTATTGCCGAACAAACCGTTGCCCAGGTAACTAGCACCCTAAATGGTCT
C9 CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTAAATGGTCT
C10 CCCATCGCCGAACAGACCGTTGCCCAGGTAACTAACACTCTAAATGGTCT
** ** ********.***** *************. ** **:******.*
C1 ATTTTGG
C2 ATTTTGG
C3 ATTTTGG
C4 ATTTTGG
C5 ATTTTGG
C6 ATTTTGG
C7 ATTCTGG
C8 ATTTTGG
C9 ATTTTGG
C10 ATTTTGG
*** ***
>C1
ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATTATGCTGGACGGACTCACCTGCGTGTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTGTCCGTGCTCAACTGCCTCTACGATTCCATTAGCCTG
ATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT
ATTTTGG
>C2
ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
CATCATGCTGGCTTTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCCATTGCCGAACAAACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT
ATTTTGG
>C3
ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTATTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT
ATTTTGG
>C4
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGATGGACTTACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
CATCATGCTGGCCTTTGACGAGATCTGCGACGGAGGCATAATTCTGGATG
CCGATCCGTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCAATTGCCGAACAGACCGTCGCCCAGGTAACTAATACCCTTAATGGTAT
ATTTTGG
>C5
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCTTGTCCA
CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTCTACAA
GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCTATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAATACCTGGAGAT
CATCATGCTGGCCTTTGACGAGATCTGCGATGGAGGCATAATTCTGGATG
CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCAATTGCCGAACAGACCGTTGCCCAGGTAACTAATACCCTTAATGGTAT
ATTTTGG
>C6
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGACGGCAACCGCATCCTGGCCAAGTACTACGACAAAAACATTCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATAATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCGGTGCTCAACTGCCTGTACGACTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
CATCATGCTGGCCTTCGATGAGATCTGCGACGGAGGCATAATCCTGGATG
CCGATCCATCGTCCATTGTGAAACGTGTCGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTAAATGGTCT
ATTTTGG
>C7
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGACGGGAACCGCATCCTGGCCAAGTACTACGACAAGAACATACTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
ATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATTATCCTGGACG
CGGATCCCTCGTCCGTGGTGAAACGCGTCGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACTCTAAATGGTCT
ATTCTGG
>C8
ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGATGGAAACCGCATCCTGGCCAAATACTACGATAAAAACATCTTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATAATGCTGGACGGACTCACCTGCGTCTACAA
AAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTGATCCTGCTGTCTGTGCTCAACTGCCTGTACGACTCCATCAGCCTA
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
CATCATGCTGGCCTTTGATGAAATCTGCGACGGAGGCATGATTCTGGATG
CGGATCCCTCCTCCGTAGTGAAACGCGTCGATCTGCGCAACGATGACATT
CCTATTGCCGAACAAACCGTTGCCCAGGTAACTAGCACCCTAAATGGTCT
ATTTTGG
>C9
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
TGATGGAGACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAATGCCTACGAGAATG
AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTA
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGACAACCTGGAGAT
CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATGATCCTGGATG
CGGATCCCTCGTCCGTGGTGAAACGAGTCGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTAAATGGTCT
ATTTTGG
>C10
ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
TGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGACTGGTGCTGGAGAACCTGGAGAT
CATCATGCTCGCCTTCGACGAGATCTGTGACGGAGGAATGATCCTGGATG
CGGATCCCTCATCCGTCGTGAAACGAGTCGATCTGCGCAACGATGACATT
CCCATCGCCGAACAGACCGTTGCCCAGGTAACTAACACTCTAAATGGTCT
ATTTTGG
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGIFW
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTSTLNGLFW
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTNTLNGLFW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 507 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481374551
Setting output file names to "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 544928727
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7882132110
Seed = 511977608
Swapseed = 1481374551
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 55 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1942.811115 -- -24.412588
Chain 2 -- -1934.853645 -- -24.412588
Chain 3 -- -1925.246565 -- -24.412588
Chain 4 -- -1950.339270 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1912.155606 -- -24.412588
Chain 2 -- -1924.732357 -- -24.412588
Chain 3 -- -1906.886042 -- -24.412588
Chain 4 -- -1912.523523 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1942.811] (-1934.854) (-1925.247) (-1950.339) * [-1912.156] (-1924.732) (-1906.886) (-1912.524)
500 -- [-1334.451] (-1332.146) (-1336.118) (-1335.235) * (-1325.673) [-1330.414] (-1332.477) (-1351.129) -- 0:00:00
1000 -- [-1316.688] (-1327.817) (-1318.233) (-1341.483) * [-1311.979] (-1327.787) (-1343.483) (-1326.486) -- 0:00:00
1500 -- [-1294.305] (-1321.451) (-1301.886) (-1328.942) * [-1292.827] (-1309.672) (-1309.037) (-1300.902) -- 0:00:00
2000 -- (-1295.916) (-1323.609) [-1285.617] (-1322.684) * [-1282.355] (-1305.583) (-1295.872) (-1293.353) -- 0:00:00
2500 -- (-1285.178) (-1317.404) [-1286.870] (-1309.679) * [-1275.938] (-1299.891) (-1294.535) (-1295.723) -- 0:00:00
3000 -- [-1274.360] (-1302.769) (-1272.557) (-1298.331) * [-1273.155] (-1283.835) (-1272.208) (-1286.100) -- 0:00:00
3500 -- (-1266.667) (-1300.706) [-1272.946] (-1281.959) * (-1281.235) (-1286.280) [-1270.859] (-1284.423) -- 0:00:00
4000 -- [-1279.876] (-1309.337) (-1277.922) (-1281.844) * (-1287.729) [-1278.813] (-1276.808) (-1282.671) -- 0:04:09
4500 -- [-1275.708] (-1279.956) (-1272.187) (-1281.462) * (-1276.922) (-1280.105) (-1281.641) [-1286.923] -- 0:03:41
5000 -- (-1278.579) (-1282.524) [-1268.227] (-1297.523) * (-1285.930) [-1274.216] (-1279.150) (-1275.553) -- 0:03:19
Average standard deviation of split frequencies: 0.047140
5500 -- (-1275.833) (-1279.948) [-1268.143] (-1285.655) * [-1275.544] (-1273.680) (-1280.640) (-1281.778) -- 0:03:00
6000 -- (-1282.249) [-1275.137] (-1278.414) (-1282.830) * (-1278.240) (-1283.245) [-1275.478] (-1274.229) -- 0:02:45
6500 -- (-1278.356) [-1273.075] (-1278.113) (-1279.941) * [-1269.088] (-1277.851) (-1271.012) (-1275.888) -- 0:02:32
7000 -- (-1284.355) (-1287.400) [-1281.117] (-1283.076) * [-1277.248] (-1269.192) (-1279.874) (-1272.555) -- 0:02:21
7500 -- (-1282.918) (-1287.987) [-1268.448] (-1278.554) * [-1268.939] (-1273.962) (-1269.627) (-1273.515) -- 0:02:12
8000 -- [-1272.053] (-1291.120) (-1269.969) (-1282.584) * [-1274.882] (-1273.323) (-1275.729) (-1279.960) -- 0:02:04
8500 -- [-1279.471] (-1285.706) (-1280.377) (-1270.646) * (-1280.339) (-1281.032) [-1274.939] (-1278.493) -- 0:03:53
9000 -- (-1277.857) (-1292.000) [-1275.349] (-1279.136) * (-1271.715) (-1285.752) [-1266.919] (-1297.220) -- 0:03:40
9500 -- [-1275.505] (-1282.390) (-1279.107) (-1270.915) * (-1271.577) [-1275.574] (-1277.378) (-1285.063) -- 0:03:28
10000 -- (-1279.930) (-1288.786) (-1269.193) [-1272.325] * (-1282.121) (-1277.875) (-1271.106) [-1272.512] -- 0:03:18
Average standard deviation of split frequencies: 0.049718
10500 -- (-1269.311) (-1283.289) [-1279.209] (-1276.746) * [-1271.544] (-1280.509) (-1276.854) (-1283.500) -- 0:03:08
11000 -- (-1271.318) [-1276.089] (-1291.847) (-1275.122) * (-1277.971) (-1271.211) (-1281.055) [-1281.405] -- 0:02:59
11500 -- (-1271.897) (-1293.062) (-1283.344) [-1279.483] * (-1282.183) [-1270.495] (-1271.979) (-1286.661) -- 0:02:51
12000 -- (-1272.680) [-1277.088] (-1279.603) (-1271.703) * (-1279.139) [-1275.802] (-1278.808) (-1301.434) -- 0:02:44
12500 -- (-1285.504) (-1285.705) [-1275.829] (-1281.694) * (-1288.600) (-1282.187) (-1279.852) [-1266.037] -- 0:02:38
13000 -- (-1279.040) (-1270.387) (-1271.314) [-1271.194] * [-1273.759] (-1275.285) (-1277.057) (-1278.490) -- 0:02:31
13500 -- (-1278.093) (-1282.846) [-1268.774] (-1279.710) * (-1269.659) [-1275.892] (-1285.461) (-1278.697) -- 0:03:39
14000 -- [-1279.610] (-1281.574) (-1284.852) (-1278.471) * (-1282.583) (-1274.345) (-1273.296) [-1291.061] -- 0:03:31
14500 -- (-1277.906) (-1279.913) [-1274.767] (-1274.500) * (-1277.212) (-1276.724) (-1289.432) [-1274.844] -- 0:03:23
15000 -- (-1281.853) [-1277.081] (-1275.798) (-1273.337) * (-1276.133) [-1271.913] (-1272.873) (-1278.480) -- 0:03:17
Average standard deviation of split frequencies: 0.045176
15500 -- (-1281.881) (-1268.654) [-1278.578] (-1284.314) * (-1280.862) (-1288.736) [-1275.793] (-1283.169) -- 0:03:10
16000 -- (-1278.521) (-1278.007) (-1279.036) [-1276.556] * (-1277.923) (-1279.441) (-1277.398) [-1274.056] -- 0:03:04
16500 -- (-1283.440) [-1278.347] (-1273.686) (-1272.343) * [-1274.595] (-1290.573) (-1279.365) (-1283.376) -- 0:02:58
17000 -- (-1280.638) (-1279.366) (-1280.123) [-1273.016] * (-1289.340) [-1279.068] (-1280.512) (-1274.836) -- 0:02:53
17500 -- (-1273.434) (-1279.578) [-1277.986] (-1277.699) * (-1286.651) (-1277.822) (-1275.746) [-1280.067] -- 0:02:48
18000 -- (-1280.295) (-1277.408) [-1273.964] (-1279.519) * [-1280.888] (-1273.944) (-1272.492) (-1277.299) -- 0:03:38
18500 -- (-1278.975) [-1267.518] (-1279.026) (-1281.062) * (-1284.051) [-1266.670] (-1272.298) (-1283.339) -- 0:03:32
19000 -- [-1280.537] (-1270.273) (-1281.011) (-1281.371) * (-1285.853) (-1279.590) [-1270.973] (-1283.931) -- 0:03:26
19500 -- (-1278.115) (-1275.054) (-1272.527) [-1290.973] * [-1280.120] (-1277.357) (-1278.697) (-1275.635) -- 0:03:21
20000 -- (-1277.324) [-1271.948] (-1286.165) (-1283.491) * (-1272.241) (-1278.790) (-1274.048) [-1280.355] -- 0:03:16
Average standard deviation of split frequencies: 0.029938
20500 -- [-1273.560] (-1279.999) (-1277.513) (-1288.972) * (-1279.451) (-1287.528) (-1275.925) [-1278.815] -- 0:03:11
21000 -- (-1283.572) [-1277.513] (-1266.578) (-1295.817) * (-1281.323) (-1295.148) [-1281.285] (-1278.582) -- 0:03:06
21500 -- (-1282.766) (-1282.910) [-1278.505] (-1294.438) * (-1279.660) (-1277.301) [-1282.149] (-1279.569) -- 0:03:02
22000 -- [-1275.024] (-1280.421) (-1276.136) (-1283.244) * (-1279.671) (-1280.879) [-1279.665] (-1274.018) -- 0:02:57
22500 -- (-1288.101) (-1298.387) [-1278.502] (-1275.665) * (-1278.280) [-1279.543] (-1278.624) (-1275.730) -- 0:02:53
23000 -- (-1274.855) (-1288.523) [-1281.475] (-1278.597) * (-1278.272) (-1276.334) [-1275.304] (-1287.150) -- 0:03:32
23500 -- [-1283.251] (-1286.821) (-1285.271) (-1277.075) * (-1286.037) [-1268.762] (-1273.150) (-1282.801) -- 0:03:27
24000 -- (-1286.637) (-1280.839) (-1276.834) [-1267.002] * (-1279.887) (-1280.327) (-1278.915) [-1282.626] -- 0:03:23
24500 -- [-1277.757] (-1296.400) (-1280.685) (-1277.714) * [-1278.140] (-1276.294) (-1281.184) (-1276.938) -- 0:03:19
25000 -- (-1280.342) (-1286.712) (-1273.304) [-1266.508] * (-1273.740) [-1274.613] (-1279.518) (-1279.757) -- 0:03:15
Average standard deviation of split frequencies: 0.033399
25500 -- (-1280.450) [-1276.711] (-1282.030) (-1287.996) * (-1277.757) (-1273.927) (-1277.329) [-1273.424] -- 0:03:11
26000 -- (-1281.795) [-1283.342] (-1276.251) (-1275.968) * [-1274.485] (-1277.917) (-1278.346) (-1274.354) -- 0:03:07
26500 -- (-1271.061) (-1279.199) (-1289.476) [-1267.058] * [-1275.510] (-1282.745) (-1273.576) (-1284.409) -- 0:03:03
27000 -- (-1275.932) [-1279.821] (-1273.566) (-1274.239) * (-1280.916) (-1279.500) [-1275.010] (-1278.032) -- 0:03:00
27500 -- [-1272.489] (-1278.979) (-1278.209) (-1273.148) * (-1287.001) [-1271.311] (-1279.116) (-1287.659) -- 0:02:56
28000 -- [-1269.686] (-1280.907) (-1284.515) (-1265.755) * [-1272.374] (-1273.987) (-1280.284) (-1284.592) -- 0:03:28
28500 -- (-1275.108) (-1286.127) (-1277.128) [-1275.838] * (-1275.954) (-1279.076) [-1268.358] (-1274.582) -- 0:03:24
29000 -- (-1273.252) (-1290.984) (-1283.619) [-1268.423] * (-1277.565) (-1276.364) [-1271.073] (-1275.119) -- 0:03:20
29500 -- [-1269.099] (-1284.698) (-1275.317) (-1272.987) * (-1281.007) (-1276.810) (-1284.049) [-1275.314] -- 0:03:17
30000 -- (-1272.779) [-1272.868] (-1285.703) (-1275.066) * [-1267.985] (-1290.958) (-1276.724) (-1287.786) -- 0:03:14
Average standard deviation of split frequencies: 0.036169
30500 -- (-1280.376) (-1278.498) (-1272.658) [-1272.157] * [-1273.348] (-1278.248) (-1279.353) (-1277.274) -- 0:03:10
31000 -- [-1283.679] (-1281.875) (-1276.614) (-1272.739) * [-1272.994] (-1285.253) (-1274.536) (-1271.725) -- 0:03:07
31500 -- (-1282.013) (-1275.081) (-1292.805) [-1274.542] * (-1273.800) (-1271.733) (-1268.799) [-1278.430] -- 0:03:04
32000 -- [-1283.340] (-1288.720) (-1291.003) (-1278.622) * [-1274.519] (-1273.147) (-1286.698) (-1270.724) -- 0:03:01
32500 -- (-1287.683) [-1275.457] (-1276.417) (-1275.288) * (-1277.048) (-1275.059) (-1279.687) [-1271.338] -- 0:03:28
33000 -- (-1283.460) [-1270.857] (-1279.847) (-1285.024) * (-1282.898) [-1274.304] (-1270.266) (-1267.096) -- 0:03:25
33500 -- (-1287.103) (-1283.295) (-1274.357) [-1273.264] * (-1271.780) (-1277.947) (-1274.302) [-1280.340] -- 0:03:21
34000 -- [-1281.474] (-1282.981) (-1273.636) (-1275.537) * (-1288.539) (-1278.682) [-1271.370] (-1276.260) -- 0:03:18
34500 -- (-1272.206) (-1287.555) [-1279.117] (-1284.889) * [-1274.690] (-1270.351) (-1283.385) (-1274.289) -- 0:03:15
35000 -- [-1275.914] (-1276.675) (-1277.543) (-1284.425) * (-1284.811) [-1275.876] (-1276.986) (-1275.805) -- 0:03:13
Average standard deviation of split frequencies: 0.037538
35500 -- [-1266.725] (-1284.215) (-1270.848) (-1282.011) * (-1278.973) (-1282.993) [-1275.474] (-1286.125) -- 0:03:10
36000 -- (-1270.473) (-1274.528) (-1281.844) [-1285.282] * (-1278.849) (-1271.656) [-1280.523] (-1281.484) -- 0:03:07
36500 -- (-1276.415) (-1290.230) [-1271.438] (-1272.697) * (-1281.162) (-1271.130) (-1282.647) [-1276.633] -- 0:03:04
37000 -- [-1271.889] (-1286.035) (-1273.645) (-1281.279) * (-1284.858) (-1278.314) [-1278.985] (-1274.608) -- 0:03:02
37500 -- (-1275.177) [-1273.941] (-1277.325) (-1277.412) * (-1280.634) [-1267.724] (-1273.080) (-1285.993) -- 0:03:25
38000 -- (-1276.237) (-1270.009) [-1276.794] (-1280.471) * [-1286.923] (-1275.000) (-1277.060) (-1278.306) -- 0:03:22
38500 -- (-1280.835) [-1271.079] (-1270.792) (-1287.578) * (-1276.791) (-1286.764) [-1270.365] (-1276.270) -- 0:03:19
39000 -- (-1276.579) (-1270.700) [-1274.454] (-1273.462) * (-1285.739) (-1273.084) [-1275.991] (-1282.398) -- 0:03:17
39500 -- [-1274.554] (-1280.238) (-1280.070) (-1274.374) * (-1289.007) [-1269.875] (-1282.748) (-1284.665) -- 0:03:14
40000 -- (-1274.210) (-1281.860) (-1276.953) [-1277.502] * (-1273.945) (-1282.465) (-1273.574) [-1284.005] -- 0:03:12
Average standard deviation of split frequencies: 0.039744
40500 -- (-1278.450) [-1272.128] (-1269.712) (-1281.615) * (-1277.450) (-1278.331) [-1268.395] (-1275.205) -- 0:03:09
41000 -- (-1275.230) (-1282.436) [-1282.630] (-1277.323) * (-1275.810) (-1290.183) [-1276.978] (-1277.385) -- 0:03:07
41500 -- (-1280.232) [-1282.863] (-1274.409) (-1280.974) * (-1283.468) [-1283.349] (-1272.810) (-1280.347) -- 0:03:04
42000 -- (-1289.041) (-1270.040) [-1276.397] (-1285.696) * (-1284.762) [-1278.154] (-1279.190) (-1273.741) -- 0:03:25
42500 -- [-1269.594] (-1273.203) (-1280.036) (-1289.649) * (-1281.041) (-1285.769) (-1279.458) [-1275.589] -- 0:03:22
43000 -- (-1273.578) (-1276.718) [-1271.334] (-1281.675) * [-1277.316] (-1283.336) (-1270.733) (-1278.366) -- 0:03:20
43500 -- (-1270.024) (-1272.107) (-1278.787) [-1282.721] * [-1272.448] (-1294.645) (-1282.534) (-1281.052) -- 0:03:17
44000 -- (-1284.591) (-1273.726) (-1275.071) [-1271.883] * (-1280.861) (-1284.175) [-1273.176] (-1290.787) -- 0:03:15
44500 -- (-1287.853) (-1274.980) (-1287.114) [-1272.316] * (-1271.807) (-1289.843) [-1267.224] (-1292.218) -- 0:03:13
45000 -- (-1281.886) (-1282.355) (-1282.004) [-1277.641] * [-1279.808] (-1282.555) (-1273.595) (-1289.220) -- 0:03:11
Average standard deviation of split frequencies: 0.034404
45500 -- (-1277.633) (-1285.639) (-1289.882) [-1286.292] * [-1276.245] (-1281.759) (-1277.317) (-1290.041) -- 0:03:08
46000 -- (-1282.390) (-1275.815) [-1284.370] (-1275.927) * (-1279.494) (-1275.018) (-1281.088) [-1275.002] -- 0:03:06
46500 -- [-1268.920] (-1283.934) (-1281.130) (-1285.069) * [-1276.264] (-1274.671) (-1290.315) (-1288.849) -- 0:03:04
47000 -- [-1273.994] (-1282.242) (-1277.808) (-1279.845) * (-1278.460) [-1283.502] (-1280.407) (-1279.359) -- 0:03:22
47500 -- [-1273.231] (-1280.475) (-1287.150) (-1273.990) * (-1276.317) [-1275.750] (-1278.713) (-1279.310) -- 0:03:20
48000 -- [-1268.701] (-1284.156) (-1285.484) (-1271.278) * (-1280.188) [-1276.704] (-1276.862) (-1282.417) -- 0:03:18
48500 -- [-1269.954] (-1267.999) (-1284.751) (-1279.014) * (-1273.142) (-1286.981) [-1270.308] (-1282.760) -- 0:03:16
49000 -- [-1270.345] (-1281.981) (-1290.104) (-1276.742) * (-1279.327) (-1275.602) [-1280.099] (-1276.747) -- 0:03:14
49500 -- [-1265.701] (-1274.799) (-1287.585) (-1278.203) * [-1271.755] (-1281.080) (-1277.930) (-1282.132) -- 0:03:12
50000 -- (-1269.887) [-1277.968] (-1283.908) (-1285.082) * (-1282.830) (-1272.607) (-1274.340) [-1279.856] -- 0:03:10
Average standard deviation of split frequencies: 0.036596
50500 -- (-1289.372) [-1276.191] (-1278.497) (-1271.355) * (-1283.240) (-1279.721) [-1281.910] (-1277.554) -- 0:03:08
51000 -- (-1278.829) (-1272.711) [-1269.523] (-1278.796) * (-1283.708) (-1272.728) [-1277.268] (-1275.974) -- 0:03:06
51500 -- (-1275.116) (-1281.766) (-1277.431) [-1271.582] * (-1285.304) [-1281.968] (-1275.168) (-1277.685) -- 0:03:22
52000 -- [-1272.848] (-1274.839) (-1277.136) (-1273.665) * (-1277.571) [-1275.796] (-1297.443) (-1274.490) -- 0:03:20
52500 -- (-1271.018) (-1272.943) [-1272.539] (-1274.694) * [-1284.923] (-1277.162) (-1284.458) (-1278.842) -- 0:03:18
53000 -- [-1267.101] (-1273.291) (-1269.913) (-1283.940) * (-1294.722) [-1273.055] (-1281.910) (-1279.078) -- 0:03:16
53500 -- (-1287.444) (-1279.963) [-1278.034] (-1280.741) * (-1280.749) (-1273.135) [-1271.517] (-1272.479) -- 0:03:14
54000 -- [-1277.201] (-1279.393) (-1287.993) (-1276.095) * (-1281.519) (-1280.808) [-1280.466] (-1272.980) -- 0:03:12
54500 -- (-1281.625) (-1276.776) [-1277.898] (-1275.872) * (-1277.972) [-1270.499] (-1274.295) (-1282.231) -- 0:03:10
55000 -- (-1278.375) [-1272.957] (-1280.511) (-1271.491) * (-1281.717) (-1281.387) (-1276.393) [-1278.820] -- 0:03:09
Average standard deviation of split frequencies: 0.034233
55500 -- (-1282.956) (-1275.526) (-1282.456) [-1276.244] * (-1289.182) [-1272.586] (-1274.326) (-1279.604) -- 0:03:07
56000 -- (-1286.957) (-1277.809) (-1285.957) [-1271.153] * [-1278.606] (-1277.842) (-1274.731) (-1279.138) -- 0:03:05
56500 -- [-1273.275] (-1287.765) (-1280.905) (-1278.877) * (-1291.209) (-1277.851) [-1275.881] (-1274.631) -- 0:03:20
57000 -- (-1287.629) [-1275.365] (-1277.274) (-1280.606) * (-1290.253) [-1269.967] (-1273.444) (-1273.722) -- 0:03:18
57500 -- (-1283.457) (-1281.451) [-1274.869] (-1284.019) * [-1279.041] (-1274.449) (-1282.561) (-1274.216) -- 0:03:16
58000 -- (-1273.551) (-1285.838) [-1278.308] (-1276.544) * (-1283.147) (-1275.460) [-1278.822] (-1287.695) -- 0:03:14
58500 -- [-1269.385] (-1275.079) (-1277.937) (-1277.573) * (-1274.531) [-1276.614] (-1272.984) (-1272.228) -- 0:03:13
59000 -- [-1264.745] (-1282.218) (-1273.853) (-1268.361) * (-1284.146) (-1283.786) (-1273.906) [-1267.967] -- 0:03:11
59500 -- (-1279.616) (-1280.822) (-1286.638) [-1274.043] * (-1273.852) (-1276.780) (-1282.669) [-1277.039] -- 0:03:09
60000 -- [-1268.995] (-1282.592) (-1273.510) (-1267.240) * (-1277.601) (-1267.137) (-1274.392) [-1272.880] -- 0:03:08
Average standard deviation of split frequencies: 0.029010
60500 -- (-1280.520) (-1272.989) (-1280.482) [-1271.053] * [-1268.477] (-1275.343) (-1288.983) (-1272.036) -- 0:03:06
61000 -- [-1280.719] (-1280.953) (-1277.508) (-1281.913) * (-1281.330) (-1283.330) [-1285.388] (-1284.627) -- 0:03:20
61500 -- (-1272.633) [-1274.891] (-1271.035) (-1283.954) * (-1283.109) [-1271.819] (-1274.439) (-1279.048) -- 0:03:18
62000 -- [-1286.118] (-1276.899) (-1267.147) (-1275.110) * (-1281.545) (-1276.884) (-1280.959) [-1270.298] -- 0:03:16
62500 -- (-1269.192) [-1277.077] (-1281.286) (-1280.225) * (-1281.971) (-1272.885) (-1286.752) [-1277.333] -- 0:03:15
63000 -- [-1273.425] (-1287.698) (-1280.119) (-1286.767) * (-1286.083) (-1270.566) [-1278.787] (-1275.986) -- 0:03:13
63500 -- (-1284.757) (-1278.280) [-1275.661] (-1277.862) * (-1280.042) [-1275.025] (-1280.671) (-1280.329) -- 0:03:11
64000 -- (-1272.570) [-1273.306] (-1269.855) (-1287.521) * (-1279.029) [-1268.054] (-1289.055) (-1274.102) -- 0:03:10
64500 -- (-1279.799) (-1280.092) [-1276.623] (-1280.865) * (-1284.742) (-1272.835) [-1280.293] (-1286.299) -- 0:03:08
65000 -- [-1269.641] (-1278.174) (-1269.260) (-1286.471) * [-1277.471] (-1278.204) (-1274.939) (-1284.552) -- 0:03:07
Average standard deviation of split frequencies: 0.030475
65500 -- (-1272.887) (-1271.373) (-1276.180) [-1283.548] * (-1273.246) [-1274.955] (-1289.510) (-1274.526) -- 0:03:05
66000 -- [-1276.493] (-1280.013) (-1277.880) (-1285.375) * [-1275.052] (-1274.593) (-1273.161) (-1279.859) -- 0:03:18
66500 -- [-1278.029] (-1278.146) (-1278.323) (-1278.092) * (-1277.193) [-1272.792] (-1272.927) (-1282.150) -- 0:03:16
67000 -- (-1280.572) (-1274.748) (-1283.702) [-1269.104] * [-1273.532] (-1276.123) (-1281.150) (-1279.074) -- 0:03:14
67500 -- [-1272.745] (-1280.456) (-1270.488) (-1280.726) * (-1283.361) (-1271.082) (-1277.691) [-1280.231] -- 0:03:13
68000 -- [-1276.907] (-1278.167) (-1272.376) (-1274.800) * (-1272.710) [-1275.232] (-1281.118) (-1288.773) -- 0:03:11
68500 -- [-1273.437] (-1273.413) (-1273.778) (-1275.840) * (-1280.591) (-1288.586) [-1278.078] (-1278.888) -- 0:03:10
69000 -- [-1276.098] (-1283.051) (-1285.825) (-1271.942) * (-1277.832) (-1281.923) (-1284.768) [-1270.328] -- 0:03:08
69500 -- [-1271.012] (-1296.114) (-1276.708) (-1275.706) * (-1271.564) (-1290.376) [-1279.307] (-1278.203) -- 0:03:07
70000 -- [-1272.851] (-1280.067) (-1274.538) (-1282.681) * (-1284.190) (-1284.139) [-1275.256] (-1277.384) -- 0:03:06
Average standard deviation of split frequencies: 0.027573
70500 -- (-1273.923) (-1279.857) [-1273.539] (-1277.429) * (-1278.887) (-1283.485) (-1278.371) [-1273.772] -- 0:03:04
71000 -- [-1274.351] (-1289.643) (-1287.249) (-1278.787) * (-1282.521) (-1286.630) [-1269.645] (-1274.144) -- 0:03:16
71500 -- (-1278.144) [-1280.871] (-1283.304) (-1281.759) * (-1277.394) [-1276.690] (-1280.095) (-1277.998) -- 0:03:14
72000 -- [-1275.588] (-1285.156) (-1285.134) (-1296.428) * (-1276.196) (-1282.852) [-1279.204] (-1284.915) -- 0:03:13
72500 -- (-1282.714) [-1273.211] (-1285.076) (-1288.229) * (-1278.257) [-1264.494] (-1274.474) (-1283.361) -- 0:03:11
73000 -- (-1279.674) [-1283.043] (-1290.909) (-1282.906) * (-1284.598) [-1270.698] (-1270.299) (-1286.045) -- 0:03:10
73500 -- [-1278.866] (-1268.742) (-1283.701) (-1288.436) * [-1273.635] (-1271.406) (-1268.802) (-1286.226) -- 0:03:09
74000 -- [-1276.064] (-1272.390) (-1276.805) (-1282.835) * [-1280.758] (-1275.544) (-1277.845) (-1276.856) -- 0:03:07
74500 -- (-1280.967) [-1276.674] (-1279.605) (-1279.000) * (-1272.802) [-1277.068] (-1273.087) (-1280.655) -- 0:03:06
75000 -- (-1283.760) (-1273.732) [-1276.121] (-1277.843) * (-1275.852) [-1273.453] (-1282.607) (-1290.459) -- 0:03:05
Average standard deviation of split frequencies: 0.023570
75500 -- (-1276.165) [-1275.642] (-1283.743) (-1286.914) * (-1282.275) (-1281.390) [-1278.599] (-1287.692) -- 0:03:15
76000 -- (-1276.417) (-1274.669) (-1277.759) [-1273.728] * (-1275.490) (-1275.253) [-1272.354] (-1279.151) -- 0:03:14
76500 -- (-1271.881) (-1272.690) [-1274.972] (-1279.702) * [-1274.443] (-1287.440) (-1275.187) (-1281.021) -- 0:03:13
77000 -- [-1283.683] (-1276.863) (-1278.180) (-1284.710) * [-1271.379] (-1277.418) (-1274.445) (-1283.358) -- 0:03:11
77500 -- (-1269.114) (-1285.820) (-1278.503) [-1267.574] * (-1283.591) (-1277.488) [-1273.954] (-1279.126) -- 0:03:10
78000 -- [-1269.258] (-1281.380) (-1281.545) (-1281.205) * (-1277.561) (-1271.414) [-1274.728] (-1272.168) -- 0:03:09
78500 -- (-1270.939) (-1279.486) [-1269.598] (-1272.039) * (-1277.968) [-1270.959] (-1277.179) (-1268.554) -- 0:03:07
79000 -- (-1277.226) (-1277.818) (-1275.678) [-1270.558] * (-1275.988) (-1278.910) [-1277.265] (-1278.160) -- 0:03:06
79500 -- (-1279.204) (-1273.089) (-1273.526) [-1272.929] * (-1277.277) (-1276.143) (-1277.778) [-1281.933] -- 0:03:05
80000 -- (-1285.789) (-1277.728) (-1280.924) [-1268.533] * (-1283.861) (-1276.229) (-1267.692) [-1274.635] -- 0:03:04
Average standard deviation of split frequencies: 0.022986
80500 -- (-1285.733) (-1285.054) [-1271.150] (-1270.285) * (-1282.618) (-1271.775) (-1269.541) [-1274.181] -- 0:03:14
81000 -- (-1272.323) (-1274.643) [-1273.852] (-1282.818) * (-1292.163) (-1284.766) (-1277.152) [-1275.530] -- 0:03:12
81500 -- (-1269.297) [-1271.154] (-1282.343) (-1273.346) * (-1288.820) (-1276.706) (-1267.211) [-1274.190] -- 0:03:11
82000 -- (-1270.697) [-1281.630] (-1296.370) (-1281.080) * (-1288.637) (-1279.615) [-1270.810] (-1282.966) -- 0:03:10
82500 -- (-1274.750) [-1276.817] (-1282.418) (-1281.494) * [-1282.275] (-1273.530) (-1276.622) (-1286.777) -- 0:03:09
83000 -- (-1279.779) (-1277.022) [-1279.605] (-1278.408) * (-1282.829) (-1274.634) [-1271.888] (-1290.001) -- 0:03:07
83500 -- (-1271.807) [-1267.354] (-1279.352) (-1283.689) * (-1282.694) (-1282.016) (-1279.297) [-1267.839] -- 0:03:06
84000 -- (-1281.861) (-1273.389) [-1280.438] (-1283.113) * (-1276.235) (-1283.108) [-1275.478] (-1275.670) -- 0:03:05
84500 -- (-1279.100) [-1275.289] (-1286.023) (-1277.442) * (-1284.822) [-1271.019] (-1281.811) (-1284.817) -- 0:03:04
85000 -- (-1282.326) (-1271.016) (-1285.842) [-1269.580] * (-1284.107) (-1279.627) [-1268.378] (-1284.948) -- 0:03:13
Average standard deviation of split frequencies: 0.021926
85500 -- (-1284.089) (-1274.184) [-1275.588] (-1270.275) * (-1285.031) (-1280.080) [-1277.197] (-1275.715) -- 0:03:12
86000 -- (-1286.207) (-1271.738) (-1286.628) [-1273.589] * (-1281.302) (-1278.855) [-1277.003] (-1285.563) -- 0:03:11
86500 -- (-1273.566) [-1274.257] (-1276.553) (-1285.077) * (-1282.609) (-1277.657) (-1275.837) [-1279.385] -- 0:03:10
87000 -- [-1269.649] (-1283.449) (-1279.740) (-1277.423) * (-1279.619) (-1278.756) [-1272.927] (-1286.293) -- 0:03:08
87500 -- (-1276.951) (-1282.102) [-1280.410] (-1274.977) * (-1277.984) (-1281.152) (-1283.217) [-1284.803] -- 0:03:07
88000 -- (-1276.214) (-1272.464) [-1282.267] (-1276.728) * [-1277.576] (-1280.352) (-1281.409) (-1282.378) -- 0:03:06
88500 -- (-1271.280) (-1285.598) [-1267.589] (-1278.101) * (-1276.682) (-1276.382) (-1275.247) [-1274.950] -- 0:03:05
89000 -- (-1279.444) [-1273.401] (-1269.489) (-1281.105) * (-1287.876) (-1278.819) (-1279.530) [-1286.421] -- 0:03:04
89500 -- [-1277.607] (-1272.568) (-1269.906) (-1270.745) * (-1286.053) (-1280.846) (-1272.826) [-1276.109] -- 0:03:03
90000 -- (-1280.192) (-1279.349) [-1280.152] (-1273.135) * [-1279.150] (-1269.037) (-1277.271) (-1281.517) -- 0:03:12
Average standard deviation of split frequencies: 0.021837
90500 -- (-1279.573) (-1280.246) [-1276.466] (-1267.940) * [-1279.087] (-1275.591) (-1283.295) (-1275.802) -- 0:03:10
91000 -- (-1270.912) [-1284.486] (-1275.057) (-1272.277) * (-1280.864) [-1276.050] (-1279.544) (-1275.212) -- 0:03:09
91500 -- [-1269.853] (-1275.772) (-1276.995) (-1274.752) * (-1283.549) [-1284.165] (-1274.957) (-1281.217) -- 0:03:08
92000 -- (-1285.179) (-1280.356) [-1271.769] (-1271.160) * (-1290.840) (-1279.288) (-1269.435) [-1276.453] -- 0:03:07
92500 -- (-1287.830) [-1275.146] (-1272.881) (-1276.626) * (-1287.980) (-1295.959) [-1274.438] (-1279.721) -- 0:03:06
93000 -- [-1288.145] (-1271.479) (-1278.489) (-1277.770) * (-1285.334) (-1271.027) [-1263.496] (-1279.544) -- 0:03:05
93500 -- (-1275.450) (-1279.429) [-1276.140] (-1294.071) * (-1276.487) (-1278.925) [-1268.030] (-1282.387) -- 0:03:04
94000 -- [-1277.256] (-1281.151) (-1281.182) (-1270.005) * (-1279.646) (-1276.605) (-1271.938) [-1279.078] -- 0:03:03
94500 -- [-1273.037] (-1282.259) (-1281.360) (-1274.534) * (-1281.909) [-1273.772] (-1275.489) (-1283.389) -- 0:03:11
95000 -- (-1280.112) (-1279.654) (-1290.046) [-1281.992] * (-1282.219) (-1277.081) (-1278.592) [-1274.130] -- 0:03:10
Average standard deviation of split frequencies: 0.019314
95500 -- [-1281.220] (-1276.764) (-1283.048) (-1279.163) * (-1274.043) (-1275.358) (-1279.261) [-1272.203] -- 0:03:09
96000 -- (-1287.446) (-1278.793) (-1277.709) [-1266.263] * (-1275.345) (-1277.092) (-1274.244) [-1271.949] -- 0:03:08
96500 -- (-1280.314) (-1274.895) [-1276.227] (-1275.130) * (-1274.730) (-1288.302) (-1276.030) [-1264.149] -- 0:03:07
97000 -- (-1282.416) (-1281.829) [-1272.681] (-1275.930) * (-1270.331) (-1278.485) (-1274.206) [-1271.578] -- 0:03:06
97500 -- [-1279.403] (-1275.381) (-1279.657) (-1272.014) * (-1279.632) [-1288.460] (-1273.198) (-1277.089) -- 0:03:05
98000 -- (-1287.690) (-1279.891) [-1272.764] (-1270.770) * (-1276.324) [-1274.397] (-1278.569) (-1278.375) -- 0:03:04
98500 -- (-1272.376) [-1266.900] (-1279.671) (-1285.403) * (-1281.271) [-1274.296] (-1277.526) (-1273.146) -- 0:03:03
99000 -- [-1275.608] (-1280.433) (-1281.610) (-1285.611) * [-1271.054] (-1286.671) (-1273.485) (-1277.143) -- 0:03:02
99500 -- (-1283.523) (-1280.585) (-1282.917) [-1275.428] * [-1269.038] (-1282.375) (-1271.767) (-1289.262) -- 0:03:10
100000 -- (-1284.374) (-1272.366) (-1273.019) [-1276.391] * (-1274.175) (-1283.178) (-1271.988) [-1280.915] -- 0:03:09
Average standard deviation of split frequencies: 0.019356
100500 -- [-1268.277] (-1286.870) (-1284.986) (-1277.888) * (-1281.247) [-1271.629] (-1286.530) (-1279.020) -- 0:03:07
101000 -- (-1273.902) (-1277.273) [-1272.872] (-1276.627) * (-1281.716) (-1286.440) (-1277.280) [-1278.303] -- 0:03:06
101500 -- [-1281.698] (-1287.954) (-1284.394) (-1277.000) * [-1269.288] (-1280.539) (-1273.480) (-1282.397) -- 0:03:05
102000 -- [-1273.388] (-1282.817) (-1278.540) (-1277.931) * (-1283.932) (-1279.950) (-1281.382) [-1274.071] -- 0:03:04
102500 -- (-1280.373) (-1278.030) [-1269.516] (-1284.955) * (-1284.770) (-1279.998) [-1275.575] (-1289.004) -- 0:03:03
103000 -- (-1285.490) [-1275.453] (-1273.063) (-1279.459) * [-1277.813] (-1271.498) (-1269.880) (-1278.504) -- 0:03:02
103500 -- (-1275.219) [-1275.951] (-1279.676) (-1278.730) * [-1271.958] (-1267.181) (-1279.753) (-1282.841) -- 0:03:01
104000 -- (-1286.312) [-1280.454] (-1273.550) (-1269.754) * [-1270.321] (-1278.298) (-1274.995) (-1278.214) -- 0:03:09
104500 -- [-1273.969] (-1272.994) (-1278.803) (-1278.579) * (-1270.021) (-1278.645) (-1267.560) [-1280.308] -- 0:03:08
105000 -- (-1283.480) (-1280.326) [-1281.996] (-1284.430) * (-1272.551) (-1273.734) [-1279.673] (-1279.552) -- 0:03:07
Average standard deviation of split frequencies: 0.020161
105500 -- [-1280.756] (-1283.915) (-1281.291) (-1273.029) * [-1272.946] (-1276.809) (-1287.401) (-1286.330) -- 0:03:06
106000 -- (-1286.126) (-1277.359) [-1270.235] (-1279.613) * [-1274.525] (-1277.969) (-1270.841) (-1289.426) -- 0:03:05
106500 -- (-1276.716) (-1287.623) [-1273.406] (-1269.870) * (-1278.517) (-1284.239) [-1269.510] (-1275.188) -- 0:03:04
107000 -- (-1279.913) [-1276.056] (-1283.591) (-1279.380) * (-1280.673) (-1282.005) [-1269.121] (-1275.621) -- 0:03:03
107500 -- (-1294.078) (-1278.942) (-1275.933) [-1275.987] * (-1270.820) (-1289.991) (-1275.628) [-1275.834] -- 0:03:02
108000 -- (-1276.181) [-1275.486] (-1285.453) (-1283.662) * [-1266.799] (-1290.538) (-1268.254) (-1283.856) -- 0:03:01
108500 -- (-1282.504) (-1276.652) (-1272.083) [-1271.854] * (-1271.084) [-1274.467] (-1278.832) (-1278.053) -- 0:03:00
109000 -- [-1276.759] (-1281.055) (-1280.248) (-1279.495) * (-1281.933) (-1269.695) (-1288.156) [-1269.955] -- 0:03:08
109500 -- (-1276.162) (-1285.492) (-1275.779) [-1278.766] * (-1278.915) [-1272.053] (-1271.978) (-1277.289) -- 0:03:07
110000 -- (-1276.525) (-1281.391) (-1274.399) [-1269.854] * [-1272.500] (-1280.551) (-1277.387) (-1277.342) -- 0:03:06
Average standard deviation of split frequencies: 0.023286
110500 -- (-1274.252) (-1279.066) (-1276.571) [-1273.205] * [-1271.075] (-1273.629) (-1279.303) (-1277.751) -- 0:03:05
111000 -- (-1280.616) (-1287.402) (-1272.815) [-1271.869] * [-1276.912] (-1282.565) (-1289.602) (-1276.438) -- 0:03:04
111500 -- (-1284.663) [-1280.525] (-1280.822) (-1272.838) * [-1270.563] (-1276.707) (-1275.940) (-1273.166) -- 0:03:03
112000 -- [-1264.460] (-1276.414) (-1275.266) (-1272.119) * (-1281.242) [-1276.591] (-1285.170) (-1276.350) -- 0:03:02
112500 -- [-1271.253] (-1272.404) (-1276.448) (-1288.011) * (-1271.848) (-1276.114) (-1288.853) [-1268.430] -- 0:03:01
113000 -- (-1283.488) [-1273.969] (-1271.691) (-1278.575) * [-1267.857] (-1274.809) (-1282.177) (-1278.038) -- 0:03:00
113500 -- [-1275.085] (-1280.042) (-1277.104) (-1279.014) * (-1272.905) (-1274.403) [-1285.006] (-1274.752) -- 0:02:59
114000 -- [-1271.923] (-1278.258) (-1278.595) (-1281.249) * (-1276.892) (-1275.457) (-1280.109) [-1270.948] -- 0:03:06
114500 -- [-1268.556] (-1279.794) (-1282.339) (-1273.703) * [-1276.210] (-1270.594) (-1281.245) (-1283.077) -- 0:03:05
115000 -- (-1274.583) [-1269.525] (-1275.001) (-1278.672) * (-1267.566) (-1280.316) [-1277.833] (-1284.764) -- 0:03:04
Average standard deviation of split frequencies: 0.020861
115500 -- (-1276.848) (-1279.468) [-1272.312] (-1274.130) * (-1283.856) (-1272.897) [-1275.246] (-1282.774) -- 0:03:03
116000 -- (-1276.079) (-1278.948) [-1271.534] (-1271.366) * (-1283.303) (-1285.262) (-1279.221) [-1274.182] -- 0:03:02
116500 -- (-1274.191) (-1279.424) (-1277.449) [-1272.843] * (-1278.529) (-1287.823) [-1272.942] (-1280.656) -- 0:03:02
117000 -- (-1277.618) [-1268.169] (-1276.749) (-1289.417) * (-1280.780) [-1276.378] (-1275.137) (-1271.342) -- 0:03:01
117500 -- (-1276.198) [-1275.795] (-1278.146) (-1271.396) * (-1279.969) [-1280.845] (-1275.624) (-1279.467) -- 0:03:00
118000 -- [-1288.135] (-1279.899) (-1272.250) (-1264.934) * [-1280.987] (-1275.698) (-1280.465) (-1274.493) -- 0:02:59
118500 -- (-1282.251) (-1278.071) (-1272.937) [-1272.495] * (-1268.418) (-1275.073) [-1274.628] (-1272.138) -- 0:03:05
119000 -- [-1276.855] (-1266.098) (-1279.899) (-1273.085) * (-1281.833) [-1283.197] (-1270.940) (-1273.670) -- 0:03:05
119500 -- (-1278.997) [-1269.104] (-1283.459) (-1270.550) * (-1280.531) (-1285.263) [-1278.668] (-1283.185) -- 0:03:04
120000 -- [-1267.726] (-1272.837) (-1286.360) (-1276.707) * [-1270.899] (-1276.297) (-1282.408) (-1281.908) -- 0:03:03
Average standard deviation of split frequencies: 0.021877
120500 -- [-1281.533] (-1276.666) (-1296.671) (-1270.667) * (-1282.494) [-1275.059] (-1288.582) (-1285.292) -- 0:03:02
121000 -- [-1275.566] (-1274.474) (-1284.344) (-1279.507) * (-1280.742) [-1285.597] (-1270.327) (-1278.499) -- 0:03:01
121500 -- (-1279.191) [-1272.221] (-1279.923) (-1285.592) * (-1281.194) (-1286.225) [-1285.515] (-1280.908) -- 0:03:00
122000 -- (-1275.707) (-1280.189) (-1274.397) [-1277.002] * (-1284.496) (-1293.880) (-1279.044) [-1272.196] -- 0:02:59
122500 -- (-1273.407) (-1274.336) [-1275.502] (-1285.680) * [-1281.849] (-1276.379) (-1269.516) (-1270.240) -- 0:02:59
123000 -- (-1279.370) (-1280.438) (-1269.723) [-1268.319] * (-1275.628) [-1272.597] (-1268.888) (-1277.884) -- 0:02:58
123500 -- [-1280.029] (-1282.717) (-1268.137) (-1266.997) * (-1278.828) (-1287.354) [-1272.182] (-1277.095) -- 0:03:04
124000 -- [-1275.787] (-1272.959) (-1279.678) (-1274.436) * (-1273.659) (-1288.243) [-1268.841] (-1283.672) -- 0:03:03
124500 -- (-1276.717) (-1282.636) (-1277.292) [-1272.975] * (-1268.837) (-1275.828) (-1271.536) [-1275.633] -- 0:03:02
125000 -- [-1276.350] (-1278.952) (-1280.211) (-1284.517) * (-1274.052) (-1268.972) (-1276.541) [-1277.488] -- 0:03:02
Average standard deviation of split frequencies: 0.023944
125500 -- (-1272.162) [-1272.076] (-1276.138) (-1284.957) * [-1278.252] (-1273.898) (-1275.196) (-1277.678) -- 0:03:01
126000 -- [-1274.626] (-1275.621) (-1276.081) (-1283.866) * (-1270.391) (-1282.786) (-1275.349) [-1281.151] -- 0:03:00
126500 -- (-1276.818) (-1281.590) [-1271.046] (-1285.151) * [-1278.193] (-1270.871) (-1285.688) (-1275.648) -- 0:02:59
127000 -- (-1278.950) (-1287.260) (-1273.336) [-1280.079] * (-1281.919) (-1297.658) (-1280.557) [-1273.392] -- 0:02:58
127500 -- (-1286.102) [-1279.389] (-1288.591) (-1280.464) * (-1276.609) (-1285.533) (-1282.902) [-1275.506] -- 0:02:57
128000 -- (-1279.728) (-1282.973) (-1271.440) [-1273.239] * (-1265.273) (-1290.446) [-1276.629] (-1288.024) -- 0:03:03
128500 -- (-1283.159) (-1279.810) [-1272.916] (-1275.193) * (-1277.498) [-1275.791] (-1278.985) (-1287.409) -- 0:03:03
129000 -- (-1276.850) (-1303.367) [-1281.977] (-1279.517) * (-1278.848) [-1284.472] (-1274.917) (-1273.927) -- 0:03:02
129500 -- (-1273.450) [-1271.959] (-1280.496) (-1276.041) * [-1274.793] (-1268.397) (-1272.710) (-1283.315) -- 0:03:01
130000 -- (-1275.754) (-1291.191) (-1273.101) [-1276.488] * (-1279.858) (-1277.605) (-1283.133) [-1275.274] -- 0:03:00
Average standard deviation of split frequencies: 0.022849
130500 -- [-1271.361] (-1274.168) (-1272.897) (-1275.944) * [-1271.202] (-1280.841) (-1280.042) (-1282.784) -- 0:02:59
131000 -- (-1286.236) [-1271.562] (-1280.598) (-1275.676) * (-1277.503) [-1281.267] (-1277.297) (-1280.869) -- 0:02:59
131500 -- (-1276.930) [-1269.516] (-1277.676) (-1276.566) * (-1279.331) (-1276.972) [-1268.638] (-1270.344) -- 0:02:58
132000 -- (-1271.886) [-1275.553] (-1276.408) (-1275.578) * [-1273.173] (-1280.309) (-1286.089) (-1276.729) -- 0:02:57
132500 -- (-1278.654) [-1278.541] (-1272.433) (-1279.573) * (-1277.657) (-1281.092) [-1274.404] (-1275.569) -- 0:02:56
133000 -- [-1275.720] (-1278.498) (-1280.915) (-1283.608) * [-1280.190] (-1282.732) (-1277.125) (-1269.747) -- 0:03:02
133500 -- (-1276.844) [-1279.135] (-1276.927) (-1283.730) * [-1276.513] (-1277.200) (-1272.229) (-1276.441) -- 0:03:01
134000 -- (-1281.159) (-1273.581) [-1281.196] (-1287.218) * (-1282.177) (-1278.584) (-1286.407) [-1269.923] -- 0:03:00
134500 -- (-1274.485) (-1279.449) (-1282.848) [-1270.451] * (-1279.653) (-1274.840) [-1285.476] (-1276.891) -- 0:03:00
135000 -- (-1274.669) (-1277.036) [-1274.386] (-1271.415) * [-1276.963] (-1283.079) (-1283.079) (-1282.278) -- 0:02:59
Average standard deviation of split frequencies: 0.022646
135500 -- (-1282.619) (-1275.411) [-1269.287] (-1281.520) * (-1277.345) (-1280.310) (-1279.387) [-1283.319] -- 0:02:58
136000 -- [-1274.739] (-1269.307) (-1274.087) (-1278.108) * (-1276.736) (-1273.395) [-1277.605] (-1277.665) -- 0:02:57
136500 -- (-1268.897) [-1276.187] (-1276.929) (-1272.687) * (-1279.119) (-1280.605) (-1286.413) [-1275.057] -- 0:02:57
137000 -- [-1271.039] (-1278.559) (-1277.652) (-1269.858) * (-1273.647) (-1273.450) (-1281.494) [-1278.411] -- 0:02:56
137500 -- [-1278.464] (-1282.655) (-1280.794) (-1286.313) * (-1282.719) (-1278.659) (-1289.592) [-1278.819] -- 0:03:01
138000 -- (-1273.981) (-1283.314) (-1281.002) [-1272.304] * [-1280.920] (-1282.581) (-1288.027) (-1282.001) -- 0:03:01
138500 -- (-1280.492) [-1278.108] (-1281.849) (-1270.047) * (-1272.677) (-1277.311) (-1284.509) [-1274.810] -- 0:03:00
139000 -- (-1274.773) [-1277.324] (-1275.544) (-1276.160) * (-1278.746) (-1277.509) [-1269.781] (-1282.275) -- 0:02:59
139500 -- (-1275.465) [-1269.079] (-1275.361) (-1290.569) * (-1278.628) (-1275.615) (-1270.753) [-1278.591] -- 0:02:58
140000 -- (-1288.259) [-1273.124] (-1269.109) (-1272.960) * (-1281.236) [-1274.660] (-1281.027) (-1279.945) -- 0:02:58
Average standard deviation of split frequencies: 0.021304
140500 -- (-1286.449) (-1274.752) (-1288.977) [-1262.928] * (-1279.071) (-1282.577) (-1290.098) [-1275.949] -- 0:02:57
141000 -- (-1286.220) (-1278.155) (-1279.225) [-1275.845] * (-1277.806) (-1274.923) [-1275.624] (-1285.968) -- 0:02:56
141500 -- (-1299.899) (-1285.335) [-1280.731] (-1276.121) * [-1281.857] (-1268.794) (-1272.693) (-1280.039) -- 0:02:55
142000 -- (-1277.991) (-1277.708) (-1269.933) [-1270.501] * (-1281.500) (-1277.526) [-1278.186] (-1287.958) -- 0:02:55
142500 -- (-1274.669) (-1275.364) (-1269.100) [-1277.369] * (-1277.399) (-1284.477) [-1280.960] (-1288.260) -- 0:03:00
143000 -- (-1281.005) [-1283.560] (-1269.865) (-1272.048) * (-1282.309) [-1271.130] (-1271.050) (-1292.745) -- 0:02:59
143500 -- (-1286.703) (-1288.790) (-1275.495) [-1273.907] * (-1287.536) (-1276.447) [-1271.001] (-1283.342) -- 0:02:59
144000 -- (-1285.025) [-1278.634] (-1284.561) (-1276.934) * (-1271.297) [-1272.084] (-1279.761) (-1272.433) -- 0:02:58
144500 -- (-1280.163) (-1276.060) [-1277.054] (-1281.657) * [-1275.322] (-1273.500) (-1273.278) (-1283.466) -- 0:02:57
145000 -- [-1270.528] (-1282.648) (-1275.589) (-1279.882) * (-1281.899) (-1280.362) [-1269.234] (-1287.601) -- 0:02:56
Average standard deviation of split frequencies: 0.023247
145500 -- (-1276.929) (-1286.744) [-1269.372] (-1278.550) * [-1279.858] (-1271.228) (-1267.752) (-1282.576) -- 0:02:56
146000 -- (-1289.240) (-1275.297) [-1282.158] (-1279.788) * (-1280.166) [-1270.375] (-1283.452) (-1281.549) -- 0:02:55
146500 -- [-1278.339] (-1278.008) (-1277.739) (-1281.584) * [-1279.197] (-1278.105) (-1278.161) (-1285.327) -- 0:02:54
147000 -- (-1272.662) [-1273.668] (-1278.484) (-1274.569) * (-1280.202) [-1275.037] (-1282.255) (-1276.724) -- 0:02:59
147500 -- (-1272.455) (-1275.956) [-1270.489] (-1276.172) * (-1280.433) (-1294.878) (-1275.800) [-1280.205] -- 0:02:59
148000 -- (-1276.835) [-1274.727] (-1277.870) (-1285.836) * (-1273.926) (-1277.494) [-1274.988] (-1276.879) -- 0:02:58
148500 -- (-1275.757) (-1272.644) [-1272.949] (-1283.318) * (-1277.219) (-1276.128) [-1275.747] (-1280.231) -- 0:02:57
149000 -- (-1292.548) (-1282.863) (-1269.484) [-1282.575] * (-1268.041) [-1271.750] (-1272.680) (-1280.525) -- 0:02:57
149500 -- (-1289.412) [-1273.288] (-1278.239) (-1287.748) * (-1274.864) (-1287.180) (-1287.842) [-1280.812] -- 0:02:56
150000 -- (-1283.674) (-1285.202) [-1273.435] (-1286.087) * [-1278.310] (-1280.472) (-1277.085) (-1288.224) -- 0:02:55
Average standard deviation of split frequencies: 0.021276
150500 -- (-1282.580) [-1270.488] (-1275.827) (-1283.465) * (-1274.478) [-1275.059] (-1278.952) (-1278.615) -- 0:02:54
151000 -- [-1277.150] (-1278.574) (-1287.443) (-1283.138) * (-1272.210) (-1270.200) (-1281.204) [-1277.893] -- 0:02:54
151500 -- (-1279.602) [-1271.887] (-1286.495) (-1278.198) * [-1270.156] (-1278.026) (-1279.549) (-1279.338) -- 0:02:53
152000 -- [-1276.269] (-1280.149) (-1279.110) (-1288.850) * (-1273.884) [-1272.868] (-1275.170) (-1279.531) -- 0:02:58
152500 -- (-1271.578) (-1293.210) [-1282.219] (-1289.069) * [-1268.873] (-1284.379) (-1277.713) (-1284.107) -- 0:02:57
153000 -- (-1272.558) [-1275.170] (-1277.409) (-1278.162) * (-1275.837) (-1283.067) (-1288.324) [-1273.335] -- 0:02:57
153500 -- (-1282.196) (-1276.970) [-1268.863] (-1279.533) * (-1271.685) (-1296.757) [-1279.911] (-1282.512) -- 0:02:56
154000 -- (-1281.391) (-1271.695) (-1277.774) [-1270.595] * [-1271.867] (-1276.826) (-1281.464) (-1275.488) -- 0:02:55
154500 -- (-1271.628) [-1273.822] (-1276.383) (-1271.516) * (-1277.399) [-1278.656] (-1285.069) (-1272.504) -- 0:02:55
155000 -- (-1282.582) (-1277.757) (-1273.944) [-1268.674] * [-1280.332] (-1276.871) (-1293.076) (-1275.526) -- 0:02:54
Average standard deviation of split frequencies: 0.019743
155500 -- (-1277.705) (-1275.813) (-1289.122) [-1272.711] * [-1276.158] (-1286.861) (-1286.301) (-1270.638) -- 0:02:53
156000 -- [-1273.448] (-1273.303) (-1289.754) (-1277.996) * (-1278.292) (-1280.929) (-1281.116) [-1275.376] -- 0:02:53
156500 -- (-1275.148) [-1271.682] (-1278.432) (-1289.246) * [-1268.916] (-1268.339) (-1287.016) (-1285.061) -- 0:02:57
157000 -- (-1276.752) (-1273.763) [-1269.755] (-1279.801) * [-1271.159] (-1273.940) (-1279.852) (-1285.256) -- 0:02:57
157500 -- [-1279.406] (-1279.248) (-1280.326) (-1273.046) * [-1268.531] (-1279.138) (-1288.368) (-1283.488) -- 0:02:56
158000 -- (-1274.696) [-1273.923] (-1276.062) (-1270.946) * [-1275.991] (-1287.274) (-1280.036) (-1288.878) -- 0:02:55
158500 -- [-1279.034] (-1286.590) (-1277.398) (-1289.939) * [-1280.913] (-1286.926) (-1294.039) (-1302.864) -- 0:02:55
159000 -- (-1277.576) [-1271.011] (-1281.941) (-1274.905) * (-1272.930) [-1274.719] (-1282.641) (-1275.132) -- 0:02:54
159500 -- (-1273.370) (-1287.959) (-1281.844) [-1274.836] * (-1285.215) (-1276.514) [-1287.832] (-1276.383) -- 0:02:53
160000 -- (-1292.199) [-1271.533] (-1298.761) (-1276.987) * [-1270.097] (-1284.854) (-1278.277) (-1275.760) -- 0:02:53
Average standard deviation of split frequencies: 0.019365
160500 -- (-1279.717) [-1271.447] (-1278.381) (-1270.924) * [-1270.152] (-1287.138) (-1287.502) (-1280.698) -- 0:02:52
161000 -- [-1277.083] (-1275.587) (-1294.518) (-1291.197) * (-1276.661) (-1284.304) (-1276.588) [-1274.710] -- 0:02:51
161500 -- (-1284.271) (-1274.409) (-1274.445) [-1270.442] * (-1277.776) [-1281.804] (-1273.885) (-1278.436) -- 0:02:56
162000 -- (-1281.554) [-1274.013] (-1278.257) (-1278.048) * (-1276.622) (-1289.979) (-1280.529) [-1276.692] -- 0:02:55
162500 -- (-1281.072) (-1275.793) (-1280.169) [-1278.092] * (-1293.029) (-1276.089) (-1281.159) [-1283.286] -- 0:02:55
163000 -- [-1269.177] (-1268.852) (-1286.024) (-1277.734) * (-1284.708) (-1286.856) (-1283.014) [-1277.652] -- 0:02:54
163500 -- [-1272.958] (-1275.414) (-1276.012) (-1284.866) * (-1278.845) (-1278.629) (-1279.734) [-1274.123] -- 0:02:53
164000 -- (-1272.340) [-1276.272] (-1279.685) (-1288.526) * [-1281.823] (-1277.404) (-1280.864) (-1275.054) -- 0:02:53
164500 -- [-1262.927] (-1286.145) (-1273.852) (-1285.561) * [-1278.871] (-1289.817) (-1286.724) (-1270.063) -- 0:02:52
165000 -- (-1273.160) (-1274.502) (-1272.130) [-1272.321] * (-1277.129) (-1284.795) [-1285.412] (-1271.734) -- 0:02:52
Average standard deviation of split frequencies: 0.019311
165500 -- (-1273.304) (-1267.867) [-1282.489] (-1275.647) * (-1273.292) [-1278.416] (-1279.523) (-1268.283) -- 0:02:51
166000 -- (-1275.701) (-1264.466) [-1270.004] (-1273.270) * (-1275.291) [-1275.359] (-1273.242) (-1276.411) -- 0:02:50
166500 -- [-1279.353] (-1275.587) (-1276.927) (-1278.186) * (-1278.359) [-1278.403] (-1284.900) (-1273.254) -- 0:02:55
167000 -- [-1277.368] (-1268.810) (-1279.607) (-1274.512) * (-1284.824) [-1276.975] (-1278.636) (-1277.190) -- 0:02:54
167500 -- [-1279.495] (-1272.924) (-1278.174) (-1270.718) * (-1284.502) (-1276.918) [-1268.958] (-1280.926) -- 0:02:53
168000 -- (-1286.043) (-1285.730) [-1273.293] (-1267.383) * (-1278.551) (-1288.139) [-1277.335] (-1283.563) -- 0:02:53
168500 -- (-1279.113) (-1276.596) (-1272.103) [-1268.708] * [-1272.277] (-1284.746) (-1284.787) (-1281.389) -- 0:02:52
169000 -- [-1270.725] (-1280.336) (-1272.714) (-1280.863) * (-1283.765) (-1282.100) [-1283.440] (-1280.997) -- 0:02:52
169500 -- (-1276.997) (-1287.149) [-1273.396] (-1274.573) * (-1278.870) (-1282.284) [-1279.226] (-1270.780) -- 0:02:51
170000 -- (-1285.895) (-1282.233) (-1277.605) [-1270.941] * (-1280.540) [-1280.679] (-1276.191) (-1278.227) -- 0:02:50
Average standard deviation of split frequencies: 0.018967
170500 -- [-1282.031] (-1277.687) (-1270.518) (-1282.180) * [-1283.824] (-1281.613) (-1286.827) (-1267.492) -- 0:02:50
171000 -- [-1274.326] (-1289.041) (-1271.464) (-1283.617) * (-1281.053) (-1279.138) [-1277.538] (-1270.216) -- 0:02:54
171500 -- (-1276.397) (-1286.211) (-1281.179) [-1272.698] * [-1276.020] (-1278.745) (-1273.529) (-1287.064) -- 0:02:53
172000 -- (-1268.073) (-1280.960) (-1282.346) [-1271.875] * (-1269.543) (-1276.466) [-1276.538] (-1272.056) -- 0:02:53
172500 -- (-1280.199) (-1274.555) [-1286.459] (-1269.774) * [-1285.607] (-1271.669) (-1283.545) (-1274.096) -- 0:02:52
173000 -- (-1275.507) [-1275.441] (-1279.534) (-1278.850) * (-1279.825) [-1270.383] (-1275.431) (-1275.731) -- 0:02:52
173500 -- [-1268.132] (-1279.801) (-1284.363) (-1287.654) * (-1269.633) [-1270.758] (-1287.854) (-1271.843) -- 0:02:51
174000 -- (-1268.981) (-1284.310) (-1273.874) [-1275.739] * (-1285.099) [-1269.985] (-1272.568) (-1281.034) -- 0:02:50
174500 -- (-1272.879) [-1271.392] (-1274.487) (-1271.257) * (-1278.898) (-1274.530) [-1266.466] (-1268.353) -- 0:02:50
175000 -- (-1284.807) (-1268.593) [-1273.232] (-1272.447) * (-1277.136) (-1283.723) (-1278.581) [-1269.516] -- 0:02:49
Average standard deviation of split frequencies: 0.020713
175500 -- (-1284.142) (-1272.706) (-1279.487) [-1272.941] * (-1288.750) [-1281.277] (-1283.125) (-1275.474) -- 0:02:49
176000 -- (-1278.151) [-1273.088] (-1281.287) (-1270.233) * (-1281.588) (-1283.469) (-1271.780) [-1270.101] -- 0:02:53
176500 -- (-1277.833) [-1272.406] (-1280.938) (-1267.789) * (-1278.407) (-1280.204) [-1265.978] (-1273.932) -- 0:02:52
177000 -- (-1275.411) (-1277.867) (-1279.795) [-1274.448] * [-1272.276] (-1274.797) (-1275.421) (-1279.572) -- 0:02:52
177500 -- (-1279.059) [-1272.535] (-1278.203) (-1286.823) * (-1275.113) (-1278.696) (-1274.961) [-1277.665] -- 0:02:51
178000 -- (-1278.008) (-1282.711) (-1273.848) [-1271.794] * [-1278.619] (-1274.713) (-1270.292) (-1277.698) -- 0:02:50
178500 -- (-1279.995) (-1279.502) (-1285.904) [-1272.419] * (-1271.131) (-1277.014) [-1269.999] (-1280.468) -- 0:02:50
179000 -- (-1280.534) (-1280.831) [-1279.412] (-1295.167) * (-1278.904) (-1277.306) [-1276.781] (-1286.638) -- 0:02:49
179500 -- (-1276.332) [-1271.451] (-1275.424) (-1297.065) * (-1287.444) [-1272.258] (-1277.846) (-1274.375) -- 0:02:49
180000 -- (-1277.241) [-1266.818] (-1282.611) (-1274.578) * [-1274.886] (-1285.516) (-1273.122) (-1274.889) -- 0:02:48
Average standard deviation of split frequencies: 0.020004
180500 -- (-1279.281) (-1285.427) (-1277.186) [-1278.352] * (-1275.461) (-1288.230) (-1277.297) [-1273.062] -- 0:02:52
181000 -- (-1280.452) [-1278.209] (-1271.366) (-1276.102) * (-1276.735) [-1272.937] (-1290.743) (-1275.874) -- 0:02:51
181500 -- (-1269.845) [-1276.585] (-1284.511) (-1281.736) * (-1286.297) (-1276.318) (-1283.585) [-1283.444] -- 0:02:51
182000 -- (-1267.803) [-1274.827] (-1289.811) (-1281.437) * [-1278.274] (-1274.107) (-1279.424) (-1278.828) -- 0:02:50
182500 -- (-1276.346) [-1284.026] (-1278.636) (-1276.411) * (-1276.257) [-1270.886] (-1274.856) (-1285.145) -- 0:02:50
183000 -- [-1276.016] (-1275.237) (-1277.905) (-1269.017) * (-1278.974) [-1269.692] (-1279.251) (-1279.250) -- 0:02:49
183500 -- (-1276.956) [-1275.282] (-1279.717) (-1274.099) * (-1278.477) (-1273.395) [-1272.437] (-1277.263) -- 0:02:49
184000 -- (-1273.976) [-1271.978] (-1280.491) (-1275.362) * [-1273.664] (-1279.154) (-1286.014) (-1282.678) -- 0:02:48
184500 -- (-1270.120) [-1277.087] (-1288.078) (-1278.410) * (-1265.592) (-1289.869) [-1271.121] (-1280.825) -- 0:02:47
185000 -- (-1281.093) (-1295.146) (-1281.527) [-1269.837] * [-1271.765] (-1283.869) (-1271.456) (-1276.093) -- 0:02:47
Average standard deviation of split frequencies: 0.018248
185500 -- (-1294.699) (-1275.241) [-1271.044] (-1281.911) * (-1278.280) [-1274.990] (-1266.753) (-1288.394) -- 0:02:51
186000 -- (-1280.299) (-1273.449) [-1270.670] (-1269.338) * (-1293.065) (-1280.384) (-1275.549) [-1275.904] -- 0:02:50
186500 -- [-1274.929] (-1280.618) (-1288.172) (-1282.620) * (-1275.942) [-1267.640] (-1275.392) (-1276.696) -- 0:02:50
187000 -- (-1275.556) (-1275.250) [-1274.383] (-1272.333) * (-1287.587) [-1271.349] (-1270.934) (-1286.643) -- 0:02:49
187500 -- (-1281.501) (-1278.275) (-1274.495) [-1281.148] * (-1269.400) (-1273.260) (-1288.194) [-1272.809] -- 0:02:49
188000 -- (-1283.251) (-1278.704) (-1277.990) [-1271.806] * [-1273.707] (-1280.422) (-1275.039) (-1273.478) -- 0:02:48
188500 -- [-1282.521] (-1276.996) (-1274.573) (-1279.307) * [-1277.921] (-1270.593) (-1274.307) (-1289.735) -- 0:02:47
189000 -- (-1281.512) (-1276.679) (-1279.521) [-1273.245] * (-1288.749) [-1276.664] (-1279.507) (-1275.370) -- 0:02:47
189500 -- (-1285.892) [-1277.132] (-1274.383) (-1270.853) * (-1281.042) (-1284.129) [-1277.325] (-1272.987) -- 0:02:46
190000 -- [-1274.517] (-1278.516) (-1278.795) (-1281.412) * [-1278.698] (-1274.384) (-1278.287) (-1286.470) -- 0:02:50
Average standard deviation of split frequencies: 0.018461
190500 -- (-1282.001) [-1276.261] (-1272.642) (-1277.977) * (-1276.586) [-1276.632] (-1278.832) (-1272.786) -- 0:02:49
191000 -- (-1283.255) (-1290.026) [-1268.481] (-1275.542) * (-1282.764) (-1281.466) [-1278.753] (-1279.964) -- 0:02:49
191500 -- (-1284.346) (-1283.202) (-1273.211) [-1275.572] * (-1276.466) (-1274.971) [-1270.698] (-1290.302) -- 0:02:48
192000 -- (-1283.909) [-1279.593] (-1274.805) (-1273.005) * (-1274.878) (-1278.914) [-1271.861] (-1281.766) -- 0:02:48
192500 -- (-1294.101) (-1279.509) (-1277.211) [-1267.614] * (-1279.853) [-1278.566] (-1283.625) (-1289.177) -- 0:02:47
193000 -- (-1290.233) (-1282.568) [-1271.016] (-1277.765) * [-1272.388] (-1280.989) (-1278.496) (-1285.966) -- 0:02:47
193500 -- [-1275.460] (-1277.427) (-1277.182) (-1273.483) * (-1269.373) (-1276.155) [-1274.731] (-1285.662) -- 0:02:46
194000 -- (-1280.457) [-1276.933] (-1275.156) (-1272.608) * [-1273.804] (-1279.727) (-1284.012) (-1279.319) -- 0:02:46
194500 -- (-1275.373) [-1274.768] (-1286.502) (-1265.680) * [-1268.529] (-1278.606) (-1279.984) (-1283.609) -- 0:02:45
195000 -- [-1273.599] (-1279.024) (-1280.566) (-1271.173) * (-1275.520) (-1278.438) [-1272.519] (-1289.604) -- 0:02:49
Average standard deviation of split frequencies: 0.018760
195500 -- (-1274.734) (-1279.914) [-1277.205] (-1278.255) * (-1274.841) (-1272.619) (-1279.170) [-1278.498] -- 0:02:48
196000 -- (-1280.495) (-1281.085) (-1275.785) [-1275.839] * (-1282.201) [-1276.539] (-1272.090) (-1289.389) -- 0:02:48
196500 -- (-1278.058) [-1269.302] (-1281.128) (-1275.595) * (-1279.853) (-1273.173) (-1274.397) [-1278.918] -- 0:02:47
197000 -- (-1284.313) (-1280.629) (-1271.024) [-1271.612] * (-1283.902) (-1277.210) (-1277.472) [-1278.794] -- 0:02:47
197500 -- [-1271.384] (-1283.390) (-1283.898) (-1284.793) * (-1280.923) (-1282.467) (-1288.045) [-1275.128] -- 0:02:46
198000 -- (-1276.500) (-1283.392) [-1281.552] (-1274.567) * (-1277.400) [-1274.982] (-1280.159) (-1270.064) -- 0:02:46
198500 -- (-1279.179) (-1288.776) [-1275.937] (-1287.417) * [-1276.668] (-1277.584) (-1287.217) (-1270.415) -- 0:02:45
199000 -- (-1277.980) (-1272.987) (-1287.236) [-1274.021] * (-1275.701) [-1275.888] (-1285.491) (-1277.715) -- 0:02:45
199500 -- (-1276.093) (-1275.667) (-1283.515) [-1272.307] * (-1268.295) (-1274.922) (-1280.391) [-1272.688] -- 0:02:44
200000 -- [-1274.311] (-1282.426) (-1283.119) (-1274.457) * [-1280.256] (-1275.543) (-1282.396) (-1276.117) -- 0:02:48
Average standard deviation of split frequencies: 0.018950
200500 -- (-1275.206) [-1278.401] (-1285.463) (-1279.691) * (-1285.590) (-1275.032) [-1278.288] (-1276.783) -- 0:02:47
201000 -- [-1282.699] (-1287.249) (-1272.712) (-1268.450) * [-1277.412] (-1281.946) (-1289.889) (-1282.383) -- 0:02:46
201500 -- (-1278.636) (-1284.243) (-1274.332) [-1284.078] * (-1279.196) (-1273.624) [-1275.753] (-1276.797) -- 0:02:46
202000 -- [-1273.082] (-1277.677) (-1265.522) (-1281.429) * (-1279.105) [-1271.679] (-1272.790) (-1271.162) -- 0:02:45
202500 -- (-1277.494) (-1278.135) (-1282.885) [-1271.411] * (-1272.533) [-1267.056] (-1277.311) (-1274.687) -- 0:02:45
203000 -- (-1278.327) (-1278.484) (-1287.029) [-1272.164] * (-1274.037) [-1268.345] (-1280.705) (-1287.433) -- 0:02:44
203500 -- (-1278.211) [-1272.431] (-1274.000) (-1278.677) * [-1275.801] (-1273.948) (-1283.451) (-1278.958) -- 0:02:44
204000 -- (-1273.468) [-1274.692] (-1271.950) (-1273.088) * [-1274.571] (-1273.568) (-1276.322) (-1279.232) -- 0:02:43
204500 -- [-1269.931] (-1277.645) (-1281.897) (-1277.180) * [-1273.566] (-1284.772) (-1277.224) (-1294.804) -- 0:02:47
205000 -- (-1282.247) [-1282.001] (-1271.698) (-1274.675) * (-1279.569) [-1270.550] (-1273.779) (-1276.625) -- 0:02:46
Average standard deviation of split frequencies: 0.017392
205500 -- [-1280.799] (-1287.792) (-1275.525) (-1273.740) * (-1278.137) [-1272.003] (-1285.840) (-1278.709) -- 0:02:46
206000 -- (-1279.434) (-1281.859) [-1273.727] (-1272.787) * (-1276.830) (-1270.615) (-1279.323) [-1270.646] -- 0:02:45
206500 -- (-1280.462) (-1282.034) (-1272.233) [-1274.524] * (-1285.886) [-1274.385] (-1270.586) (-1273.285) -- 0:02:45
207000 -- (-1279.758) (-1289.106) [-1276.828] (-1274.835) * (-1272.591) (-1272.490) (-1274.879) [-1285.524] -- 0:02:44
207500 -- (-1272.090) (-1271.361) (-1288.551) [-1276.999] * (-1273.973) [-1279.272] (-1286.698) (-1274.542) -- 0:02:44
208000 -- (-1277.636) (-1269.186) (-1290.699) [-1276.496] * (-1271.893) [-1272.575] (-1279.352) (-1279.015) -- 0:02:43
208500 -- (-1282.891) [-1274.285] (-1279.262) (-1279.412) * (-1273.882) (-1271.476) [-1274.811] (-1282.033) -- 0:02:43
209000 -- (-1281.452) [-1274.270] (-1283.586) (-1275.703) * (-1275.422) [-1272.486] (-1273.736) (-1288.359) -- 0:02:42
209500 -- (-1278.239) [-1276.815] (-1287.383) (-1273.463) * (-1281.147) [-1277.783] (-1273.886) (-1281.988) -- 0:02:46
210000 -- (-1270.127) (-1286.544) (-1287.289) [-1278.652] * (-1275.454) (-1281.395) (-1274.364) [-1280.510] -- 0:02:45
Average standard deviation of split frequencies: 0.017305
210500 -- (-1285.596) (-1267.221) [-1284.681] (-1288.181) * (-1273.927) (-1280.665) (-1283.053) [-1277.874] -- 0:02:45
211000 -- (-1291.883) [-1279.496] (-1281.803) (-1274.639) * (-1278.237) [-1275.526] (-1286.681) (-1271.235) -- 0:02:44
211500 -- (-1278.098) (-1281.284) (-1281.906) [-1274.078] * (-1275.841) (-1279.683) [-1273.711] (-1274.282) -- 0:02:44
212000 -- (-1283.288) [-1273.939] (-1284.471) (-1274.036) * (-1281.550) (-1277.942) [-1278.747] (-1272.637) -- 0:02:43
212500 -- (-1267.944) (-1275.685) [-1273.129] (-1271.038) * [-1284.986] (-1270.694) (-1278.324) (-1280.661) -- 0:02:43
213000 -- [-1270.050] (-1273.326) (-1277.001) (-1287.065) * [-1273.569] (-1275.134) (-1286.446) (-1282.113) -- 0:02:42
213500 -- (-1279.446) [-1274.244] (-1273.674) (-1281.457) * (-1276.342) (-1275.333) [-1277.988] (-1271.723) -- 0:02:42
214000 -- (-1276.846) (-1276.590) [-1275.227] (-1290.893) * [-1275.230] (-1276.673) (-1282.855) (-1275.313) -- 0:02:41
214500 -- (-1279.052) (-1274.220) (-1277.677) [-1270.167] * (-1277.901) (-1275.480) [-1277.102] (-1279.614) -- 0:02:44
215000 -- (-1274.400) [-1278.505] (-1271.925) (-1273.162) * (-1271.942) (-1272.072) [-1284.199] (-1274.252) -- 0:02:44
Average standard deviation of split frequencies: 0.016441
215500 -- (-1279.912) (-1282.763) (-1269.140) [-1271.646] * (-1280.525) (-1283.719) (-1285.036) [-1278.720] -- 0:02:43
216000 -- (-1276.675) [-1276.453] (-1275.808) (-1277.374) * (-1274.142) [-1272.577] (-1276.652) (-1290.564) -- 0:02:43
216500 -- (-1276.810) [-1275.281] (-1282.448) (-1271.342) * (-1281.948) (-1279.737) (-1278.976) [-1276.807] -- 0:02:42
217000 -- [-1268.355] (-1276.553) (-1285.407) (-1279.427) * [-1277.641] (-1283.107) (-1280.669) (-1274.417) -- 0:02:42
217500 -- (-1276.987) (-1277.319) [-1273.421] (-1276.741) * [-1279.163] (-1287.580) (-1272.667) (-1278.929) -- 0:02:41
218000 -- (-1273.154) [-1271.521] (-1283.420) (-1274.769) * (-1271.633) (-1282.823) [-1270.839] (-1280.710) -- 0:02:41
218500 -- (-1284.047) [-1273.923] (-1277.788) (-1272.853) * (-1274.542) (-1285.351) [-1278.091] (-1270.156) -- 0:02:40
219000 -- (-1272.900) (-1288.728) (-1276.762) [-1272.916] * (-1288.075) (-1302.693) (-1275.542) [-1276.111] -- 0:02:44
219500 -- (-1274.595) (-1275.623) [-1282.156] (-1269.543) * [-1275.165] (-1280.046) (-1289.078) (-1276.521) -- 0:02:43
220000 -- [-1273.553] (-1288.724) (-1274.140) (-1287.032) * [-1273.725] (-1276.854) (-1278.492) (-1272.124) -- 0:02:43
Average standard deviation of split frequencies: 0.014242
220500 -- (-1273.606) (-1280.791) [-1273.574] (-1283.177) * [-1271.442] (-1280.653) (-1273.613) (-1277.126) -- 0:02:42
221000 -- (-1283.273) [-1278.616] (-1276.594) (-1274.484) * (-1288.688) (-1283.047) (-1278.981) [-1274.412] -- 0:02:42
221500 -- (-1280.880) (-1283.360) (-1280.052) [-1278.264] * (-1276.103) (-1271.918) (-1280.603) [-1274.223] -- 0:02:41
222000 -- [-1278.027] (-1277.224) (-1272.685) (-1285.617) * [-1273.716] (-1273.573) (-1273.213) (-1277.572) -- 0:02:41
222500 -- (-1275.128) (-1280.553) (-1271.801) [-1274.392] * (-1285.753) [-1271.348] (-1275.293) (-1275.533) -- 0:02:40
223000 -- [-1276.856] (-1276.277) (-1279.386) (-1272.148) * (-1280.053) [-1270.443] (-1279.119) (-1279.318) -- 0:02:40
223500 -- (-1284.113) (-1283.861) (-1266.544) [-1271.550] * (-1285.328) (-1280.626) (-1276.836) [-1273.342] -- 0:02:39
224000 -- [-1273.462] (-1279.701) (-1267.883) (-1283.758) * (-1272.476) (-1280.615) [-1274.680] (-1275.158) -- 0:02:42
224500 -- (-1289.763) [-1272.716] (-1275.176) (-1288.804) * (-1273.493) (-1282.924) (-1275.479) [-1272.883] -- 0:02:42
225000 -- (-1273.244) [-1276.019] (-1284.198) (-1279.560) * (-1279.626) (-1271.214) (-1281.812) [-1271.078] -- 0:02:41
Average standard deviation of split frequencies: 0.013767
225500 -- [-1274.519] (-1285.181) (-1270.290) (-1272.326) * (-1270.286) (-1290.515) (-1273.481) [-1269.751] -- 0:02:41
226000 -- (-1270.550) (-1274.344) [-1271.116] (-1275.854) * (-1270.481) (-1284.195) (-1280.726) [-1268.586] -- 0:02:40
226500 -- (-1274.823) (-1270.377) [-1277.341] (-1279.141) * (-1289.920) [-1280.793] (-1276.035) (-1288.169) -- 0:02:40
227000 -- (-1275.711) (-1275.427) [-1270.667] (-1274.252) * (-1279.426) [-1280.703] (-1276.432) (-1276.885) -- 0:02:40
227500 -- (-1270.702) [-1271.843] (-1275.846) (-1274.267) * [-1273.058] (-1269.439) (-1267.165) (-1287.638) -- 0:02:39
228000 -- (-1267.402) (-1276.271) [-1277.787] (-1277.985) * (-1277.060) (-1274.940) [-1273.073] (-1279.544) -- 0:02:39
228500 -- (-1270.463) [-1270.706] (-1277.578) (-1286.141) * (-1275.358) (-1285.250) (-1274.619) [-1276.146] -- 0:02:38
229000 -- [-1271.080] (-1273.151) (-1273.388) (-1285.512) * (-1274.460) (-1277.987) [-1269.617] (-1278.261) -- 0:02:41
229500 -- (-1278.716) (-1277.858) [-1275.467] (-1293.728) * (-1274.578) (-1281.920) (-1264.528) [-1279.775] -- 0:02:41
230000 -- (-1281.306) [-1277.059] (-1276.107) (-1275.667) * [-1276.231] (-1284.367) (-1274.329) (-1273.552) -- 0:02:40
Average standard deviation of split frequencies: 0.014033
230500 -- (-1275.085) (-1271.781) [-1272.528] (-1298.457) * (-1283.022) (-1285.019) (-1275.153) [-1272.254] -- 0:02:40
231000 -- (-1281.533) (-1280.631) [-1282.259] (-1291.723) * (-1290.867) (-1292.017) [-1275.294] (-1279.773) -- 0:02:39
231500 -- (-1275.656) [-1268.787] (-1283.465) (-1286.694) * (-1271.909) (-1282.007) [-1275.689] (-1285.744) -- 0:02:39
232000 -- (-1271.262) (-1270.476) (-1279.006) [-1267.295] * (-1273.974) (-1272.335) (-1287.666) [-1278.715] -- 0:02:38
232500 -- (-1269.905) [-1272.894] (-1279.053) (-1274.740) * [-1274.152] (-1283.425) (-1273.440) (-1269.352) -- 0:02:38
233000 -- (-1268.045) (-1280.660) [-1274.001] (-1274.759) * (-1282.754) (-1276.629) [-1273.857] (-1272.007) -- 0:02:38
233500 -- (-1280.980) (-1276.574) (-1269.511) [-1277.868] * (-1284.346) (-1272.339) (-1273.865) [-1271.636] -- 0:02:40
234000 -- (-1277.094) (-1272.811) (-1269.511) [-1273.776] * (-1276.074) (-1282.814) (-1271.447) [-1271.278] -- 0:02:40
234500 -- (-1277.175) (-1274.741) [-1272.962] (-1272.367) * (-1280.709) (-1269.701) [-1271.622] (-1271.241) -- 0:02:39
235000 -- (-1287.081) [-1275.256] (-1277.773) (-1284.776) * (-1278.900) [-1271.202] (-1271.899) (-1283.696) -- 0:02:39
Average standard deviation of split frequencies: 0.013450
235500 -- (-1281.922) [-1269.157] (-1277.351) (-1271.773) * (-1275.405) (-1281.199) [-1272.551] (-1281.207) -- 0:02:39
236000 -- (-1282.481) [-1271.535] (-1284.095) (-1273.392) * (-1283.431) (-1274.401) [-1271.669] (-1283.869) -- 0:02:38
236500 -- (-1274.057) [-1272.466] (-1285.809) (-1276.193) * (-1276.644) (-1273.340) [-1269.814] (-1295.870) -- 0:02:38
237000 -- [-1272.200] (-1273.389) (-1273.460) (-1278.554) * (-1285.534) [-1273.107] (-1280.038) (-1279.243) -- 0:02:37
237500 -- (-1266.429) [-1268.706] (-1273.041) (-1282.128) * (-1279.964) (-1278.902) [-1282.052] (-1288.275) -- 0:02:37
238000 -- [-1266.488] (-1282.457) (-1280.957) (-1280.195) * [-1275.600] (-1286.955) (-1276.925) (-1281.175) -- 0:02:36
238500 -- (-1281.606) [-1279.989] (-1277.982) (-1280.311) * (-1281.166) (-1273.845) [-1275.791] (-1279.559) -- 0:02:39
239000 -- (-1269.469) (-1277.406) (-1282.289) [-1275.681] * (-1280.198) [-1277.955] (-1276.982) (-1271.671) -- 0:02:39
239500 -- [-1272.710] (-1273.871) (-1275.908) (-1272.309) * (-1280.029) (-1265.493) (-1289.204) [-1280.355] -- 0:02:38
240000 -- [-1281.958] (-1277.445) (-1273.013) (-1273.963) * (-1288.288) (-1274.144) (-1279.211) [-1276.324] -- 0:02:38
Average standard deviation of split frequencies: 0.015278
240500 -- (-1285.527) [-1278.089] (-1276.449) (-1284.580) * (-1276.095) [-1267.777] (-1272.401) (-1271.850) -- 0:02:37
241000 -- (-1276.308) [-1266.524] (-1275.313) (-1280.182) * [-1279.444] (-1277.501) (-1272.308) (-1283.342) -- 0:02:37
241500 -- (-1274.227) [-1270.613] (-1275.782) (-1281.457) * [-1273.191] (-1274.512) (-1279.343) (-1275.956) -- 0:02:37
242000 -- [-1278.888] (-1273.769) (-1281.576) (-1284.558) * (-1274.025) [-1271.891] (-1268.827) (-1280.178) -- 0:02:36
242500 -- (-1278.325) [-1275.064] (-1278.082) (-1278.654) * (-1275.692) [-1270.019] (-1287.629) (-1273.649) -- 0:02:36
243000 -- [-1280.486] (-1270.443) (-1275.691) (-1283.445) * (-1280.006) (-1270.874) (-1279.315) [-1268.426] -- 0:02:38
243500 -- [-1284.370] (-1280.630) (-1279.530) (-1276.375) * [-1278.101] (-1276.616) (-1269.115) (-1279.805) -- 0:02:38
244000 -- (-1274.516) [-1280.643] (-1275.962) (-1275.882) * [-1274.563] (-1276.488) (-1284.485) (-1287.116) -- 0:02:38
244500 -- (-1278.111) (-1276.064) [-1276.947] (-1276.519) * (-1268.837) (-1273.226) [-1267.512] (-1276.830) -- 0:02:37
245000 -- (-1278.602) (-1272.586) (-1277.269) [-1273.904] * (-1269.221) [-1275.679] (-1281.931) (-1275.848) -- 0:02:37
Average standard deviation of split frequencies: 0.016224
245500 -- (-1274.156) (-1273.455) [-1271.950] (-1290.066) * (-1275.964) (-1281.297) [-1280.867] (-1281.233) -- 0:02:36
246000 -- [-1283.101] (-1272.943) (-1281.881) (-1280.887) * (-1280.732) (-1279.921) [-1265.714] (-1275.051) -- 0:02:36
246500 -- (-1269.260) (-1278.559) (-1278.037) [-1269.939] * [-1272.929] (-1277.719) (-1282.985) (-1272.941) -- 0:02:35
247000 -- [-1275.715] (-1274.104) (-1273.340) (-1273.969) * (-1273.020) [-1273.293] (-1282.864) (-1271.247) -- 0:02:35
247500 -- (-1277.374) [-1270.390] (-1278.994) (-1279.082) * (-1273.347) (-1271.520) (-1268.831) [-1264.952] -- 0:02:35
248000 -- (-1276.013) (-1283.042) (-1274.911) [-1275.116] * (-1279.969) [-1275.208] (-1273.060) (-1271.231) -- 0:02:37
248500 -- [-1276.669] (-1268.578) (-1274.469) (-1284.057) * (-1278.517) (-1282.318) [-1268.828] (-1266.914) -- 0:02:37
249000 -- (-1281.506) (-1272.915) (-1287.998) [-1276.662] * (-1277.380) [-1275.432] (-1270.306) (-1270.720) -- 0:02:36
249500 -- [-1276.038] (-1278.888) (-1281.743) (-1284.438) * (-1282.869) [-1277.594] (-1273.421) (-1280.239) -- 0:02:36
250000 -- [-1273.210] (-1279.383) (-1277.074) (-1281.376) * (-1272.959) (-1284.157) [-1268.651] (-1270.883) -- 0:02:36
Average standard deviation of split frequencies: 0.016424
250500 -- (-1271.795) (-1277.190) (-1281.518) [-1280.505] * (-1278.926) (-1287.633) [-1286.789] (-1276.501) -- 0:02:35
251000 -- (-1274.416) (-1285.241) (-1281.840) [-1271.883] * (-1277.789) (-1286.272) [-1270.965] (-1278.913) -- 0:02:35
251500 -- (-1287.251) (-1278.414) (-1272.150) [-1270.336] * (-1281.881) (-1285.458) [-1276.485] (-1280.302) -- 0:02:34
252000 -- (-1279.263) (-1271.712) [-1279.475] (-1273.840) * (-1279.823) (-1284.549) (-1303.780) [-1278.319] -- 0:02:34
252500 -- (-1281.895) (-1271.049) [-1272.895] (-1274.060) * [-1276.216] (-1280.059) (-1286.258) (-1284.496) -- 0:02:33
253000 -- (-1277.459) (-1282.598) [-1270.166] (-1275.483) * (-1272.901) (-1279.140) (-1285.552) [-1272.555] -- 0:02:36
253500 -- (-1288.436) (-1292.635) (-1270.936) [-1279.820] * (-1274.200) (-1272.271) (-1288.636) [-1272.834] -- 0:02:36
254000 -- (-1282.423) [-1282.920] (-1281.008) (-1280.840) * [-1275.211] (-1277.951) (-1291.541) (-1276.005) -- 0:02:35
254500 -- (-1278.820) [-1279.796] (-1292.167) (-1286.023) * [-1270.131] (-1282.361) (-1281.118) (-1276.648) -- 0:02:35
255000 -- [-1273.569] (-1265.836) (-1288.047) (-1283.724) * (-1271.312) (-1272.183) (-1277.835) [-1268.909] -- 0:02:34
Average standard deviation of split frequencies: 0.015258
255500 -- (-1275.788) [-1269.096] (-1287.106) (-1278.257) * (-1280.567) (-1281.105) (-1286.585) [-1268.703] -- 0:02:34
256000 -- [-1277.752] (-1281.795) (-1280.143) (-1273.210) * (-1280.037) [-1281.378] (-1273.137) (-1282.064) -- 0:02:34
256500 -- [-1269.090] (-1274.712) (-1288.825) (-1282.621) * (-1281.780) [-1279.884] (-1279.975) (-1278.430) -- 0:02:33
257000 -- (-1270.104) [-1272.014] (-1282.228) (-1277.278) * (-1274.364) (-1281.058) (-1275.000) [-1271.150] -- 0:02:33
257500 -- [-1273.133] (-1281.238) (-1286.258) (-1276.622) * (-1286.431) (-1287.163) [-1276.811] (-1280.344) -- 0:02:35
258000 -- [-1274.004] (-1274.089) (-1293.932) (-1281.479) * (-1274.869) (-1275.651) [-1276.281] (-1284.221) -- 0:02:35
258500 -- [-1279.872] (-1273.753) (-1291.862) (-1283.742) * (-1272.754) (-1269.722) (-1286.396) [-1271.750] -- 0:02:34
259000 -- (-1273.402) [-1267.676] (-1284.503) (-1279.280) * (-1276.910) [-1287.947] (-1292.054) (-1282.829) -- 0:02:34
259500 -- [-1272.438] (-1271.509) (-1280.273) (-1278.678) * (-1276.578) [-1281.370] (-1283.245) (-1278.378) -- 0:02:34
260000 -- (-1285.420) (-1269.398) (-1276.733) [-1276.370] * [-1288.467] (-1280.307) (-1291.915) (-1281.522) -- 0:02:33
Average standard deviation of split frequencies: 0.016147
260500 -- [-1283.854] (-1283.167) (-1274.581) (-1279.092) * (-1278.463) (-1279.915) (-1283.379) [-1278.400] -- 0:02:33
261000 -- (-1279.709) [-1282.267] (-1272.881) (-1283.617) * (-1276.084) [-1271.179] (-1290.617) (-1280.480) -- 0:02:32
261500 -- (-1280.051) [-1279.101] (-1287.908) (-1279.971) * [-1275.687] (-1279.044) (-1283.408) (-1286.151) -- 0:02:32
262000 -- (-1276.532) (-1289.181) (-1273.943) [-1281.125] * [-1271.204] (-1274.021) (-1276.985) (-1280.829) -- 0:02:32
262500 -- (-1282.771) [-1278.165] (-1277.208) (-1306.505) * (-1279.930) (-1273.130) (-1288.724) [-1275.553] -- 0:02:34
263000 -- [-1276.428] (-1277.469) (-1280.436) (-1288.127) * [-1272.237] (-1282.493) (-1283.019) (-1278.576) -- 0:02:34
263500 -- (-1286.220) [-1275.677] (-1278.301) (-1279.168) * (-1279.553) [-1278.905] (-1276.175) (-1275.740) -- 0:02:33
264000 -- [-1271.460] (-1278.155) (-1272.139) (-1276.328) * (-1283.310) [-1277.956] (-1282.269) (-1278.693) -- 0:02:33
264500 -- (-1274.465) [-1274.468] (-1275.250) (-1273.088) * (-1272.978) (-1277.620) (-1285.210) [-1275.360] -- 0:02:32
265000 -- (-1284.167) (-1268.822) (-1277.129) [-1275.484] * (-1286.150) (-1282.881) [-1278.055] (-1277.601) -- 0:02:32
Average standard deviation of split frequencies: 0.017975
265500 -- (-1284.155) [-1263.863] (-1275.649) (-1273.970) * [-1278.426] (-1269.483) (-1279.445) (-1275.811) -- 0:02:32
266000 -- (-1274.049) (-1277.265) [-1276.734] (-1278.773) * (-1274.877) [-1274.286] (-1278.917) (-1285.310) -- 0:02:31
266500 -- (-1282.572) (-1278.508) [-1271.737] (-1277.406) * (-1283.438) (-1272.859) [-1279.888] (-1291.508) -- 0:02:31
267000 -- (-1279.346) (-1282.998) [-1277.185] (-1279.337) * (-1277.247) (-1272.642) [-1271.035] (-1281.079) -- 0:02:30
267500 -- (-1281.117) (-1273.619) [-1278.305] (-1273.226) * (-1268.307) (-1284.321) [-1266.002] (-1278.976) -- 0:02:33
268000 -- (-1287.559) [-1275.205] (-1290.304) (-1272.485) * (-1282.553) [-1278.495] (-1274.438) (-1274.435) -- 0:02:32
268500 -- (-1289.390) (-1293.334) (-1285.612) [-1276.048] * (-1265.350) [-1274.503] (-1299.236) (-1274.931) -- 0:02:32
269000 -- [-1283.365] (-1281.793) (-1294.067) (-1279.154) * (-1272.617) (-1285.988) [-1272.718] (-1272.861) -- 0:02:32
269500 -- (-1280.741) (-1282.237) (-1283.352) [-1280.083] * [-1277.846] (-1275.330) (-1270.787) (-1275.555) -- 0:02:31
270000 -- (-1284.350) [-1266.586] (-1275.642) (-1283.202) * (-1283.275) (-1274.222) [-1269.945] (-1289.252) -- 0:02:31
Average standard deviation of split frequencies: 0.018287
270500 -- (-1275.509) (-1281.543) (-1279.554) [-1276.286] * (-1270.884) (-1278.662) (-1283.278) [-1276.972] -- 0:02:31
271000 -- (-1278.734) (-1272.719) [-1280.523] (-1278.214) * [-1277.493] (-1279.869) (-1279.136) (-1276.173) -- 0:02:30
271500 -- (-1298.281) (-1277.786) (-1294.875) [-1274.463] * (-1274.133) [-1278.410] (-1281.184) (-1276.165) -- 0:02:30
272000 -- (-1280.751) (-1281.706) (-1292.153) [-1271.134] * (-1284.184) [-1278.736] (-1285.891) (-1282.184) -- 0:02:32
272500 -- (-1282.067) (-1277.508) (-1285.486) [-1267.313] * (-1276.698) [-1274.079] (-1280.096) (-1278.246) -- 0:02:32
273000 -- (-1278.652) (-1277.343) (-1280.368) [-1270.815] * (-1279.752) [-1266.022] (-1278.563) (-1276.698) -- 0:02:31
273500 -- (-1280.964) (-1292.695) (-1276.714) [-1272.137] * (-1270.886) (-1282.631) [-1277.829] (-1272.376) -- 0:02:31
274000 -- (-1277.494) [-1277.164] (-1282.039) (-1270.626) * [-1270.222] (-1274.314) (-1274.556) (-1284.031) -- 0:02:31
274500 -- (-1273.272) (-1276.272) (-1284.632) [-1271.615] * [-1273.564] (-1282.412) (-1277.086) (-1277.472) -- 0:02:30
275000 -- (-1279.206) (-1275.339) [-1275.070] (-1280.253) * [-1273.662] (-1275.914) (-1273.726) (-1293.199) -- 0:02:30
Average standard deviation of split frequencies: 0.017812
275500 -- [-1270.231] (-1278.750) (-1276.380) (-1280.709) * (-1276.953) [-1270.677] (-1271.569) (-1291.398) -- 0:02:29
276000 -- (-1275.461) [-1275.287] (-1274.967) (-1277.219) * (-1268.152) [-1277.422] (-1275.678) (-1284.196) -- 0:02:29
276500 -- (-1288.096) [-1275.792] (-1278.863) (-1278.935) * [-1270.574] (-1279.124) (-1283.576) (-1285.587) -- 0:02:29
277000 -- (-1281.567) [-1273.746] (-1279.651) (-1279.647) * (-1274.462) [-1271.009] (-1288.174) (-1272.554) -- 0:02:31
277500 -- (-1276.667) (-1273.508) (-1280.091) [-1277.021] * (-1282.112) [-1278.937] (-1278.464) (-1273.990) -- 0:02:31
278000 -- (-1273.547) (-1267.136) [-1270.149] (-1281.153) * (-1291.596) [-1270.223] (-1284.118) (-1274.777) -- 0:02:30
278500 -- (-1277.671) [-1273.154] (-1271.770) (-1278.433) * (-1276.775) (-1277.012) [-1279.049] (-1278.130) -- 0:02:30
279000 -- (-1277.083) (-1272.029) [-1269.431] (-1276.369) * (-1277.828) (-1279.973) [-1271.054] (-1272.710) -- 0:02:29
279500 -- (-1274.671) [-1282.234] (-1279.032) (-1281.885) * (-1275.533) (-1283.452) (-1273.645) [-1271.646] -- 0:02:29
280000 -- (-1276.468) (-1271.865) [-1268.117] (-1271.846) * [-1268.519] (-1277.501) (-1280.494) (-1275.906) -- 0:02:29
Average standard deviation of split frequencies: 0.018236
280500 -- (-1268.726) (-1283.495) (-1279.689) [-1276.109] * (-1277.546) (-1272.332) (-1272.072) [-1268.881] -- 0:02:28
281000 -- [-1271.524] (-1271.542) (-1275.147) (-1276.282) * (-1273.795) (-1283.301) (-1276.945) [-1277.543] -- 0:02:28
281500 -- (-1279.501) [-1282.032] (-1276.885) (-1280.945) * [-1274.476] (-1285.343) (-1278.759) (-1273.748) -- 0:02:30
282000 -- [-1271.262] (-1280.573) (-1289.247) (-1284.660) * (-1285.623) (-1288.404) (-1294.612) [-1271.339] -- 0:02:30
282500 -- (-1286.597) [-1283.899] (-1280.314) (-1291.872) * (-1268.648) (-1272.203) (-1285.839) [-1273.177] -- 0:02:29
283000 -- (-1268.222) (-1285.161) (-1280.656) [-1280.832] * [-1272.091] (-1277.466) (-1276.607) (-1278.639) -- 0:02:29
283500 -- (-1274.882) [-1271.251] (-1279.770) (-1292.527) * (-1272.465) (-1281.181) (-1280.321) [-1274.311] -- 0:02:29
284000 -- (-1278.998) [-1280.237] (-1279.862) (-1287.507) * (-1273.491) (-1285.876) [-1276.216] (-1273.979) -- 0:02:28
284500 -- (-1290.456) [-1270.603] (-1289.038) (-1278.458) * (-1277.656) (-1278.003) [-1277.984] (-1273.621) -- 0:02:28
285000 -- (-1271.773) [-1268.679] (-1277.983) (-1280.428) * (-1289.862) (-1280.313) [-1270.622] (-1272.866) -- 0:02:28
Average standard deviation of split frequencies: 0.018249
285500 -- (-1274.222) (-1280.118) (-1275.789) [-1271.947] * (-1280.202) (-1273.443) [-1286.034] (-1287.762) -- 0:02:27
286000 -- (-1287.299) (-1283.500) (-1280.578) [-1266.138] * (-1277.251) [-1275.682] (-1283.466) (-1275.154) -- 0:02:27
286500 -- (-1277.207) (-1277.511) (-1286.194) [-1278.635] * (-1277.848) (-1284.103) [-1280.439] (-1275.043) -- 0:02:29
287000 -- (-1281.799) [-1276.394] (-1281.413) (-1274.368) * (-1281.205) (-1272.587) [-1275.470] (-1279.282) -- 0:02:29
287500 -- (-1271.345) (-1273.269) [-1282.447] (-1274.494) * (-1290.804) (-1275.465) [-1274.970] (-1276.229) -- 0:02:28
288000 -- (-1280.485) [-1272.009] (-1281.425) (-1282.653) * (-1288.578) (-1277.553) (-1274.056) [-1266.845] -- 0:02:28
288500 -- (-1277.248) [-1274.837] (-1276.610) (-1274.628) * (-1282.424) (-1280.077) (-1273.317) [-1274.617] -- 0:02:27
289000 -- [-1276.750] (-1270.392) (-1286.540) (-1275.571) * (-1277.408) [-1271.425] (-1274.387) (-1273.542) -- 0:02:27
289500 -- [-1272.153] (-1269.830) (-1283.381) (-1272.309) * (-1281.050) (-1278.212) [-1274.076] (-1273.143) -- 0:02:27
290000 -- (-1273.680) (-1278.365) (-1277.144) [-1269.161] * [-1282.862] (-1283.210) (-1278.419) (-1276.962) -- 0:02:26
Average standard deviation of split frequencies: 0.018303
290500 -- (-1273.771) [-1274.023] (-1274.116) (-1285.154) * (-1297.595) (-1269.991) [-1274.576] (-1280.106) -- 0:02:26
291000 -- [-1275.035] (-1282.499) (-1270.397) (-1276.315) * (-1281.839) (-1269.811) [-1268.755] (-1281.811) -- 0:02:28
291500 -- [-1278.333] (-1271.617) (-1275.230) (-1280.133) * [-1271.010] (-1278.396) (-1273.926) (-1279.669) -- 0:02:28
292000 -- (-1291.486) (-1279.344) (-1278.631) [-1276.890] * (-1268.634) (-1274.881) (-1274.532) [-1268.151] -- 0:02:27
292500 -- (-1285.406) [-1279.917] (-1280.853) (-1277.587) * [-1275.473] (-1289.124) (-1270.999) (-1276.532) -- 0:02:27
293000 -- (-1275.176) (-1274.613) [-1275.067] (-1274.937) * (-1280.055) [-1281.404] (-1276.761) (-1266.235) -- 0:02:27
293500 -- (-1276.495) (-1283.980) [-1271.614] (-1271.764) * (-1275.147) (-1276.550) (-1285.786) [-1274.410] -- 0:02:26
294000 -- [-1277.483] (-1292.456) (-1282.227) (-1273.936) * (-1272.183) (-1277.492) (-1274.133) [-1269.249] -- 0:02:26
294500 -- (-1286.001) (-1276.946) (-1275.830) [-1276.259] * (-1273.194) (-1273.856) [-1272.128] (-1284.711) -- 0:02:26
295000 -- (-1271.680) [-1278.018] (-1279.922) (-1271.695) * (-1269.181) (-1279.168) [-1273.675] (-1275.854) -- 0:02:25
Average standard deviation of split frequencies: 0.017746
295500 -- (-1274.171) (-1273.862) [-1270.034] (-1269.993) * (-1275.712) (-1279.651) (-1280.224) [-1267.115] -- 0:02:25
296000 -- (-1285.308) [-1275.180] (-1273.005) (-1279.725) * (-1277.866) (-1274.020) (-1281.362) [-1272.361] -- 0:02:27
296500 -- (-1275.527) (-1280.781) [-1278.344] (-1286.154) * (-1267.792) (-1272.295) (-1289.448) [-1271.264] -- 0:02:27
297000 -- (-1270.090) (-1285.738) [-1270.011] (-1282.817) * (-1278.959) (-1270.333) (-1288.980) [-1275.030] -- 0:02:26
297500 -- (-1276.653) (-1276.654) [-1266.910] (-1277.933) * (-1273.341) (-1278.375) (-1288.735) [-1266.376] -- 0:02:26
298000 -- [-1276.878] (-1272.490) (-1268.725) (-1282.651) * (-1272.787) (-1281.692) [-1277.841] (-1275.304) -- 0:02:26
298500 -- (-1274.282) (-1274.812) [-1276.861] (-1278.289) * (-1268.910) [-1278.643] (-1293.347) (-1285.094) -- 0:02:25
299000 -- (-1277.683) (-1270.446) (-1284.908) [-1273.899] * (-1271.283) (-1277.188) (-1279.818) [-1263.776] -- 0:02:25
299500 -- (-1272.709) [-1275.559] (-1276.361) (-1271.228) * (-1284.069) (-1277.633) (-1271.326) [-1273.666] -- 0:02:25
300000 -- (-1274.182) (-1287.022) [-1270.144] (-1279.443) * (-1273.927) (-1289.513) (-1282.164) [-1272.672] -- 0:02:24
Average standard deviation of split frequencies: 0.018366
300500 -- (-1273.036) (-1274.609) [-1273.675] (-1281.644) * (-1287.934) [-1275.743] (-1294.652) (-1280.396) -- 0:02:26
301000 -- [-1274.977] (-1279.102) (-1270.516) (-1277.601) * [-1271.584] (-1282.910) (-1279.500) (-1279.376) -- 0:02:26
301500 -- (-1271.163) (-1279.871) [-1277.487] (-1277.728) * [-1276.805] (-1286.712) (-1283.892) (-1279.278) -- 0:02:25
302000 -- (-1281.910) (-1285.738) [-1275.299] (-1275.110) * (-1279.929) (-1274.513) [-1273.709] (-1277.120) -- 0:02:25
302500 -- (-1286.740) [-1274.694] (-1271.087) (-1279.157) * (-1287.744) (-1282.271) (-1273.513) [-1289.210] -- 0:02:25
303000 -- (-1282.243) [-1271.715] (-1277.808) (-1285.183) * (-1280.095) (-1275.394) [-1268.126] (-1278.063) -- 0:02:24
303500 -- (-1276.596) (-1277.759) [-1274.896] (-1286.712) * (-1275.012) [-1271.273] (-1275.384) (-1271.087) -- 0:02:24
304000 -- (-1281.251) (-1281.990) (-1278.526) [-1279.709] * (-1272.639) (-1274.134) (-1283.607) [-1271.676] -- 0:02:24
304500 -- (-1276.210) [-1277.363] (-1278.070) (-1282.604) * (-1277.983) [-1268.432] (-1277.800) (-1276.026) -- 0:02:23
305000 -- (-1271.092) (-1271.517) [-1265.920] (-1282.992) * (-1277.099) [-1276.021] (-1292.233) (-1278.206) -- 0:02:23
Average standard deviation of split frequencies: 0.018486
305500 -- (-1280.019) [-1272.266] (-1269.812) (-1274.866) * [-1273.787] (-1277.433) (-1294.824) (-1278.743) -- 0:02:25
306000 -- [-1270.474] (-1272.092) (-1275.089) (-1283.512) * [-1276.685] (-1282.963) (-1288.943) (-1277.928) -- 0:02:25
306500 -- [-1271.147] (-1273.076) (-1287.292) (-1276.649) * (-1279.558) [-1275.866] (-1282.675) (-1277.481) -- 0:02:24
307000 -- (-1271.137) (-1274.927) [-1275.821] (-1275.386) * (-1280.339) (-1275.314) (-1287.538) [-1281.087] -- 0:02:24
307500 -- (-1279.319) [-1280.363] (-1282.512) (-1279.557) * (-1277.765) [-1276.179] (-1281.867) (-1274.644) -- 0:02:24
308000 -- [-1273.917] (-1269.886) (-1274.697) (-1273.598) * (-1279.006) [-1273.618] (-1292.443) (-1280.389) -- 0:02:23
308500 -- [-1274.063] (-1283.190) (-1285.470) (-1287.066) * (-1267.187) [-1271.325] (-1286.917) (-1288.545) -- 0:02:23
309000 -- (-1284.383) [-1271.663] (-1281.583) (-1291.109) * [-1275.682] (-1276.040) (-1277.513) (-1290.369) -- 0:02:23
309500 -- (-1276.642) [-1270.261] (-1280.281) (-1290.440) * (-1286.174) (-1278.473) (-1281.578) [-1272.459] -- 0:02:22
310000 -- (-1279.661) (-1283.070) [-1278.648] (-1285.649) * (-1281.883) (-1280.789) (-1272.473) [-1269.800] -- 0:02:22
Average standard deviation of split frequencies: 0.016583
310500 -- (-1276.909) [-1278.067] (-1277.043) (-1286.505) * (-1277.382) (-1285.466) [-1273.178] (-1282.734) -- 0:02:24
311000 -- (-1277.179) [-1280.125] (-1278.864) (-1285.081) * (-1273.154) (-1287.478) [-1270.715] (-1279.034) -- 0:02:24
311500 -- (-1283.662) [-1273.073] (-1276.569) (-1283.462) * (-1273.874) (-1288.176) (-1278.495) [-1277.177] -- 0:02:23
312000 -- (-1279.943) (-1281.562) [-1272.569] (-1275.483) * [-1283.561] (-1274.243) (-1272.129) (-1284.956) -- 0:02:23
312500 -- (-1275.603) (-1271.840) [-1269.022] (-1285.757) * (-1281.018) (-1288.533) (-1278.893) [-1281.515] -- 0:02:23
313000 -- (-1288.887) [-1269.807] (-1279.356) (-1282.306) * (-1276.262) (-1280.839) (-1277.795) [-1274.909] -- 0:02:22
313500 -- (-1294.404) (-1281.925) (-1286.176) [-1276.306] * (-1284.375) [-1276.115] (-1273.166) (-1287.268) -- 0:02:22
314000 -- (-1300.090) [-1274.797] (-1278.865) (-1284.400) * (-1276.133) [-1276.666] (-1276.447) (-1284.377) -- 0:02:22
314500 -- (-1295.064) [-1275.414] (-1277.591) (-1277.168) * (-1287.153) [-1272.733] (-1294.464) (-1288.245) -- 0:02:21
315000 -- [-1281.502] (-1277.614) (-1276.812) (-1278.380) * (-1282.963) (-1273.624) (-1280.471) [-1272.052] -- 0:02:23
Average standard deviation of split frequencies: 0.016516
315500 -- (-1298.346) (-1286.959) [-1275.133] (-1275.775) * (-1292.195) (-1280.115) [-1268.425] (-1279.130) -- 0:02:23
316000 -- (-1292.006) (-1276.823) (-1272.080) [-1270.942] * (-1280.373) (-1294.407) (-1270.307) [-1274.385] -- 0:02:22
316500 -- (-1286.273) [-1280.850] (-1273.173) (-1276.418) * (-1281.552) [-1277.729] (-1278.903) (-1272.440) -- 0:02:22
317000 -- (-1271.104) (-1281.474) [-1277.842] (-1275.115) * (-1277.066) [-1266.508] (-1273.551) (-1278.483) -- 0:02:22
317500 -- (-1282.117) (-1284.077) (-1284.699) [-1270.204] * [-1273.929] (-1275.323) (-1270.433) (-1274.892) -- 0:02:21
318000 -- (-1281.209) (-1272.889) [-1277.963] (-1267.724) * (-1276.361) (-1277.215) [-1273.666] (-1293.223) -- 0:02:21
318500 -- (-1279.414) [-1277.593] (-1279.622) (-1266.279) * (-1274.094) (-1285.642) [-1273.610] (-1277.430) -- 0:02:21
319000 -- (-1284.591) [-1280.154] (-1282.682) (-1275.503) * (-1289.779) (-1282.804) (-1278.717) [-1277.804] -- 0:02:20
319500 -- [-1267.745] (-1274.747) (-1275.351) (-1270.936) * (-1283.992) [-1277.354] (-1278.290) (-1276.490) -- 0:02:20
320000 -- (-1275.439) (-1280.483) (-1274.294) [-1276.589] * (-1284.249) (-1273.983) [-1270.692] (-1285.789) -- 0:02:22
Average standard deviation of split frequencies: 0.015226
320500 -- (-1276.401) (-1272.335) [-1272.468] (-1274.861) * [-1284.401] (-1276.219) (-1282.058) (-1274.403) -- 0:02:22
321000 -- [-1274.804] (-1279.166) (-1279.515) (-1280.440) * (-1293.469) (-1275.789) [-1277.044] (-1272.909) -- 0:02:21
321500 -- [-1275.073] (-1278.986) (-1282.956) (-1281.233) * (-1280.669) [-1278.996] (-1277.280) (-1278.806) -- 0:02:21
322000 -- (-1277.863) (-1277.595) [-1279.177] (-1287.238) * (-1274.067) (-1278.586) [-1272.794] (-1279.808) -- 0:02:21
322500 -- (-1274.457) (-1275.574) [-1279.439] (-1289.567) * (-1277.907) (-1278.613) [-1274.866] (-1275.668) -- 0:02:20
323000 -- (-1276.335) (-1279.001) [-1274.014] (-1279.091) * (-1275.251) [-1274.266] (-1274.852) (-1274.211) -- 0:02:20
323500 -- (-1282.391) (-1275.656) (-1278.614) [-1272.513] * (-1276.447) [-1278.232] (-1278.254) (-1282.319) -- 0:02:20
324000 -- (-1289.669) [-1283.228] (-1284.207) (-1283.226) * (-1276.307) (-1274.628) (-1278.011) [-1276.975] -- 0:02:19
324500 -- [-1270.953] (-1270.534) (-1278.290) (-1277.838) * [-1280.695] (-1272.700) (-1277.321) (-1282.021) -- 0:02:21
325000 -- (-1274.400) (-1269.078) [-1277.621] (-1276.414) * (-1274.303) (-1281.900) [-1273.790] (-1278.799) -- 0:02:21
Average standard deviation of split frequencies: 0.014357
325500 -- (-1278.133) [-1273.050] (-1281.497) (-1278.553) * (-1275.359) (-1273.509) (-1282.029) [-1276.902] -- 0:02:20
326000 -- [-1276.569] (-1269.830) (-1278.532) (-1274.536) * (-1277.962) [-1275.001] (-1275.922) (-1280.356) -- 0:02:20
326500 -- [-1276.471] (-1282.737) (-1286.634) (-1285.886) * [-1280.194] (-1278.063) (-1272.639) (-1284.551) -- 0:02:20
327000 -- (-1277.718) (-1270.794) [-1282.290] (-1273.077) * (-1285.964) (-1286.989) (-1273.647) [-1281.281] -- 0:02:19
327500 -- [-1271.017] (-1275.588) (-1277.033) (-1275.993) * (-1281.431) (-1283.992) [-1275.301] (-1282.602) -- 0:02:19
328000 -- [-1276.058] (-1272.521) (-1276.626) (-1272.039) * [-1275.013] (-1274.246) (-1284.151) (-1274.484) -- 0:02:19
328500 -- [-1269.318] (-1270.092) (-1281.904) (-1280.765) * [-1276.624] (-1274.178) (-1279.988) (-1274.413) -- 0:02:19
329000 -- (-1274.489) [-1273.874] (-1276.663) (-1281.825) * (-1277.604) (-1273.441) [-1274.141] (-1285.844) -- 0:02:18
329500 -- (-1282.283) (-1276.654) [-1274.145] (-1281.366) * [-1275.129] (-1282.327) (-1270.512) (-1288.413) -- 0:02:20
330000 -- (-1274.534) (-1267.307) (-1281.641) [-1280.112] * [-1269.815] (-1276.412) (-1277.608) (-1281.293) -- 0:02:20
Average standard deviation of split frequencies: 0.014562
330500 -- (-1277.315) (-1269.851) [-1273.962] (-1277.550) * [-1295.501] (-1273.104) (-1276.569) (-1284.840) -- 0:02:19
331000 -- (-1288.112) [-1283.393] (-1272.025) (-1273.897) * (-1279.713) (-1281.524) [-1274.331] (-1292.286) -- 0:02:19
331500 -- (-1271.890) [-1279.220] (-1282.576) (-1276.875) * (-1287.381) (-1281.258) [-1269.977] (-1290.001) -- 0:02:19
332000 -- [-1271.596] (-1278.538) (-1280.965) (-1282.066) * [-1280.352] (-1281.020) (-1276.790) (-1280.622) -- 0:02:18
332500 -- [-1278.911] (-1281.317) (-1282.084) (-1284.103) * (-1284.591) (-1279.963) [-1276.197] (-1276.218) -- 0:02:18
333000 -- [-1275.154] (-1290.809) (-1280.981) (-1280.436) * [-1272.307] (-1274.827) (-1281.948) (-1280.588) -- 0:02:18
333500 -- (-1271.674) [-1276.137] (-1294.635) (-1291.130) * (-1275.522) [-1278.861] (-1283.517) (-1296.606) -- 0:02:17
334000 -- [-1271.054] (-1273.517) (-1283.818) (-1276.741) * (-1277.182) [-1277.022] (-1279.591) (-1290.112) -- 0:02:19
334500 -- [-1273.031] (-1278.675) (-1278.928) (-1283.820) * (-1286.396) (-1292.420) [-1276.803] (-1286.002) -- 0:02:19
335000 -- [-1274.026] (-1283.792) (-1269.014) (-1280.185) * (-1280.433) (-1287.939) [-1273.076] (-1279.866) -- 0:02:18
Average standard deviation of split frequencies: 0.015633
335500 -- [-1267.759] (-1279.056) (-1274.203) (-1281.720) * [-1269.025] (-1292.855) (-1280.195) (-1282.483) -- 0:02:18
336000 -- [-1269.461] (-1278.296) (-1274.898) (-1278.701) * (-1266.980) (-1279.075) [-1278.834] (-1278.957) -- 0:02:18
336500 -- (-1278.229) [-1276.268] (-1273.238) (-1281.960) * (-1275.532) (-1290.067) [-1280.223] (-1282.050) -- 0:02:18
337000 -- [-1268.124] (-1276.306) (-1272.996) (-1286.052) * (-1266.524) (-1274.270) [-1273.618] (-1285.713) -- 0:02:17
337500 -- (-1283.530) [-1274.773] (-1285.590) (-1287.946) * [-1279.360] (-1282.036) (-1272.406) (-1276.252) -- 0:02:17
338000 -- [-1274.454] (-1276.289) (-1285.669) (-1277.809) * (-1268.259) [-1280.996] (-1270.867) (-1294.938) -- 0:02:17
338500 -- [-1266.472] (-1290.121) (-1278.091) (-1277.483) * [-1278.830] (-1283.005) (-1274.392) (-1290.684) -- 0:02:16
339000 -- (-1285.996) (-1276.666) [-1273.151] (-1279.178) * (-1277.960) [-1272.109] (-1273.516) (-1272.192) -- 0:02:18
339500 -- (-1279.679) (-1278.108) (-1275.064) [-1278.672] * (-1283.545) (-1294.767) [-1274.037] (-1277.715) -- 0:02:18
340000 -- [-1281.039] (-1280.041) (-1277.547) (-1278.529) * (-1277.008) [-1270.874] (-1274.271) (-1274.569) -- 0:02:17
Average standard deviation of split frequencies: 0.016704
340500 -- [-1267.860] (-1280.624) (-1280.749) (-1292.307) * [-1277.343] (-1275.658) (-1286.057) (-1279.696) -- 0:02:17
341000 -- (-1268.008) [-1275.900] (-1275.295) (-1280.688) * [-1272.360] (-1274.712) (-1286.867) (-1278.550) -- 0:02:17
341500 -- [-1273.372] (-1283.989) (-1282.050) (-1275.042) * (-1275.177) (-1274.406) [-1281.108] (-1278.515) -- 0:02:16
342000 -- (-1287.516) [-1281.766] (-1283.106) (-1273.721) * (-1279.923) (-1282.370) [-1275.987] (-1283.066) -- 0:02:16
342500 -- (-1282.243) [-1270.577] (-1278.955) (-1283.192) * (-1279.250) (-1280.148) (-1274.790) [-1283.599] -- 0:02:16
343000 -- [-1274.860] (-1267.882) (-1277.751) (-1276.140) * (-1272.026) (-1283.051) (-1277.854) [-1275.907] -- 0:02:15
343500 -- (-1282.212) (-1285.322) [-1277.210] (-1273.900) * [-1272.461] (-1268.897) (-1270.121) (-1277.836) -- 0:02:17
344000 -- (-1277.388) (-1280.711) (-1271.650) [-1266.522] * [-1275.800] (-1272.655) (-1285.811) (-1289.356) -- 0:02:17
344500 -- (-1274.679) [-1286.467] (-1287.448) (-1277.418) * (-1281.459) [-1269.888] (-1279.543) (-1280.409) -- 0:02:16
345000 -- (-1278.203) [-1269.563] (-1282.215) (-1276.272) * (-1278.494) [-1268.101] (-1281.446) (-1285.627) -- 0:02:16
Average standard deviation of split frequencies: 0.015376
345500 -- [-1267.699] (-1274.083) (-1283.506) (-1282.778) * (-1273.831) [-1274.585] (-1272.965) (-1287.034) -- 0:02:16
346000 -- (-1275.845) [-1270.824] (-1282.111) (-1279.540) * (-1274.568) [-1273.482] (-1269.981) (-1287.126) -- 0:02:16
346500 -- (-1274.151) [-1276.038] (-1280.853) (-1279.334) * (-1277.710) [-1281.892] (-1269.509) (-1279.579) -- 0:02:15
347000 -- (-1272.251) (-1275.477) (-1269.555) [-1281.705] * (-1272.921) (-1283.646) [-1270.982] (-1278.922) -- 0:02:15
347500 -- (-1271.801) (-1278.488) (-1275.622) [-1279.053] * (-1274.544) [-1275.587] (-1272.554) (-1280.102) -- 0:02:15
348000 -- (-1275.881) (-1275.860) (-1273.228) [-1270.444] * [-1266.510] (-1280.568) (-1288.219) (-1275.727) -- 0:02:14
348500 -- [-1272.927] (-1276.342) (-1287.195) (-1276.421) * [-1275.205] (-1285.220) (-1284.036) (-1270.735) -- 0:02:16
349000 -- (-1269.228) (-1280.470) [-1272.529] (-1278.870) * (-1273.291) (-1278.249) [-1278.061] (-1279.121) -- 0:02:16
349500 -- (-1270.655) (-1275.709) [-1276.946] (-1274.720) * (-1273.242) [-1278.396] (-1278.137) (-1274.108) -- 0:02:15
350000 -- [-1267.654] (-1268.670) (-1273.074) (-1274.635) * (-1288.128) [-1278.927] (-1277.541) (-1277.301) -- 0:02:15
Average standard deviation of split frequencies: 0.014595
350500 -- (-1270.519) (-1279.205) [-1281.577] (-1272.799) * (-1272.774) (-1276.570) (-1284.122) [-1279.569] -- 0:02:15
351000 -- [-1281.401] (-1274.905) (-1286.752) (-1269.416) * [-1280.998] (-1276.317) (-1275.674) (-1284.961) -- 0:02:14
351500 -- (-1283.253) (-1277.499) (-1279.962) [-1262.648] * [-1269.355] (-1283.848) (-1283.148) (-1284.506) -- 0:02:14
352000 -- (-1279.845) (-1280.766) [-1276.765] (-1279.354) * (-1281.717) (-1276.466) (-1280.713) [-1275.078] -- 0:02:14
352500 -- [-1272.972] (-1297.680) (-1277.634) (-1285.730) * (-1293.099) [-1274.728] (-1287.358) (-1274.402) -- 0:02:14
353000 -- (-1280.250) [-1271.639] (-1284.327) (-1289.281) * [-1268.430] (-1290.262) (-1270.572) (-1283.122) -- 0:02:15
353500 -- (-1288.262) (-1287.619) (-1273.839) [-1269.122] * (-1279.585) [-1274.316] (-1292.391) (-1271.041) -- 0:02:15
354000 -- (-1270.947) (-1275.916) [-1280.144] (-1273.168) * (-1270.906) (-1292.338) [-1274.452] (-1271.021) -- 0:02:15
354500 -- [-1269.647] (-1276.532) (-1270.561) (-1275.415) * (-1293.594) [-1271.890] (-1272.549) (-1274.954) -- 0:02:14
355000 -- (-1276.984) (-1286.321) (-1276.837) [-1270.283] * (-1286.448) [-1278.186] (-1275.044) (-1271.783) -- 0:02:14
Average standard deviation of split frequencies: 0.014566
355500 -- (-1286.036) (-1281.379) (-1276.483) [-1270.374] * (-1285.239) [-1278.914] (-1283.575) (-1286.741) -- 0:02:14
356000 -- [-1278.291] (-1274.115) (-1284.775) (-1275.395) * (-1283.894) [-1279.182] (-1275.847) (-1267.578) -- 0:02:13
356500 -- (-1274.840) (-1281.071) [-1275.098] (-1282.067) * (-1282.215) (-1279.973) (-1269.802) [-1271.845] -- 0:02:13
357000 -- [-1271.302] (-1284.718) (-1275.231) (-1274.207) * (-1277.160) (-1271.307) (-1279.542) [-1273.913] -- 0:02:13
357500 -- [-1271.484] (-1279.911) (-1274.045) (-1277.700) * (-1293.455) (-1269.323) (-1272.608) [-1271.141] -- 0:02:12
358000 -- [-1278.697] (-1276.473) (-1275.224) (-1282.046) * (-1281.248) [-1279.278] (-1276.805) (-1274.980) -- 0:02:14
358500 -- [-1273.828] (-1274.069) (-1282.514) (-1284.533) * (-1278.163) [-1279.224] (-1272.036) (-1276.345) -- 0:02:14
359000 -- [-1279.618] (-1270.344) (-1270.639) (-1285.726) * (-1278.508) (-1278.975) [-1273.840] (-1267.773) -- 0:02:13
359500 -- (-1277.577) (-1289.837) (-1281.549) [-1290.142] * (-1281.442) (-1285.300) [-1280.776] (-1270.859) -- 0:02:13
360000 -- (-1277.939) (-1274.086) (-1276.488) [-1272.957] * (-1289.827) (-1278.926) [-1270.912] (-1284.467) -- 0:02:13
Average standard deviation of split frequencies: 0.011964
360500 -- (-1279.232) (-1272.160) (-1280.517) [-1269.780] * (-1280.124) [-1273.617] (-1269.912) (-1271.716) -- 0:02:13
361000 -- [-1280.835] (-1273.804) (-1285.450) (-1271.905) * (-1275.507) (-1280.671) [-1275.904] (-1289.794) -- 0:02:12
361500 -- (-1275.251) [-1273.669] (-1272.431) (-1277.851) * (-1282.210) (-1286.055) [-1276.893] (-1274.934) -- 0:02:12
362000 -- (-1277.026) (-1285.533) (-1285.227) [-1272.453] * [-1273.368] (-1285.474) (-1283.388) (-1270.872) -- 0:02:12
362500 -- (-1275.366) (-1269.054) (-1296.320) [-1273.989] * (-1277.177) (-1273.043) (-1275.535) [-1269.712] -- 0:02:11
363000 -- (-1281.647) (-1277.172) [-1276.212] (-1272.976) * (-1277.576) (-1277.038) [-1276.296] (-1280.043) -- 0:02:13
363500 -- (-1277.192) [-1274.981] (-1275.016) (-1274.928) * (-1277.905) [-1267.541] (-1269.589) (-1270.998) -- 0:02:13
364000 -- (-1284.488) (-1282.507) (-1277.917) [-1271.836] * [-1266.873] (-1277.481) (-1271.326) (-1274.050) -- 0:02:12
364500 -- (-1287.552) (-1282.465) (-1275.174) [-1264.998] * (-1276.958) (-1284.031) [-1270.003] (-1279.542) -- 0:02:12
365000 -- (-1283.712) [-1273.280] (-1276.109) (-1276.517) * (-1272.410) [-1272.080] (-1281.840) (-1276.414) -- 0:02:12
Average standard deviation of split frequencies: 0.012385
365500 -- (-1275.653) [-1293.281] (-1277.150) (-1272.458) * (-1291.727) (-1274.142) [-1281.777] (-1272.535) -- 0:02:11
366000 -- (-1277.875) (-1278.498) (-1269.357) [-1272.887] * (-1276.694) (-1279.276) [-1275.981] (-1284.956) -- 0:02:11
366500 -- (-1272.116) (-1277.852) [-1275.879] (-1273.176) * (-1286.085) [-1267.623] (-1281.171) (-1280.516) -- 0:02:11
367000 -- (-1281.596) [-1276.663] (-1281.415) (-1273.752) * (-1282.373) [-1273.780] (-1281.461) (-1272.131) -- 0:02:11
367500 -- (-1283.999) (-1285.360) (-1276.191) [-1270.754] * (-1276.938) [-1275.317] (-1282.879) (-1275.195) -- 0:02:12
368000 -- (-1270.168) (-1286.981) (-1284.419) [-1280.678] * (-1282.110) [-1271.418] (-1279.468) (-1283.989) -- 0:02:12
368500 -- (-1272.573) (-1280.170) [-1277.592] (-1281.903) * [-1269.699] (-1266.318) (-1274.325) (-1277.848) -- 0:02:11
369000 -- (-1275.044) [-1272.327] (-1278.759) (-1278.176) * (-1278.098) [-1269.533] (-1278.076) (-1278.189) -- 0:02:11
369500 -- [-1271.267] (-1287.840) (-1285.539) (-1274.193) * (-1285.069) (-1274.961) (-1282.622) [-1271.277] -- 0:02:11
370000 -- [-1274.356] (-1280.060) (-1280.173) (-1264.930) * (-1277.071) [-1272.139] (-1285.416) (-1279.361) -- 0:02:11
Average standard deviation of split frequencies: 0.012913
370500 -- (-1278.903) (-1274.828) (-1278.082) [-1269.435] * (-1289.543) [-1275.311] (-1287.716) (-1279.977) -- 0:02:10
371000 -- [-1280.072] (-1275.259) (-1270.729) (-1274.374) * (-1284.270) (-1271.343) (-1278.601) [-1278.756] -- 0:02:10
371500 -- [-1277.104] (-1280.868) (-1274.967) (-1274.239) * (-1274.026) (-1276.548) [-1278.943] (-1281.836) -- 0:02:10
372000 -- (-1291.378) (-1281.797) [-1274.143] (-1273.286) * (-1276.228) [-1279.209] (-1276.503) (-1272.743) -- 0:02:09
372500 -- (-1281.468) [-1270.293] (-1277.265) (-1274.969) * (-1280.933) [-1269.956] (-1277.662) (-1274.572) -- 0:02:11
373000 -- (-1277.499) (-1278.245) [-1273.904] (-1274.720) * [-1272.197] (-1276.376) (-1279.457) (-1279.881) -- 0:02:11
373500 -- [-1277.621] (-1270.762) (-1287.115) (-1279.064) * (-1283.287) [-1272.603] (-1276.064) (-1276.827) -- 0:02:10
374000 -- [-1285.254] (-1272.898) (-1274.625) (-1288.904) * (-1275.002) (-1275.603) [-1273.843] (-1279.943) -- 0:02:10
374500 -- (-1272.219) (-1276.290) [-1277.926] (-1281.301) * (-1280.631) [-1279.333] (-1280.316) (-1276.323) -- 0:02:10
375000 -- (-1283.301) [-1269.294] (-1277.309) (-1284.432) * (-1276.295) (-1282.141) [-1272.311] (-1283.052) -- 0:02:10
Average standard deviation of split frequencies: 0.011477
375500 -- [-1280.169] (-1272.507) (-1282.596) (-1278.998) * (-1278.022) [-1277.116] (-1270.877) (-1275.373) -- 0:02:09
376000 -- (-1281.917) [-1275.863] (-1273.897) (-1276.577) * (-1272.609) (-1279.543) [-1269.612] (-1276.746) -- 0:02:09
376500 -- (-1276.590) [-1270.905] (-1279.883) (-1281.909) * (-1275.643) (-1283.279) [-1271.607] (-1281.293) -- 0:02:09
377000 -- (-1280.291) (-1268.779) (-1276.931) [-1280.777] * (-1280.026) (-1280.415) (-1276.920) [-1272.727] -- 0:02:08
377500 -- (-1281.625) [-1276.437] (-1284.677) (-1277.803) * (-1271.668) (-1285.026) (-1272.264) [-1273.374] -- 0:02:10
378000 -- (-1280.038) [-1276.034] (-1270.897) (-1286.812) * [-1278.194] (-1281.123) (-1281.579) (-1282.685) -- 0:02:09
378500 -- (-1283.271) [-1266.635] (-1272.358) (-1280.802) * [-1269.473] (-1279.633) (-1275.576) (-1273.057) -- 0:02:09
379000 -- (-1278.486) [-1271.699] (-1276.104) (-1289.497) * (-1282.250) [-1268.275] (-1272.975) (-1284.623) -- 0:02:09
379500 -- (-1282.431) [-1273.706] (-1277.701) (-1281.895) * (-1279.093) [-1271.170] (-1272.449) (-1277.298) -- 0:02:09
380000 -- (-1285.789) [-1276.224] (-1276.372) (-1282.400) * [-1275.250] (-1281.843) (-1272.171) (-1281.535) -- 0:02:08
Average standard deviation of split frequencies: 0.011431
380500 -- (-1280.764) (-1278.087) [-1275.581] (-1281.867) * (-1270.048) (-1280.723) (-1274.824) [-1268.103] -- 0:02:08
381000 -- (-1266.268) [-1273.130] (-1275.419) (-1274.469) * (-1268.880) (-1279.204) (-1273.736) [-1267.844] -- 0:02:08
381500 -- (-1275.367) (-1269.006) [-1281.082] (-1277.893) * (-1283.163) [-1280.224] (-1276.840) (-1280.446) -- 0:02:08
382000 -- (-1278.920) [-1271.292] (-1275.416) (-1269.317) * (-1271.837) [-1275.624] (-1284.944) (-1276.929) -- 0:02:09
382500 -- (-1280.674) (-1272.838) [-1268.025] (-1271.000) * (-1271.048) (-1276.910) [-1271.014] (-1280.434) -- 0:02:09
383000 -- (-1275.779) (-1278.747) [-1278.649] (-1278.308) * (-1279.228) [-1270.949] (-1277.368) (-1284.371) -- 0:02:08
383500 -- [-1272.492] (-1279.053) (-1275.674) (-1275.581) * (-1275.273) (-1277.502) (-1282.336) [-1283.184] -- 0:02:08
384000 -- (-1275.196) [-1274.473] (-1284.664) (-1277.432) * (-1278.461) [-1269.861] (-1279.340) (-1284.776) -- 0:02:08
384500 -- (-1277.211) (-1284.129) (-1279.321) [-1267.340] * (-1276.901) [-1274.015] (-1282.148) (-1288.147) -- 0:02:08
385000 -- (-1283.646) [-1271.681] (-1279.091) (-1270.667) * (-1288.645) (-1270.165) (-1281.409) [-1270.323] -- 0:02:07
Average standard deviation of split frequencies: 0.010522
385500 -- (-1283.818) [-1280.224] (-1277.547) (-1275.812) * (-1281.187) [-1272.845] (-1281.596) (-1276.690) -- 0:02:07
386000 -- (-1285.568) (-1279.450) (-1281.078) [-1271.171] * (-1275.347) (-1274.140) (-1285.452) [-1273.077] -- 0:02:07
386500 -- [-1275.720] (-1273.048) (-1285.140) (-1277.059) * [-1276.772] (-1270.195) (-1281.940) (-1277.371) -- 0:02:06
387000 -- (-1286.608) [-1271.874] (-1295.180) (-1285.399) * (-1281.920) (-1266.372) [-1273.642] (-1278.910) -- 0:02:08
387500 -- (-1282.644) (-1274.026) [-1271.753] (-1276.822) * (-1278.404) [-1273.543] (-1269.395) (-1280.210) -- 0:02:08
388000 -- [-1275.312] (-1292.750) (-1280.074) (-1275.932) * (-1272.206) [-1277.625] (-1275.406) (-1274.464) -- 0:02:07
388500 -- (-1274.557) (-1285.598) [-1277.951] (-1273.098) * [-1272.194] (-1292.976) (-1277.691) (-1265.010) -- 0:02:07
389000 -- (-1285.669) (-1279.277) (-1274.223) [-1277.832] * (-1279.838) (-1279.277) (-1279.855) [-1277.625] -- 0:02:07
389500 -- (-1271.322) [-1270.300] (-1291.040) (-1278.545) * (-1278.105) (-1281.474) [-1281.460] (-1277.631) -- 0:02:06
390000 -- (-1271.350) [-1272.589] (-1273.016) (-1285.812) * [-1280.385] (-1275.197) (-1279.439) (-1280.403) -- 0:02:06
Average standard deviation of split frequencies: 0.010303
390500 -- (-1278.135) (-1270.792) (-1277.017) [-1277.313] * [-1282.840] (-1267.881) (-1270.794) (-1278.085) -- 0:02:06
391000 -- (-1281.972) (-1288.823) [-1281.849] (-1278.292) * (-1272.819) (-1272.960) [-1274.627] (-1290.168) -- 0:02:06
391500 -- (-1270.015) [-1279.832] (-1296.009) (-1271.763) * (-1277.395) [-1273.761] (-1279.177) (-1281.988) -- 0:02:05
392000 -- (-1270.598) (-1276.823) (-1291.181) [-1281.984] * [-1270.731] (-1279.103) (-1275.396) (-1277.346) -- 0:02:07
392500 -- (-1266.773) (-1277.223) (-1290.033) [-1272.652] * (-1276.415) (-1278.770) [-1278.440] (-1268.171) -- 0:02:06
393000 -- [-1276.850] (-1282.632) (-1283.209) (-1280.679) * (-1282.247) [-1271.760] (-1274.692) (-1280.382) -- 0:02:06
393500 -- (-1287.256) (-1280.637) (-1272.765) [-1271.424] * (-1279.034) (-1276.746) (-1278.912) [-1273.455] -- 0:02:06
394000 -- (-1279.828) (-1270.615) [-1272.088] (-1286.284) * (-1277.282) (-1278.188) [-1282.975] (-1285.981) -- 0:02:06
394500 -- (-1280.383) (-1280.403) (-1280.696) [-1272.892] * (-1276.801) [-1270.602] (-1274.614) (-1276.731) -- 0:02:05
395000 -- (-1278.883) (-1274.569) (-1283.131) [-1269.725] * (-1268.457) (-1272.634) (-1273.127) [-1280.694] -- 0:02:05
Average standard deviation of split frequencies: 0.009890
395500 -- (-1270.628) (-1286.313) (-1276.456) [-1272.180] * [-1269.139] (-1278.006) (-1270.718) (-1273.174) -- 0:02:05
396000 -- (-1275.404) (-1280.475) [-1268.160] (-1285.354) * (-1292.106) (-1282.460) [-1276.742] (-1270.284) -- 0:02:05
396500 -- (-1283.594) [-1271.389] (-1282.479) (-1280.748) * (-1278.008) (-1281.510) [-1271.279] (-1277.022) -- 0:02:06
397000 -- (-1282.336) [-1275.204] (-1274.194) (-1284.481) * (-1284.815) [-1278.799] (-1284.055) (-1268.845) -- 0:02:06
397500 -- (-1270.939) (-1285.794) (-1279.532) [-1271.601] * (-1277.147) (-1280.174) (-1271.094) [-1277.586] -- 0:02:05
398000 -- (-1283.786) (-1281.751) [-1281.119] (-1272.047) * (-1275.949) [-1275.138] (-1279.034) (-1278.210) -- 0:02:05
398500 -- (-1270.879) (-1304.553) [-1280.376] (-1280.768) * (-1284.545) (-1270.256) [-1276.174] (-1275.460) -- 0:02:05
399000 -- (-1278.044) [-1271.545] (-1291.080) (-1292.551) * (-1273.908) [-1266.698] (-1275.132) (-1275.513) -- 0:02:05
399500 -- (-1276.938) (-1282.215) [-1277.391] (-1288.032) * (-1276.222) (-1271.790) (-1283.137) [-1273.503] -- 0:02:04
400000 -- (-1284.504) (-1270.790) [-1274.758] (-1275.618) * (-1289.162) (-1278.524) [-1269.795] (-1274.408) -- 0:02:04
Average standard deviation of split frequencies: 0.009503
400500 -- (-1277.632) [-1270.571] (-1273.569) (-1283.081) * (-1283.882) (-1275.769) (-1282.275) [-1278.033] -- 0:02:04
401000 -- (-1275.621) [-1271.448] (-1278.534) (-1294.252) * [-1276.121] (-1276.325) (-1276.920) (-1271.356) -- 0:02:03
401500 -- (-1279.418) (-1285.640) [-1277.466] (-1273.362) * (-1269.007) (-1283.061) [-1277.017] (-1274.900) -- 0:02:05
402000 -- (-1284.599) (-1279.916) [-1278.479] (-1284.839) * (-1284.630) [-1282.317] (-1270.338) (-1284.457) -- 0:02:04
402500 -- (-1279.501) (-1272.735) (-1275.917) [-1277.976] * (-1276.317) (-1290.667) [-1269.220] (-1282.543) -- 0:02:04
403000 -- (-1279.700) (-1273.332) (-1281.673) [-1287.637] * (-1287.312) (-1275.009) (-1273.135) [-1273.140] -- 0:02:04
403500 -- (-1275.933) (-1280.777) (-1272.427) [-1275.828] * (-1282.071) (-1285.979) (-1283.156) [-1282.774] -- 0:02:04
404000 -- (-1276.981) (-1276.870) [-1279.575] (-1278.372) * (-1273.391) [-1276.891] (-1277.998) (-1281.947) -- 0:02:03
404500 -- (-1275.244) (-1264.380) (-1286.814) [-1271.202] * (-1286.010) (-1276.031) (-1271.851) [-1274.633] -- 0:02:03
405000 -- [-1280.673] (-1280.162) (-1272.468) (-1278.136) * (-1285.768) (-1285.498) [-1274.892] (-1267.498) -- 0:02:03
Average standard deviation of split frequencies: 0.010616
405500 -- (-1279.243) (-1280.575) (-1267.809) [-1277.911] * (-1279.618) [-1272.623] (-1283.952) (-1275.427) -- 0:02:03
406000 -- [-1276.718] (-1278.506) (-1279.837) (-1276.315) * (-1284.426) [-1280.113] (-1276.681) (-1273.085) -- 0:02:04
406500 -- (-1282.129) (-1274.694) [-1273.886] (-1277.432) * (-1277.780) (-1283.667) (-1275.845) [-1283.020] -- 0:02:04
407000 -- (-1279.475) [-1270.438] (-1276.570) (-1275.028) * (-1275.470) (-1269.853) (-1272.990) [-1272.580] -- 0:02:03
407500 -- [-1275.081] (-1276.535) (-1274.980) (-1277.355) * (-1284.002) (-1267.475) [-1274.302] (-1269.980) -- 0:02:03
408000 -- (-1272.981) (-1294.611) (-1284.582) [-1277.747] * [-1276.549] (-1275.793) (-1273.705) (-1273.076) -- 0:02:03
408500 -- (-1281.487) [-1267.988] (-1281.817) (-1279.914) * [-1280.604] (-1275.840) (-1276.408) (-1280.732) -- 0:02:03
409000 -- (-1283.488) (-1277.533) (-1269.630) [-1266.231] * (-1279.673) [-1272.336] (-1274.645) (-1275.865) -- 0:02:02
409500 -- (-1282.928) [-1270.641] (-1280.153) (-1279.952) * (-1283.971) [-1276.390] (-1279.495) (-1270.745) -- 0:02:02
410000 -- (-1272.910) [-1282.093] (-1285.332) (-1281.538) * (-1270.151) [-1283.484] (-1275.354) (-1277.925) -- 0:02:02
Average standard deviation of split frequencies: 0.008830
410500 -- [-1269.820] (-1281.924) (-1280.588) (-1269.771) * [-1280.160] (-1281.874) (-1276.817) (-1280.404) -- 0:02:02
411000 -- (-1278.617) [-1269.454] (-1271.319) (-1276.411) * (-1277.442) (-1292.035) [-1277.667] (-1273.660) -- 0:02:03
411500 -- [-1278.930] (-1289.074) (-1287.139) (-1287.950) * (-1272.871) (-1280.033) [-1277.129] (-1282.120) -- 0:02:02
412000 -- (-1273.279) (-1278.695) (-1273.924) [-1270.376] * (-1277.144) (-1281.600) (-1274.150) [-1274.041] -- 0:02:02
412500 -- (-1279.711) [-1272.658] (-1277.225) (-1293.164) * (-1270.503) (-1277.568) (-1281.819) [-1272.091] -- 0:02:02
413000 -- (-1273.050) (-1287.981) (-1277.374) [-1274.306] * (-1282.923) (-1277.597) [-1271.686] (-1278.293) -- 0:02:02
413500 -- (-1283.010) [-1279.938] (-1272.189) (-1273.386) * (-1288.730) [-1279.392] (-1286.047) (-1276.992) -- 0:02:01
414000 -- (-1279.055) [-1277.050] (-1277.185) (-1279.727) * (-1274.357) [-1277.104] (-1271.163) (-1278.102) -- 0:02:01
414500 -- (-1279.208) [-1274.885] (-1270.697) (-1268.181) * [-1274.489] (-1273.733) (-1269.768) (-1270.369) -- 0:02:01
415000 -- (-1284.694) (-1282.686) [-1269.295] (-1272.866) * (-1271.309) [-1280.204] (-1277.465) (-1286.236) -- 0:02:01
Average standard deviation of split frequencies: 0.008804
415500 -- [-1272.382] (-1272.998) (-1278.555) (-1274.230) * [-1276.911] (-1283.085) (-1285.917) (-1276.896) -- 0:02:02
416000 -- (-1281.086) (-1277.326) [-1270.225] (-1288.104) * [-1272.521] (-1282.021) (-1273.950) (-1273.952) -- 0:02:02
416500 -- (-1274.784) (-1269.738) [-1273.671] (-1277.419) * (-1277.314) (-1287.357) (-1281.220) [-1277.810] -- 0:02:01
417000 -- [-1277.033] (-1286.266) (-1280.129) (-1276.659) * [-1275.702] (-1278.816) (-1273.883) (-1278.522) -- 0:02:01
417500 -- [-1273.498] (-1285.990) (-1291.676) (-1274.425) * [-1273.704] (-1273.814) (-1280.154) (-1281.679) -- 0:02:01
418000 -- (-1283.267) [-1279.601] (-1285.611) (-1274.375) * (-1272.183) [-1276.324] (-1274.203) (-1274.122) -- 0:02:01
418500 -- (-1280.405) (-1287.198) [-1271.419] (-1275.095) * (-1274.600) (-1273.370) [-1274.209] (-1275.730) -- 0:02:00
419000 -- (-1288.996) (-1281.835) [-1265.556] (-1274.358) * (-1273.835) (-1279.630) (-1269.995) [-1274.457] -- 0:02:00
419500 -- (-1281.182) [-1274.116] (-1273.060) (-1284.704) * [-1280.673] (-1274.692) (-1280.167) (-1275.914) -- 0:02:00
420000 -- (-1274.768) (-1277.693) [-1275.144] (-1279.642) * [-1277.020] (-1278.734) (-1284.213) (-1278.442) -- 0:02:00
Average standard deviation of split frequencies: 0.008189
420500 -- [-1273.381] (-1284.806) (-1274.611) (-1287.909) * (-1275.385) [-1274.543] (-1273.843) (-1276.050) -- 0:02:01
421000 -- [-1281.960] (-1276.787) (-1284.280) (-1283.092) * (-1277.222) (-1275.826) (-1286.808) [-1275.555] -- 0:02:01
421500 -- [-1281.760] (-1272.889) (-1281.292) (-1277.726) * (-1281.250) [-1270.891] (-1275.308) (-1276.636) -- 0:02:00
422000 -- (-1279.694) (-1291.295) [-1278.050] (-1288.883) * (-1272.939) (-1273.598) (-1287.498) [-1276.326] -- 0:02:00
422500 -- (-1287.915) [-1270.576] (-1273.750) (-1290.263) * (-1284.363) (-1279.740) (-1274.228) [-1276.848] -- 0:02:00
423000 -- (-1279.215) [-1271.517] (-1282.631) (-1291.555) * [-1272.175] (-1285.443) (-1281.114) (-1278.585) -- 0:02:00
423500 -- (-1290.088) (-1274.997) [-1278.014] (-1281.656) * (-1282.408) [-1277.687] (-1279.971) (-1270.625) -- 0:01:59
424000 -- [-1272.634] (-1275.211) (-1281.266) (-1280.143) * (-1277.620) [-1271.165] (-1277.917) (-1266.914) -- 0:01:59
424500 -- (-1278.515) (-1275.782) [-1268.720] (-1291.804) * (-1287.339) [-1276.184] (-1281.468) (-1275.918) -- 0:01:59
425000 -- (-1281.337) [-1280.492] (-1273.804) (-1288.768) * (-1274.938) (-1280.221) [-1275.106] (-1281.478) -- 0:01:59
Average standard deviation of split frequencies: 0.008172
425500 -- (-1285.353) (-1277.191) [-1270.407] (-1278.635) * (-1272.959) (-1282.208) (-1273.186) [-1272.117] -- 0:02:00
426000 -- (-1300.050) [-1270.395] (-1271.068) (-1281.283) * (-1279.183) [-1281.978] (-1282.482) (-1270.768) -- 0:01:59
426500 -- (-1279.280) (-1271.653) [-1270.527] (-1277.988) * (-1271.088) (-1290.916) [-1270.605] (-1270.038) -- 0:01:59
427000 -- [-1272.286] (-1278.900) (-1285.387) (-1289.033) * (-1273.336) (-1284.027) [-1275.660] (-1274.544) -- 0:01:59
427500 -- (-1276.685) [-1271.212] (-1282.330) (-1289.412) * [-1271.032] (-1278.407) (-1287.353) (-1270.815) -- 0:01:59
428000 -- (-1278.469) [-1265.667] (-1272.960) (-1275.832) * [-1270.267] (-1287.222) (-1283.307) (-1271.829) -- 0:01:58
428500 -- (-1287.213) (-1277.586) [-1274.852] (-1273.128) * (-1266.883) (-1270.721) (-1291.584) [-1281.822] -- 0:01:58
429000 -- (-1283.117) (-1287.390) (-1277.089) [-1276.926] * (-1273.940) [-1277.624] (-1281.614) (-1287.372) -- 0:01:58
429500 -- (-1272.616) (-1280.932) (-1281.474) [-1279.509] * (-1275.727) (-1275.285) (-1273.859) [-1271.562] -- 0:01:58
430000 -- (-1281.425) [-1282.452] (-1271.509) (-1274.677) * (-1268.584) (-1294.436) (-1283.854) [-1269.571] -- 0:01:59
Average standard deviation of split frequencies: 0.007915
430500 -- (-1283.701) [-1277.285] (-1272.007) (-1282.651) * (-1273.235) (-1285.495) (-1272.475) [-1278.366] -- 0:01:59
431000 -- (-1280.770) (-1280.212) [-1275.723] (-1290.716) * (-1281.527) (-1280.485) [-1276.024] (-1279.856) -- 0:01:58
431500 -- (-1277.339) (-1278.393) [-1273.696] (-1280.847) * (-1278.538) (-1288.448) (-1285.750) [-1271.692] -- 0:01:58
432000 -- [-1281.274] (-1277.429) (-1288.813) (-1277.817) * (-1277.548) (-1283.156) [-1277.608] (-1275.231) -- 0:01:58
432500 -- (-1273.499) (-1286.991) [-1283.245] (-1277.327) * [-1279.208] (-1277.806) (-1281.405) (-1276.163) -- 0:01:58
433000 -- [-1278.230] (-1281.422) (-1269.905) (-1285.077) * [-1279.337] (-1287.577) (-1277.094) (-1275.386) -- 0:01:57
433500 -- (-1276.766) (-1283.347) [-1279.306] (-1282.935) * (-1275.438) (-1280.345) [-1275.099] (-1270.798) -- 0:01:57
434000 -- (-1285.459) [-1280.071] (-1278.250) (-1284.300) * (-1275.255) [-1272.038] (-1272.306) (-1280.805) -- 0:01:57
434500 -- [-1279.781] (-1275.990) (-1275.240) (-1284.200) * (-1275.266) (-1275.862) (-1282.783) [-1272.639] -- 0:01:57
435000 -- [-1277.633] (-1278.768) (-1282.301) (-1275.384) * [-1270.913] (-1284.629) (-1274.805) (-1279.379) -- 0:01:58
Average standard deviation of split frequencies: 0.007984
435500 -- (-1274.339) (-1285.209) [-1273.941] (-1274.952) * (-1273.002) (-1279.669) (-1273.286) [-1277.332] -- 0:01:57
436000 -- [-1268.242] (-1275.301) (-1288.827) (-1279.543) * (-1291.426) (-1271.466) (-1282.492) [-1276.322] -- 0:01:57
436500 -- (-1279.775) (-1280.272) [-1276.623] (-1289.459) * (-1274.388) [-1272.835] (-1282.634) (-1279.754) -- 0:01:57
437000 -- (-1276.022) (-1281.020) (-1283.377) [-1277.114] * (-1273.043) (-1269.096) (-1271.065) [-1267.766] -- 0:01:57
437500 -- (-1276.105) (-1281.831) [-1271.320] (-1294.848) * (-1284.205) (-1271.926) (-1271.933) [-1271.164] -- 0:01:56
438000 -- (-1273.506) (-1276.154) [-1275.943] (-1280.004) * (-1279.318) (-1285.216) [-1281.244] (-1272.826) -- 0:01:56
438500 -- (-1284.696) [-1279.692] (-1278.593) (-1273.577) * (-1277.782) [-1279.859] (-1274.189) (-1286.663) -- 0:01:56
439000 -- (-1293.780) (-1272.699) (-1270.486) [-1274.844] * (-1277.313) (-1282.329) (-1274.056) [-1275.446] -- 0:01:56
439500 -- (-1290.772) [-1277.916] (-1275.118) (-1283.867) * (-1284.711) (-1286.983) [-1283.407] (-1278.842) -- 0:01:57
440000 -- (-1282.277) (-1283.490) (-1271.462) [-1277.894] * (-1285.991) (-1280.894) (-1277.501) [-1268.964] -- 0:01:57
Average standard deviation of split frequencies: 0.006665
440500 -- (-1278.702) (-1285.497) (-1278.763) [-1285.266] * (-1282.624) [-1274.559] (-1281.004) (-1270.278) -- 0:01:56
441000 -- [-1279.041] (-1278.679) (-1276.110) (-1282.196) * (-1285.881) (-1282.618) (-1278.704) [-1267.587] -- 0:01:56
441500 -- [-1276.850] (-1284.410) (-1278.876) (-1273.814) * (-1289.105) (-1272.772) (-1276.820) [-1269.791] -- 0:01:56
442000 -- (-1275.960) (-1279.238) [-1277.562] (-1279.034) * (-1280.813) (-1274.720) (-1283.228) [-1274.122] -- 0:01:56
442500 -- [-1267.749] (-1273.047) (-1274.534) (-1273.428) * [-1279.597] (-1271.091) (-1278.121) (-1276.295) -- 0:01:55
443000 -- (-1276.472) (-1287.327) [-1275.008] (-1271.443) * [-1270.198] (-1278.438) (-1277.503) (-1275.696) -- 0:01:55
443500 -- (-1274.012) (-1277.070) (-1278.502) [-1272.635] * (-1271.891) (-1276.919) (-1282.035) [-1279.913] -- 0:01:55
444000 -- [-1273.170] (-1275.137) (-1268.629) (-1280.077) * (-1266.181) [-1280.827] (-1281.778) (-1293.316) -- 0:01:55
444500 -- (-1280.315) (-1275.352) (-1279.654) [-1273.030] * (-1276.494) (-1279.704) (-1276.762) [-1274.765] -- 0:01:56
445000 -- (-1273.566) (-1277.860) (-1276.793) [-1272.346] * [-1275.303] (-1279.769) (-1276.247) (-1270.577) -- 0:01:55
Average standard deviation of split frequencies: 0.006423
445500 -- (-1279.239) [-1272.312] (-1278.359) (-1278.401) * (-1279.032) (-1283.733) (-1280.044) [-1274.321] -- 0:01:55
446000 -- [-1273.420] (-1280.022) (-1278.427) (-1274.725) * (-1279.156) (-1276.965) [-1280.470] (-1270.558) -- 0:01:55
446500 -- (-1272.915) (-1270.557) (-1300.891) [-1271.372] * (-1285.158) (-1276.684) (-1283.243) [-1273.126] -- 0:01:55
447000 -- (-1285.597) [-1273.617] (-1292.102) (-1271.077) * [-1278.095] (-1279.331) (-1284.329) (-1282.596) -- 0:01:55
447500 -- [-1270.309] (-1273.388) (-1275.535) (-1274.364) * [-1274.770] (-1279.501) (-1292.392) (-1282.174) -- 0:01:54
448000 -- (-1269.732) [-1270.211] (-1288.262) (-1273.594) * (-1271.531) (-1272.518) (-1291.821) [-1279.592] -- 0:01:54
448500 -- (-1274.738) [-1275.321] (-1277.242) (-1276.511) * [-1272.604] (-1282.910) (-1286.431) (-1281.711) -- 0:01:54
449000 -- (-1273.948) [-1276.379] (-1285.070) (-1282.333) * (-1273.733) (-1278.642) (-1293.180) [-1280.857] -- 0:01:54
449500 -- (-1275.509) (-1271.288) (-1277.245) [-1273.884] * (-1277.542) (-1276.533) (-1275.673) [-1270.466] -- 0:01:55
450000 -- (-1272.959) (-1277.074) (-1283.382) [-1272.263] * (-1269.309) [-1274.129] (-1274.093) (-1283.240) -- 0:01:54
Average standard deviation of split frequencies: 0.005632
450500 -- [-1273.768] (-1276.976) (-1284.196) (-1276.426) * (-1289.249) (-1278.979) [-1279.439] (-1278.541) -- 0:01:54
451000 -- (-1275.422) (-1286.596) [-1271.185] (-1284.206) * (-1293.556) (-1270.995) [-1271.644] (-1279.713) -- 0:01:54
451500 -- (-1275.265) (-1279.552) (-1278.462) [-1267.342] * (-1283.016) [-1272.805] (-1279.254) (-1276.363) -- 0:01:54
452000 -- [-1271.177] (-1276.262) (-1282.499) (-1274.788) * [-1290.297] (-1277.756) (-1276.109) (-1280.808) -- 0:01:53
452500 -- [-1273.009] (-1271.549) (-1277.976) (-1279.940) * (-1282.258) (-1277.263) [-1273.554] (-1280.186) -- 0:01:53
453000 -- (-1284.064) (-1278.829) (-1289.713) [-1271.104] * [-1275.575] (-1272.321) (-1290.976) (-1271.921) -- 0:01:53
453500 -- [-1272.728] (-1284.915) (-1290.465) (-1278.710) * (-1291.792) (-1283.899) (-1281.530) [-1272.029] -- 0:01:53
454000 -- (-1291.186) [-1267.188] (-1286.103) (-1274.987) * (-1276.778) (-1271.419) [-1278.346] (-1273.896) -- 0:01:54
454500 -- (-1275.937) (-1280.840) (-1290.550) [-1268.402] * (-1284.881) (-1279.081) (-1274.952) [-1282.150] -- 0:01:54
455000 -- (-1284.056) (-1282.689) (-1283.087) [-1272.431] * (-1276.600) (-1276.084) (-1274.116) [-1282.660] -- 0:01:53
Average standard deviation of split frequencies: 0.005089
455500 -- (-1280.298) (-1283.902) (-1286.632) [-1270.827] * (-1280.318) [-1271.436] (-1278.433) (-1277.904) -- 0:01:53
456000 -- [-1272.650] (-1282.398) (-1287.738) (-1272.392) * (-1276.285) (-1279.005) [-1274.573] (-1271.759) -- 0:01:53
456500 -- [-1278.843] (-1274.341) (-1280.046) (-1279.572) * [-1274.473] (-1273.021) (-1267.399) (-1274.228) -- 0:01:53
457000 -- (-1278.543) [-1277.621] (-1277.288) (-1269.796) * [-1282.685] (-1277.726) (-1272.704) (-1284.618) -- 0:01:52
457500 -- (-1278.096) (-1281.859) (-1281.650) [-1279.602] * (-1276.297) (-1279.331) [-1269.944] (-1276.086) -- 0:01:52
458000 -- [-1275.040] (-1284.211) (-1279.977) (-1284.954) * (-1296.461) (-1277.266) [-1271.801] (-1270.607) -- 0:01:52
458500 -- (-1276.529) (-1284.826) (-1285.146) [-1280.567] * (-1292.624) (-1278.022) (-1279.222) [-1270.767] -- 0:01:52
459000 -- (-1291.864) (-1290.301) (-1275.696) [-1273.505] * (-1280.936) (-1283.287) (-1277.124) [-1273.289] -- 0:01:53
459500 -- [-1278.756] (-1285.177) (-1280.245) (-1271.768) * (-1281.329) (-1271.366) (-1269.057) [-1270.152] -- 0:01:52
460000 -- (-1281.074) (-1285.839) [-1271.603] (-1284.762) * (-1278.170) [-1272.102] (-1278.421) (-1273.108) -- 0:01:52
Average standard deviation of split frequencies: 0.004802
460500 -- (-1281.401) (-1268.572) (-1283.205) [-1273.660] * (-1281.057) (-1274.295) [-1267.594] (-1270.010) -- 0:01:52
461000 -- (-1280.769) (-1270.848) (-1285.399) [-1271.890] * [-1272.535] (-1279.752) (-1271.064) (-1274.235) -- 0:01:52
461500 -- (-1280.946) [-1273.438] (-1270.129) (-1297.431) * [-1269.684] (-1274.479) (-1286.498) (-1286.730) -- 0:01:52
462000 -- (-1281.325) (-1274.957) [-1280.854] (-1279.971) * (-1281.244) (-1277.645) (-1276.281) [-1269.382] -- 0:01:51
462500 -- (-1268.759) (-1270.203) (-1280.875) [-1272.359] * (-1272.638) [-1276.888] (-1273.379) (-1273.476) -- 0:01:51
463000 -- (-1277.489) [-1279.603] (-1279.130) (-1282.983) * [-1267.762] (-1279.889) (-1283.321) (-1271.955) -- 0:01:51
463500 -- (-1288.548) (-1292.171) (-1270.058) [-1286.479] * [-1274.677] (-1282.113) (-1283.048) (-1269.682) -- 0:01:51
464000 -- [-1276.409] (-1274.684) (-1269.620) (-1271.913) * (-1273.294) (-1277.680) (-1282.006) [-1274.760] -- 0:01:52
464500 -- (-1284.104) (-1272.793) [-1279.744] (-1274.641) * (-1278.583) [-1275.864] (-1277.170) (-1275.066) -- 0:01:51
465000 -- (-1280.753) (-1275.384) (-1273.210) [-1273.831] * [-1275.284] (-1281.172) (-1280.086) (-1272.010) -- 0:01:51
Average standard deviation of split frequencies: 0.004513
465500 -- (-1284.069) (-1278.504) (-1272.863) [-1275.571] * (-1274.933) [-1279.211] (-1278.310) (-1275.329) -- 0:01:51
466000 -- [-1276.513] (-1284.402) (-1275.934) (-1273.819) * (-1274.447) (-1273.981) [-1278.995] (-1279.567) -- 0:01:51
466500 -- (-1282.292) (-1285.513) [-1271.664] (-1275.734) * (-1283.059) (-1289.512) [-1274.536] (-1284.247) -- 0:01:50
467000 -- (-1271.508) (-1273.849) (-1273.519) [-1276.215] * (-1271.343) [-1276.369] (-1271.052) (-1276.832) -- 0:01:50
467500 -- (-1279.910) (-1284.838) [-1272.073] (-1275.152) * (-1279.901) [-1278.606] (-1280.924) (-1275.339) -- 0:01:50
468000 -- (-1275.205) (-1283.149) (-1288.847) [-1278.540] * (-1270.431) (-1272.982) [-1271.324] (-1277.244) -- 0:01:50
468500 -- (-1273.922) [-1273.957] (-1282.634) (-1279.768) * [-1275.758] (-1275.972) (-1274.103) (-1274.354) -- 0:01:51
469000 -- (-1278.457) [-1264.889] (-1278.756) (-1290.736) * (-1275.926) (-1275.038) (-1281.600) [-1270.277] -- 0:01:50
469500 -- [-1273.635] (-1282.176) (-1272.064) (-1269.460) * [-1271.210] (-1284.102) (-1273.485) (-1276.341) -- 0:01:50
470000 -- [-1272.683] (-1280.146) (-1275.136) (-1281.215) * [-1284.089] (-1274.621) (-1276.773) (-1279.154) -- 0:01:50
Average standard deviation of split frequencies: 0.004777
470500 -- (-1273.474) (-1271.411) [-1275.924] (-1271.365) * (-1276.740) [-1281.884] (-1286.616) (-1276.580) -- 0:01:50
471000 -- (-1286.770) [-1277.047] (-1281.477) (-1274.863) * (-1291.364) [-1271.600] (-1283.778) (-1277.937) -- 0:01:50
471500 -- [-1268.206] (-1267.758) (-1286.796) (-1285.610) * (-1290.370) [-1272.809] (-1275.770) (-1275.641) -- 0:01:49
472000 -- (-1273.459) (-1281.969) (-1284.696) [-1283.397] * (-1285.634) [-1274.855] (-1272.790) (-1275.855) -- 0:01:49
472500 -- (-1275.565) [-1269.629] (-1277.601) (-1275.904) * (-1272.995) (-1272.643) (-1278.233) [-1280.042] -- 0:01:49
473000 -- [-1272.769] (-1272.136) (-1273.020) (-1281.830) * (-1272.514) [-1274.347] (-1279.903) (-1277.379) -- 0:01:49
473500 -- (-1283.358) [-1271.216] (-1274.272) (-1279.100) * (-1274.979) (-1283.513) [-1267.822] (-1285.074) -- 0:01:50
474000 -- (-1285.030) (-1278.125) (-1282.038) [-1276.430] * (-1281.026) (-1288.687) [-1270.026] (-1274.067) -- 0:01:49
474500 -- [-1268.367] (-1277.407) (-1270.187) (-1278.771) * [-1276.177] (-1273.956) (-1279.241) (-1275.506) -- 0:01:49
475000 -- [-1268.867] (-1274.871) (-1272.294) (-1283.441) * [-1277.045] (-1287.975) (-1271.535) (-1265.020) -- 0:01:49
Average standard deviation of split frequencies: 0.004723
475500 -- (-1272.920) (-1280.192) [-1276.066] (-1273.375) * (-1276.824) (-1277.776) (-1275.831) [-1271.578] -- 0:01:49
476000 -- [-1269.643] (-1279.072) (-1265.988) (-1278.810) * [-1280.045] (-1284.136) (-1276.636) (-1289.337) -- 0:01:48
476500 -- (-1280.392) (-1289.650) (-1274.096) [-1268.967] * (-1272.132) (-1284.751) [-1270.386] (-1274.444) -- 0:01:48
477000 -- (-1272.109) (-1278.005) (-1285.536) [-1263.957] * (-1281.120) (-1281.942) [-1276.266] (-1272.324) -- 0:01:48
477500 -- (-1264.595) (-1280.973) (-1289.375) [-1268.099] * [-1280.845] (-1276.544) (-1268.153) (-1275.449) -- 0:01:48
478000 -- (-1284.253) (-1276.262) (-1276.682) [-1274.360] * (-1296.845) (-1285.032) (-1270.956) [-1273.067] -- 0:01:49
478500 -- [-1276.257] (-1280.710) (-1275.836) (-1271.978) * (-1291.974) (-1285.691) [-1271.559] (-1272.754) -- 0:01:48
479000 -- (-1270.985) (-1274.860) [-1284.928] (-1273.945) * (-1287.579) (-1280.347) (-1279.352) [-1270.041] -- 0:01:48
479500 -- (-1270.841) [-1275.301] (-1273.984) (-1275.450) * (-1286.175) (-1277.926) [-1272.739] (-1270.962) -- 0:01:48
480000 -- (-1281.424) (-1289.688) (-1275.224) [-1275.148] * (-1286.220) [-1284.907] (-1272.767) (-1275.506) -- 0:01:48
Average standard deviation of split frequencies: 0.004677
480500 -- (-1283.343) [-1277.568] (-1280.905) (-1267.844) * (-1283.883) (-1273.793) [-1275.716] (-1275.795) -- 0:01:48
481000 -- (-1278.413) (-1275.950) [-1271.889] (-1269.114) * [-1278.166] (-1276.093) (-1276.936) (-1276.923) -- 0:01:47
481500 -- [-1283.310] (-1269.975) (-1276.712) (-1282.780) * (-1282.503) (-1284.634) [-1272.299] (-1276.059) -- 0:01:47
482000 -- (-1273.781) [-1271.148] (-1291.118) (-1279.665) * (-1280.294) [-1273.943] (-1274.884) (-1276.966) -- 0:01:47
482500 -- [-1276.747] (-1285.828) (-1275.475) (-1284.053) * (-1289.754) [-1274.453] (-1289.786) (-1288.430) -- 0:01:47
483000 -- (-1278.915) (-1278.973) (-1277.657) [-1277.078] * (-1281.030) (-1285.378) (-1275.197) [-1272.222] -- 0:01:48
483500 -- (-1280.701) [-1279.649] (-1277.455) (-1281.710) * (-1278.619) [-1272.153] (-1274.096) (-1270.961) -- 0:01:47
484000 -- (-1280.699) (-1278.144) [-1274.997] (-1289.662) * [-1278.786] (-1276.751) (-1281.123) (-1287.944) -- 0:01:47
484500 -- (-1283.866) (-1275.456) (-1278.644) [-1275.168] * (-1276.020) [-1269.699] (-1283.146) (-1287.018) -- 0:01:47
485000 -- (-1282.289) [-1266.180] (-1282.164) (-1273.588) * [-1274.461] (-1274.024) (-1280.239) (-1276.967) -- 0:01:47
Average standard deviation of split frequencies: 0.003880
485500 -- (-1275.092) (-1285.839) (-1279.720) [-1276.750] * (-1278.141) [-1269.448] (-1281.894) (-1269.152) -- 0:01:47
486000 -- [-1272.626] (-1294.933) (-1284.122) (-1276.306) * (-1281.229) (-1273.437) (-1281.403) [-1276.763] -- 0:01:46
486500 -- [-1276.188] (-1272.081) (-1277.136) (-1283.833) * [-1274.615] (-1269.038) (-1277.051) (-1281.156) -- 0:01:46
487000 -- (-1277.385) (-1273.154) [-1276.862] (-1281.682) * (-1291.284) (-1284.616) [-1274.944] (-1272.975) -- 0:01:46
487500 -- (-1278.906) [-1279.876] (-1291.107) (-1283.799) * (-1303.383) (-1275.990) (-1279.821) [-1268.564] -- 0:01:47
488000 -- (-1277.132) (-1277.847) [-1269.751] (-1280.145) * [-1274.852] (-1281.869) (-1280.576) (-1280.161) -- 0:01:47
488500 -- (-1268.457) (-1276.101) [-1269.125] (-1275.262) * [-1275.056] (-1279.570) (-1273.172) (-1272.685) -- 0:01:46
489000 -- (-1269.672) [-1274.864] (-1278.189) (-1284.556) * [-1272.614] (-1272.017) (-1273.678) (-1271.820) -- 0:01:46
489500 -- [-1276.603] (-1270.804) (-1277.892) (-1275.404) * (-1275.814) (-1284.070) [-1270.258] (-1275.282) -- 0:01:46
490000 -- (-1283.342) (-1273.667) [-1283.421] (-1275.825) * (-1278.018) (-1274.895) [-1279.431] (-1280.643) -- 0:01:46
Average standard deviation of split frequencies: 0.004286
490500 -- (-1279.820) (-1275.958) [-1270.110] (-1275.558) * (-1283.127) [-1272.583] (-1275.870) (-1275.495) -- 0:01:45
491000 -- (-1279.911) (-1272.473) [-1269.493] (-1274.838) * (-1282.891) [-1272.046] (-1270.161) (-1290.644) -- 0:01:45
491500 -- [-1269.031] (-1279.395) (-1274.846) (-1272.590) * [-1272.807] (-1279.551) (-1274.745) (-1284.130) -- 0:01:45
492000 -- (-1285.896) (-1277.683) [-1270.332] (-1279.728) * [-1273.247] (-1276.275) (-1276.276) (-1280.226) -- 0:01:45
492500 -- (-1274.194) (-1270.391) [-1268.371] (-1289.371) * [-1275.122] (-1277.295) (-1276.020) (-1286.478) -- 0:01:46
493000 -- [-1272.225] (-1279.443) (-1272.276) (-1270.788) * [-1281.989] (-1276.242) (-1279.692) (-1283.832) -- 0:01:45
493500 -- (-1285.257) (-1277.841) (-1268.696) [-1272.067] * (-1275.125) (-1273.914) (-1276.915) [-1280.653] -- 0:01:45
494000 -- (-1284.533) (-1278.441) [-1275.766] (-1285.030) * (-1279.262) (-1280.576) (-1289.839) [-1288.319] -- 0:01:45
494500 -- [-1273.804] (-1283.692) (-1281.940) (-1279.106) * (-1278.448) (-1274.923) (-1279.352) [-1276.194] -- 0:01:45
495000 -- (-1277.028) [-1275.579] (-1286.238) (-1283.195) * (-1283.302) (-1279.631) [-1275.875] (-1287.919) -- 0:01:45
Average standard deviation of split frequencies: 0.004313
495500 -- (-1283.250) (-1275.061) [-1283.075] (-1278.980) * (-1292.962) (-1286.099) (-1269.240) [-1277.093] -- 0:01:44
496000 -- [-1276.225] (-1291.689) (-1273.970) (-1281.950) * (-1284.719) (-1284.248) (-1278.663) [-1279.454] -- 0:01:44
496500 -- (-1282.955) (-1283.974) (-1275.294) [-1274.307] * (-1276.584) (-1285.202) (-1281.807) [-1277.025] -- 0:01:44
497000 -- [-1270.064] (-1275.432) (-1289.300) (-1279.295) * [-1271.802] (-1281.393) (-1274.650) (-1287.370) -- 0:01:45
497500 -- (-1280.040) (-1268.235) (-1272.258) [-1266.268] * (-1271.019) (-1277.953) [-1269.680] (-1277.342) -- 0:01:45
498000 -- (-1280.435) (-1269.781) (-1275.843) [-1277.221] * (-1274.360) (-1273.266) [-1265.764] (-1284.510) -- 0:01:44
498500 -- [-1278.420] (-1276.893) (-1280.236) (-1275.387) * (-1277.024) (-1280.813) [-1268.286] (-1280.925) -- 0:01:44
499000 -- (-1276.110) (-1271.664) (-1277.598) [-1266.379] * (-1266.024) (-1281.073) [-1267.386] (-1282.824) -- 0:01:44
499500 -- [-1274.054] (-1273.471) (-1279.349) (-1277.525) * [-1265.557] (-1277.578) (-1278.151) (-1294.328) -- 0:01:44
500000 -- (-1268.651) (-1270.371) (-1271.425) [-1272.840] * (-1279.286) [-1274.322] (-1272.273) (-1286.051) -- 0:01:44
Average standard deviation of split frequencies: 0.004563
500500 -- (-1274.389) (-1277.710) [-1271.467] (-1268.429) * (-1278.662) (-1278.636) [-1277.626] (-1297.101) -- 0:01:43
501000 -- [-1286.335] (-1281.831) (-1279.179) (-1279.476) * (-1278.401) [-1273.689] (-1280.317) (-1286.112) -- 0:01:43
501500 -- (-1285.845) (-1272.688) [-1266.940] (-1269.662) * (-1273.195) (-1284.924) [-1270.267] (-1285.645) -- 0:01:43
502000 -- (-1284.190) [-1269.801] (-1281.087) (-1264.346) * (-1276.162) [-1272.740] (-1274.755) (-1281.869) -- 0:01:44
502500 -- (-1274.811) (-1277.392) (-1271.183) [-1268.212] * (-1285.755) [-1275.001] (-1280.577) (-1281.647) -- 0:01:43
503000 -- (-1271.735) [-1274.257] (-1276.314) (-1276.828) * [-1269.508] (-1266.939) (-1282.069) (-1277.546) -- 0:01:43
503500 -- (-1269.336) (-1289.096) [-1272.806] (-1278.614) * (-1280.114) [-1277.887] (-1275.457) (-1276.538) -- 0:01:43
504000 -- (-1276.630) (-1275.680) (-1283.799) [-1272.936] * (-1276.456) [-1282.929] (-1280.259) (-1278.404) -- 0:01:43
504500 -- (-1278.631) (-1290.106) (-1279.621) [-1274.038] * (-1286.555) (-1283.221) [-1273.560] (-1291.809) -- 0:01:43
505000 -- (-1275.421) (-1288.995) (-1279.218) [-1267.400] * (-1276.241) (-1273.590) [-1276.698] (-1278.981) -- 0:01:42
Average standard deviation of split frequencies: 0.004801
505500 -- (-1268.283) (-1294.512) [-1275.067] (-1281.978) * (-1268.529) (-1275.485) (-1278.311) [-1278.836] -- 0:01:42
506000 -- [-1267.593] (-1278.724) (-1275.633) (-1286.562) * (-1278.392) [-1276.054] (-1276.218) (-1291.508) -- 0:01:42
506500 -- [-1269.628] (-1272.583) (-1270.335) (-1279.980) * (-1278.618) (-1274.385) (-1295.110) [-1280.856] -- 0:01:42
507000 -- [-1269.692] (-1277.269) (-1267.589) (-1286.815) * (-1282.126) [-1265.602] (-1282.860) (-1277.496) -- 0:01:43
507500 -- [-1273.248] (-1269.857) (-1269.494) (-1286.262) * (-1272.327) (-1280.037) [-1270.475] (-1284.368) -- 0:01:42
508000 -- (-1272.106) [-1279.870] (-1284.458) (-1283.282) * (-1277.856) [-1268.009] (-1272.257) (-1275.288) -- 0:01:42
508500 -- (-1272.587) (-1278.699) (-1281.396) [-1275.069] * (-1270.205) [-1272.829] (-1277.621) (-1280.548) -- 0:01:42
509000 -- (-1268.330) (-1271.648) [-1269.611] (-1274.352) * (-1274.635) (-1278.421) (-1278.397) [-1273.791] -- 0:01:42
509500 -- (-1274.771) (-1276.109) (-1276.950) [-1276.061] * (-1285.983) (-1273.393) [-1269.890] (-1279.122) -- 0:01:42
510000 -- (-1282.612) (-1288.576) (-1273.520) [-1271.534] * (-1276.653) [-1271.991] (-1278.351) (-1277.384) -- 0:01:41
Average standard deviation of split frequencies: 0.004474
510500 -- [-1281.270] (-1277.117) (-1277.593) (-1272.029) * (-1269.535) (-1273.967) (-1286.289) [-1270.570] -- 0:01:41
511000 -- (-1271.389) [-1267.582] (-1275.538) (-1277.380) * [-1276.902] (-1283.434) (-1274.147) (-1275.447) -- 0:01:41
511500 -- (-1282.630) [-1278.688] (-1277.719) (-1273.823) * (-1276.501) (-1282.008) [-1279.575] (-1274.887) -- 0:01:41
512000 -- [-1281.967] (-1280.374) (-1271.527) (-1272.901) * [-1277.670] (-1271.835) (-1281.198) (-1276.484) -- 0:01:41
512500 -- (-1278.325) [-1274.181] (-1277.036) (-1280.341) * (-1285.025) [-1265.364] (-1269.184) (-1274.672) -- 0:01:41
513000 -- (-1282.883) (-1275.994) [-1274.372] (-1277.298) * (-1271.375) (-1265.523) [-1269.041] (-1283.547) -- 0:01:41
513500 -- [-1272.806] (-1284.377) (-1269.842) (-1274.888) * (-1282.753) (-1274.950) [-1273.168] (-1273.366) -- 0:01:41
514000 -- (-1276.810) (-1288.742) [-1269.341] (-1275.176) * [-1281.777] (-1277.069) (-1274.818) (-1279.010) -- 0:01:41
514500 -- (-1272.049) [-1280.332] (-1291.468) (-1286.408) * (-1278.129) (-1277.518) (-1270.886) [-1279.337] -- 0:01:40
515000 -- (-1286.618) [-1276.449] (-1287.864) (-1275.025) * (-1275.668) (-1281.223) (-1271.858) [-1274.305] -- 0:01:40
Average standard deviation of split frequencies: 0.005200
515500 -- (-1266.788) [-1275.672] (-1278.357) (-1269.780) * (-1270.115) (-1281.846) [-1281.036] (-1286.022) -- 0:01:40
516000 -- (-1281.583) (-1279.901) (-1273.880) [-1272.305] * (-1289.022) (-1282.346) [-1278.872] (-1274.338) -- 0:01:40
516500 -- (-1276.074) (-1281.756) [-1270.761] (-1276.326) * (-1277.765) (-1279.446) (-1281.044) [-1269.358] -- 0:01:41
517000 -- [-1271.652] (-1290.525) (-1276.779) (-1278.585) * (-1275.085) (-1278.485) (-1271.329) [-1270.142] -- 0:01:40
517500 -- (-1285.178) (-1295.579) [-1270.929] (-1283.118) * (-1274.752) (-1274.064) (-1277.349) [-1271.568] -- 0:01:40
518000 -- (-1275.553) (-1289.883) (-1273.619) [-1270.529] * (-1279.086) (-1273.748) (-1286.680) [-1270.971] -- 0:01:40
518500 -- (-1282.314) (-1272.491) [-1271.980] (-1276.114) * (-1269.314) (-1280.262) [-1271.112] (-1276.676) -- 0:01:40
519000 -- [-1275.007] (-1287.222) (-1270.360) (-1291.897) * (-1271.533) (-1285.175) [-1272.273] (-1279.314) -- 0:01:40
519500 -- (-1280.136) (-1287.921) [-1272.594] (-1277.395) * [-1275.131] (-1273.811) (-1273.193) (-1287.168) -- 0:01:39
520000 -- [-1282.347] (-1279.959) (-1281.442) (-1277.320) * (-1280.147) [-1275.364] (-1283.328) (-1284.351) -- 0:01:39
Average standard deviation of split frequencies: 0.006129
520500 -- (-1275.341) (-1288.891) (-1281.206) [-1272.952] * (-1278.217) [-1268.288] (-1287.695) (-1271.140) -- 0:01:39
521000 -- [-1271.156] (-1311.132) (-1280.529) (-1275.057) * (-1278.084) (-1285.385) (-1270.516) [-1279.060] -- 0:01:39
521500 -- (-1277.579) (-1285.824) [-1280.004] (-1278.140) * (-1272.551) [-1281.067] (-1280.859) (-1292.368) -- 0:01:40
522000 -- (-1277.337) (-1280.941) (-1273.656) [-1272.754] * (-1276.974) (-1278.070) (-1274.562) [-1272.561] -- 0:01:39
522500 -- [-1276.098] (-1294.316) (-1274.578) (-1279.807) * [-1272.290] (-1282.198) (-1270.219) (-1279.515) -- 0:01:39
523000 -- (-1272.030) (-1286.248) [-1275.502] (-1281.735) * (-1278.619) [-1278.221] (-1277.438) (-1266.861) -- 0:01:39
523500 -- (-1283.427) (-1293.750) [-1275.790] (-1281.875) * (-1282.354) (-1285.492) [-1271.336] (-1284.188) -- 0:01:39
524000 -- (-1280.118) (-1279.297) [-1270.046] (-1271.500) * [-1272.395] (-1272.827) (-1281.992) (-1282.797) -- 0:01:39
524500 -- (-1281.380) (-1282.773) (-1286.041) [-1272.957] * (-1278.128) (-1279.654) [-1277.701] (-1271.939) -- 0:01:38
525000 -- (-1276.903) (-1276.765) (-1271.528) [-1268.312] * (-1277.067) [-1270.982] (-1281.497) (-1283.742) -- 0:01:38
Average standard deviation of split frequencies: 0.006136
525500 -- (-1271.315) (-1280.540) (-1277.281) [-1275.865] * [-1268.385] (-1278.252) (-1278.547) (-1275.154) -- 0:01:38
526000 -- (-1275.462) (-1283.608) (-1277.847) [-1273.657] * (-1274.776) (-1277.002) (-1277.237) [-1276.008] -- 0:01:38
526500 -- (-1280.930) (-1272.141) (-1273.703) [-1269.363] * [-1273.745] (-1289.943) (-1276.234) (-1275.840) -- 0:01:38
527000 -- (-1287.428) (-1280.391) (-1278.771) [-1270.479] * (-1271.504) (-1293.339) [-1276.496] (-1275.134) -- 0:01:38
527500 -- [-1274.427] (-1297.624) (-1280.886) (-1267.522) * (-1269.885) [-1275.041] (-1282.147) (-1272.993) -- 0:01:38
528000 -- (-1272.645) (-1279.267) (-1280.465) [-1274.130] * (-1275.868) [-1275.629] (-1290.998) (-1277.603) -- 0:01:38
528500 -- (-1282.430) [-1281.164] (-1286.548) (-1279.185) * (-1275.779) [-1277.972] (-1281.537) (-1267.287) -- 0:01:38
529000 -- (-1278.267) (-1272.949) [-1276.483] (-1288.588) * (-1272.363) (-1277.796) (-1275.951) [-1269.339] -- 0:01:37
529500 -- (-1270.534) [-1270.961] (-1272.854) (-1269.039) * (-1277.220) (-1286.619) (-1280.925) [-1272.234] -- 0:01:37
530000 -- (-1283.580) [-1277.393] (-1275.326) (-1276.195) * [-1267.640] (-1272.352) (-1288.079) (-1278.061) -- 0:01:37
Average standard deviation of split frequencies: 0.005603
530500 -- (-1281.718) [-1272.529] (-1272.701) (-1288.568) * (-1272.825) (-1273.237) (-1284.283) [-1275.585] -- 0:01:37
531000 -- (-1285.906) (-1276.548) [-1279.045] (-1278.751) * (-1282.648) [-1278.226] (-1290.782) (-1279.757) -- 0:01:38
531500 -- (-1284.351) (-1277.432) [-1276.857] (-1288.965) * (-1276.389) (-1277.035) (-1292.367) [-1267.956] -- 0:01:37
532000 -- (-1284.572) (-1266.889) [-1272.896] (-1273.622) * [-1277.015] (-1278.401) (-1283.039) (-1273.472) -- 0:01:37
532500 -- [-1275.894] (-1272.043) (-1268.226) (-1285.953) * (-1288.355) (-1278.669) [-1270.673] (-1266.752) -- 0:01:37
533000 -- (-1274.949) [-1276.349] (-1276.862) (-1277.425) * (-1283.582) [-1275.126] (-1285.649) (-1278.246) -- 0:01:37
533500 -- [-1268.054] (-1277.186) (-1269.650) (-1283.191) * (-1275.809) (-1293.262) [-1278.045] (-1275.471) -- 0:01:37
534000 -- (-1276.987) (-1273.663) [-1275.477] (-1272.352) * [-1272.169] (-1279.403) (-1290.031) (-1285.508) -- 0:01:36
534500 -- (-1273.986) (-1273.839) [-1271.903] (-1270.699) * (-1281.268) (-1279.785) [-1270.833] (-1270.494) -- 0:01:36
535000 -- (-1270.356) [-1275.959] (-1275.280) (-1270.059) * (-1276.310) (-1283.604) (-1281.145) [-1269.792] -- 0:01:36
Average standard deviation of split frequencies: 0.006089
535500 -- (-1273.741) (-1279.484) (-1285.403) [-1268.264] * [-1271.858] (-1284.721) (-1278.396) (-1276.903) -- 0:01:36
536000 -- (-1274.173) [-1276.161] (-1279.946) (-1271.904) * (-1281.134) (-1276.172) [-1270.932] (-1271.781) -- 0:01:36
536500 -- (-1280.570) (-1273.210) [-1272.462] (-1285.905) * (-1274.484) [-1279.845] (-1280.690) (-1284.341) -- 0:01:36
537000 -- (-1271.055) (-1282.097) (-1271.406) [-1270.563] * (-1277.997) [-1276.582] (-1275.366) (-1283.054) -- 0:01:36
537500 -- (-1275.472) [-1271.686] (-1267.284) (-1277.114) * (-1277.316) [-1271.025] (-1285.731) (-1278.004) -- 0:01:36
538000 -- (-1281.488) (-1277.125) (-1281.969) [-1272.625] * (-1270.075) [-1270.994] (-1277.931) (-1275.980) -- 0:01:36
538500 -- (-1281.821) (-1274.889) [-1278.303] (-1284.057) * (-1276.601) (-1269.675) [-1273.759] (-1268.868) -- 0:01:35
539000 -- (-1287.179) (-1275.577) [-1275.041] (-1278.025) * [-1275.788] (-1277.216) (-1283.732) (-1275.923) -- 0:01:35
539500 -- [-1276.010] (-1271.153) (-1279.422) (-1277.031) * [-1266.682] (-1279.288) (-1285.846) (-1273.362) -- 0:01:35
540000 -- (-1280.874) [-1277.022] (-1275.618) (-1277.542) * [-1277.599] (-1286.840) (-1285.114) (-1283.239) -- 0:01:35
Average standard deviation of split frequencies: 0.005835
540500 -- [-1266.910] (-1273.334) (-1276.987) (-1275.764) * (-1275.018) (-1288.340) (-1283.188) [-1277.117] -- 0:01:35
541000 -- [-1268.941] (-1271.462) (-1272.452) (-1282.558) * (-1289.538) (-1286.901) [-1272.434] (-1282.152) -- 0:01:35
541500 -- (-1266.090) (-1275.287) [-1271.701] (-1276.907) * (-1289.140) (-1289.474) (-1278.707) [-1271.596] -- 0:01:35
542000 -- (-1275.479) [-1272.787] (-1278.428) (-1289.084) * (-1285.876) (-1276.772) (-1275.497) [-1277.082] -- 0:01:35
542500 -- (-1272.588) (-1277.770) (-1279.685) [-1275.130] * (-1284.717) (-1277.144) (-1286.546) [-1271.268] -- 0:01:35
543000 -- (-1292.721) (-1285.131) [-1280.329] (-1273.064) * (-1281.704) (-1278.270) (-1277.573) [-1274.997] -- 0:01:35
543500 -- [-1276.817] (-1283.961) (-1277.787) (-1282.809) * (-1284.896) [-1272.011] (-1283.002) (-1273.886) -- 0:01:34
544000 -- (-1274.092) (-1275.344) (-1273.903) [-1272.365] * (-1279.561) (-1276.966) [-1280.792] (-1279.583) -- 0:01:34
544500 -- (-1275.592) (-1283.436) (-1276.609) [-1280.974] * (-1282.436) (-1279.779) [-1269.532] (-1283.515) -- 0:01:34
545000 -- (-1279.334) (-1273.389) (-1270.437) [-1277.679] * (-1279.338) [-1280.445] (-1266.309) (-1271.327) -- 0:01:34
Average standard deviation of split frequencies: 0.005247
545500 -- (-1275.934) (-1283.606) (-1272.770) [-1279.946] * (-1282.742) [-1280.429] (-1285.225) (-1271.947) -- 0:01:34
546000 -- (-1282.406) (-1272.009) (-1274.676) [-1280.184] * [-1280.547] (-1273.050) (-1285.743) (-1274.861) -- 0:01:34
546500 -- (-1277.197) (-1283.459) (-1280.272) [-1276.553] * (-1289.551) (-1279.226) (-1280.221) [-1271.617] -- 0:01:34
547000 -- [-1268.792] (-1280.069) (-1287.264) (-1270.961) * (-1280.626) [-1267.753] (-1274.682) (-1276.419) -- 0:01:34
547500 -- (-1277.571) (-1292.762) (-1279.352) [-1269.105] * (-1281.385) (-1273.568) [-1274.901] (-1284.648) -- 0:01:34
548000 -- (-1280.923) (-1274.030) [-1284.165] (-1273.304) * [-1277.005] (-1274.553) (-1286.208) (-1270.111) -- 0:01:34
548500 -- [-1274.393] (-1280.023) (-1280.804) (-1268.571) * (-1275.663) (-1274.852) [-1282.443] (-1278.246) -- 0:01:33
549000 -- [-1270.399] (-1286.798) (-1277.138) (-1266.629) * (-1279.996) [-1274.561] (-1284.097) (-1281.423) -- 0:01:33
549500 -- (-1278.834) (-1277.054) (-1278.015) [-1270.761] * (-1274.787) [-1281.182] (-1286.296) (-1283.201) -- 0:01:33
550000 -- (-1278.160) (-1275.767) [-1282.134] (-1285.973) * (-1278.311) (-1278.459) [-1270.261] (-1281.045) -- 0:01:33
Average standard deviation of split frequencies: 0.004544
550500 -- (-1277.964) [-1274.356] (-1278.621) (-1273.221) * (-1274.469) (-1277.025) (-1273.069) [-1280.846] -- 0:01:33
551000 -- (-1285.299) (-1272.165) (-1271.204) [-1279.546] * (-1285.266) (-1281.337) [-1275.585] (-1278.009) -- 0:01:33
551500 -- (-1275.001) [-1283.103] (-1270.394) (-1276.695) * (-1282.792) [-1277.608] (-1276.932) (-1277.543) -- 0:01:33
552000 -- (-1284.128) (-1295.074) (-1282.813) [-1274.706] * (-1293.317) (-1272.996) (-1282.607) [-1276.651] -- 0:01:33
552500 -- (-1274.889) [-1274.151] (-1271.174) (-1279.506) * (-1288.235) (-1268.363) [-1276.245] (-1277.861) -- 0:01:33
553000 -- (-1280.729) (-1283.553) [-1276.836] (-1286.852) * (-1275.932) [-1280.604] (-1290.709) (-1271.540) -- 0:01:32
553500 -- (-1278.826) (-1276.675) [-1278.790] (-1286.566) * (-1273.246) (-1272.586) (-1271.478) [-1270.545] -- 0:01:32
554000 -- [-1272.350] (-1274.182) (-1273.040) (-1278.183) * (-1279.176) [-1271.188] (-1278.987) (-1286.584) -- 0:01:32
554500 -- (-1280.318) (-1286.378) [-1272.299] (-1280.607) * (-1272.976) [-1273.769] (-1275.910) (-1282.500) -- 0:01:32
555000 -- (-1275.000) (-1280.361) (-1281.771) [-1281.219] * (-1277.260) (-1278.232) (-1272.899) [-1273.492] -- 0:01:33
Average standard deviation of split frequencies: 0.005022
555500 -- (-1273.398) [-1278.004] (-1280.121) (-1278.235) * (-1276.436) [-1271.668] (-1288.506) (-1272.296) -- 0:01:32
556000 -- (-1284.758) (-1283.826) (-1283.845) [-1274.038] * (-1272.450) [-1294.542] (-1275.907) (-1271.078) -- 0:01:32
556500 -- (-1280.950) (-1283.976) [-1274.418] (-1280.090) * (-1274.829) [-1284.440] (-1277.891) (-1275.515) -- 0:01:32
557000 -- (-1280.580) (-1282.695) [-1280.037] (-1274.653) * (-1283.111) (-1282.786) (-1274.046) [-1277.674] -- 0:01:32
557500 -- (-1281.935) (-1275.924) [-1282.215] (-1284.888) * (-1276.991) (-1279.846) (-1277.780) [-1269.801] -- 0:01:32
558000 -- [-1279.242] (-1276.133) (-1281.554) (-1278.236) * [-1267.829] (-1279.207) (-1289.069) (-1282.825) -- 0:01:31
558500 -- (-1289.503) (-1282.461) [-1279.887] (-1272.642) * (-1275.842) [-1269.413] (-1275.967) (-1279.743) -- 0:01:31
559000 -- (-1274.945) (-1280.855) (-1283.778) [-1273.939] * (-1278.677) (-1275.723) [-1281.631] (-1263.517) -- 0:01:31
559500 -- (-1284.807) [-1275.277] (-1276.157) (-1277.253) * (-1276.736) [-1276.830] (-1281.890) (-1270.354) -- 0:01:31
560000 -- (-1270.097) (-1278.623) (-1281.302) [-1270.901] * (-1275.063) (-1275.022) (-1276.121) [-1273.628] -- 0:01:31
Average standard deviation of split frequencies: 0.005239
560500 -- [-1274.908] (-1277.414) (-1272.683) (-1273.152) * [-1271.504] (-1275.128) (-1271.287) (-1272.263) -- 0:01:31
561000 -- [-1296.014] (-1273.428) (-1270.898) (-1287.708) * [-1274.191] (-1282.383) (-1274.065) (-1277.809) -- 0:01:31
561500 -- [-1278.990] (-1272.647) (-1284.787) (-1283.815) * (-1279.720) [-1275.851] (-1275.277) (-1280.856) -- 0:01:31
562000 -- (-1288.808) [-1271.831] (-1275.453) (-1283.838) * (-1276.273) (-1282.527) [-1270.539] (-1284.370) -- 0:01:31
562500 -- (-1276.093) (-1274.553) (-1284.941) [-1275.814] * (-1273.745) (-1287.587) (-1273.110) [-1273.983] -- 0:01:31
563000 -- (-1291.270) (-1272.352) (-1280.845) [-1277.695] * (-1270.112) (-1272.635) (-1281.871) [-1271.590] -- 0:01:30
563500 -- (-1279.179) (-1275.773) (-1279.524) [-1277.047] * (-1284.309) [-1270.011] (-1277.580) (-1270.329) -- 0:01:30
564000 -- (-1285.004) (-1270.908) [-1278.144] (-1277.886) * [-1278.798] (-1282.291) (-1279.241) (-1280.608) -- 0:01:30
564500 -- (-1285.280) (-1271.552) (-1271.168) [-1271.263] * (-1274.670) (-1283.821) (-1284.085) [-1269.945] -- 0:01:30
565000 -- (-1277.761) (-1273.261) [-1274.243] (-1280.482) * [-1277.274] (-1278.932) (-1288.180) (-1288.228) -- 0:01:30
Average standard deviation of split frequencies: 0.004933
565500 -- (-1281.292) [-1271.592] (-1274.612) (-1279.987) * (-1278.782) (-1284.227) [-1274.541] (-1275.229) -- 0:01:30
566000 -- (-1298.698) (-1270.637) (-1273.173) [-1271.975] * (-1283.496) (-1283.260) (-1273.111) [-1272.303] -- 0:01:30
566500 -- (-1282.967) [-1273.120] (-1284.799) (-1274.200) * (-1278.686) (-1280.590) (-1282.389) [-1274.285] -- 0:01:30
567000 -- (-1267.988) [-1272.021] (-1282.874) (-1288.444) * [-1272.996] (-1274.775) (-1272.064) (-1280.037) -- 0:01:30
567500 -- (-1294.237) (-1267.933) [-1272.605] (-1273.279) * (-1284.161) (-1282.769) (-1284.051) [-1277.366] -- 0:01:29
568000 -- (-1279.616) [-1272.986] (-1282.023) (-1280.076) * (-1276.899) (-1282.753) [-1276.920] (-1275.080) -- 0:01:29
568500 -- (-1279.078) (-1275.782) [-1270.337] (-1280.134) * (-1276.809) [-1271.743] (-1269.708) (-1280.771) -- 0:01:29
569000 -- (-1274.325) (-1269.248) (-1270.794) [-1273.730] * [-1274.896] (-1279.347) (-1267.905) (-1271.782) -- 0:01:29
569500 -- (-1283.446) (-1271.832) [-1268.127] (-1279.665) * (-1278.343) (-1282.603) (-1280.839) [-1275.017] -- 0:01:29
570000 -- (-1278.252) (-1281.936) (-1273.322) [-1285.720] * (-1268.758) (-1278.870) (-1269.460) [-1274.438] -- 0:01:29
Average standard deviation of split frequencies: 0.005274
570500 -- (-1283.771) (-1282.471) [-1275.126] (-1271.046) * (-1270.689) [-1282.750] (-1284.712) (-1276.749) -- 0:01:29
571000 -- (-1280.413) [-1273.570] (-1284.623) (-1284.204) * (-1272.672) (-1277.064) (-1285.339) [-1274.734] -- 0:01:29
571500 -- [-1275.196] (-1282.572) (-1276.169) (-1273.819) * [-1270.528] (-1280.939) (-1274.464) (-1275.294) -- 0:01:29
572000 -- (-1280.501) [-1269.013] (-1276.143) (-1274.556) * [-1278.975] (-1280.098) (-1275.845) (-1277.151) -- 0:01:29
572500 -- (-1280.545) (-1277.132) [-1268.342] (-1274.839) * (-1287.955) (-1273.504) (-1277.111) [-1270.615] -- 0:01:28
573000 -- (-1278.714) [-1280.463] (-1277.015) (-1275.336) * (-1282.804) [-1274.886] (-1275.429) (-1266.037) -- 0:01:28
573500 -- (-1278.371) [-1274.047] (-1271.473) (-1276.500) * (-1277.957) (-1282.388) [-1280.170] (-1268.236) -- 0:01:28
574000 -- (-1284.002) (-1279.022) (-1288.911) [-1271.007] * (-1284.208) (-1285.008) (-1279.117) [-1269.550] -- 0:01:28
574500 -- [-1269.713] (-1274.908) (-1278.020) (-1274.905) * (-1282.897) (-1280.233) [-1271.167] (-1271.764) -- 0:01:28
575000 -- (-1275.464) (-1276.395) (-1286.121) [-1266.308] * (-1271.952) (-1279.327) (-1278.558) [-1269.967] -- 0:01:28
Average standard deviation of split frequencies: 0.005036
575500 -- [-1272.341] (-1279.802) (-1294.633) (-1275.703) * [-1275.331] (-1286.142) (-1279.919) (-1275.384) -- 0:01:28
576000 -- (-1277.903) [-1270.032] (-1284.240) (-1274.733) * [-1275.502] (-1278.918) (-1275.398) (-1277.055) -- 0:01:28
576500 -- (-1272.082) (-1278.339) (-1277.078) [-1271.984] * [-1278.987] (-1278.581) (-1283.262) (-1280.049) -- 0:01:28
577000 -- (-1273.902) (-1282.368) [-1278.544] (-1275.128) * (-1280.889) (-1279.498) (-1274.794) [-1279.586] -- 0:01:27
577500 -- (-1270.403) [-1272.091] (-1286.390) (-1270.089) * (-1283.708) [-1283.317] (-1280.801) (-1278.350) -- 0:01:27
578000 -- [-1286.654] (-1270.054) (-1285.380) (-1279.653) * [-1281.594] (-1277.401) (-1287.461) (-1284.977) -- 0:01:27
578500 -- (-1289.349) [-1265.920] (-1276.315) (-1278.637) * [-1273.934] (-1276.225) (-1280.353) (-1285.210) -- 0:01:27
579000 -- (-1275.703) (-1264.934) [-1277.991] (-1280.565) * (-1280.670) (-1277.744) [-1278.023] (-1283.674) -- 0:01:27
579500 -- (-1279.836) [-1281.754] (-1279.235) (-1284.404) * [-1265.856] (-1279.170) (-1280.338) (-1278.812) -- 0:01:27
580000 -- (-1276.103) [-1273.127] (-1276.681) (-1274.262) * (-1278.722) (-1279.178) [-1275.766] (-1273.044) -- 0:01:27
Average standard deviation of split frequencies: 0.005683
580500 -- (-1273.601) [-1277.469] (-1280.904) (-1282.887) * (-1292.780) (-1279.762) (-1275.700) [-1269.803] -- 0:01:27
581000 -- (-1277.275) [-1277.686] (-1280.980) (-1288.128) * (-1273.956) (-1283.532) (-1285.001) [-1269.102] -- 0:01:27
581500 -- [-1279.535] (-1267.661) (-1283.443) (-1281.176) * (-1282.322) (-1285.115) [-1270.252] (-1281.494) -- 0:01:27
582000 -- (-1278.688) [-1271.187] (-1285.006) (-1282.313) * (-1272.879) (-1281.152) (-1277.546) [-1271.268] -- 0:01:26
582500 -- [-1278.462] (-1275.931) (-1288.451) (-1275.400) * (-1302.711) (-1278.313) (-1270.988) [-1285.188] -- 0:01:26
583000 -- (-1285.346) [-1271.306] (-1285.114) (-1280.684) * (-1291.187) [-1278.164] (-1282.457) (-1282.756) -- 0:01:26
583500 -- (-1277.605) (-1281.735) (-1286.871) [-1269.353] * (-1276.097) [-1278.582] (-1274.486) (-1275.486) -- 0:01:26
584000 -- (-1284.163) (-1274.273) (-1292.459) [-1274.063] * [-1269.098] (-1280.258) (-1286.448) (-1276.642) -- 0:01:26
584500 -- (-1283.598) (-1273.133) (-1277.187) [-1272.951] * (-1275.763) (-1275.500) [-1276.318] (-1274.126) -- 0:01:26
585000 -- [-1283.607] (-1275.497) (-1285.908) (-1279.298) * [-1272.339] (-1282.605) (-1287.890) (-1282.794) -- 0:01:26
Average standard deviation of split frequencies: 0.005817
585500 -- (-1279.505) (-1279.185) (-1287.774) [-1270.791] * (-1283.035) (-1273.530) (-1284.293) [-1278.925] -- 0:01:26
586000 -- [-1277.805] (-1282.001) (-1285.126) (-1280.833) * [-1276.152] (-1276.259) (-1277.710) (-1275.268) -- 0:01:26
586500 -- [-1269.913] (-1273.876) (-1290.028) (-1275.786) * (-1277.782) (-1270.398) [-1274.364] (-1286.587) -- 0:01:26
587000 -- (-1278.768) (-1276.415) [-1278.103] (-1287.683) * (-1275.243) [-1275.104] (-1268.344) (-1276.324) -- 0:01:25
587500 -- (-1265.766) [-1273.417] (-1284.249) (-1281.187) * (-1275.175) [-1273.721] (-1281.783) (-1282.742) -- 0:01:25
588000 -- (-1270.384) [-1279.170] (-1292.127) (-1287.488) * (-1289.473) [-1272.021] (-1275.330) (-1271.347) -- 0:01:25
588500 -- [-1277.912] (-1277.288) (-1286.692) (-1296.462) * (-1289.430) (-1279.730) (-1274.631) [-1276.255] -- 0:01:25
589000 -- [-1279.281] (-1275.207) (-1281.890) (-1275.863) * (-1284.562) [-1268.629] (-1285.847) (-1275.535) -- 0:01:25
589500 -- (-1270.087) (-1276.689) [-1274.901] (-1277.361) * (-1280.624) [-1271.854] (-1283.798) (-1279.039) -- 0:01:25
590000 -- (-1281.740) (-1278.541) (-1278.428) [-1277.998] * (-1285.682) [-1272.482] (-1284.679) (-1277.285) -- 0:01:25
Average standard deviation of split frequencies: 0.005955
590500 -- [-1269.505] (-1280.475) (-1270.769) (-1271.727) * (-1283.667) (-1274.954) (-1273.597) [-1273.920] -- 0:01:25
591000 -- (-1273.517) (-1273.156) (-1277.605) [-1281.957] * (-1275.911) (-1281.224) [-1278.871] (-1278.377) -- 0:01:25
591500 -- (-1273.508) [-1285.068] (-1275.876) (-1282.045) * (-1282.395) (-1272.420) (-1286.448) [-1277.531] -- 0:01:24
592000 -- (-1267.507) [-1274.765] (-1271.474) (-1274.106) * [-1270.585] (-1281.539) (-1277.423) (-1282.133) -- 0:01:24
592500 -- (-1268.438) (-1279.997) [-1274.627] (-1288.964) * (-1280.832) (-1282.847) (-1277.373) [-1278.407] -- 0:01:24
593000 -- (-1278.659) (-1277.704) [-1273.606] (-1278.158) * [-1274.839] (-1282.624) (-1288.081) (-1274.954) -- 0:01:24
593500 -- (-1277.964) (-1274.979) [-1277.810] (-1286.449) * (-1283.635) [-1271.993] (-1281.933) (-1282.106) -- 0:01:24
594000 -- [-1269.032] (-1278.862) (-1285.362) (-1278.893) * (-1294.913) (-1272.738) (-1275.322) [-1278.894] -- 0:01:24
594500 -- [-1279.407] (-1282.610) (-1284.273) (-1277.725) * (-1274.556) (-1274.943) (-1288.777) [-1272.843] -- 0:01:24
595000 -- (-1271.394) (-1281.184) (-1275.681) [-1272.664] * [-1271.527] (-1275.129) (-1287.198) (-1279.920) -- 0:01:24
Average standard deviation of split frequencies: 0.006023
595500 -- (-1273.954) (-1281.829) [-1265.855] (-1269.819) * (-1267.467) (-1279.737) (-1273.224) [-1268.213] -- 0:01:24
596000 -- (-1273.033) [-1274.635] (-1281.718) (-1269.605) * (-1281.621) (-1285.832) (-1280.076) [-1273.602] -- 0:01:24
596500 -- [-1267.069] (-1287.511) (-1275.034) (-1277.724) * (-1279.508) [-1278.836] (-1276.683) (-1310.233) -- 0:01:23
597000 -- (-1283.371) [-1271.919] (-1287.294) (-1275.416) * (-1271.802) (-1277.475) (-1276.762) [-1279.429] -- 0:01:23
597500 -- (-1281.655) (-1269.889) (-1277.702) [-1280.310] * (-1276.836) (-1288.967) (-1272.184) [-1275.877] -- 0:01:23
598000 -- (-1275.935) [-1265.901] (-1283.405) (-1277.260) * (-1265.482) (-1277.158) (-1281.555) [-1278.491] -- 0:01:23
598500 -- [-1272.555] (-1279.643) (-1291.692) (-1291.106) * (-1275.867) (-1277.392) [-1273.999] (-1278.743) -- 0:01:23
599000 -- [-1274.188] (-1271.459) (-1273.317) (-1283.290) * (-1277.363) [-1273.257] (-1273.935) (-1290.929) -- 0:01:23
599500 -- (-1272.407) (-1286.628) (-1285.248) [-1278.140] * (-1291.419) [-1275.458] (-1285.011) (-1280.119) -- 0:01:23
600000 -- (-1280.027) [-1271.419] (-1272.550) (-1294.787) * (-1283.402) [-1272.281] (-1283.502) (-1280.347) -- 0:01:23
Average standard deviation of split frequencies: 0.006158
600500 -- (-1278.535) (-1281.525) (-1279.015) [-1273.243] * (-1274.615) [-1272.941] (-1284.368) (-1285.868) -- 0:01:23
601000 -- (-1268.982) (-1278.360) (-1282.544) [-1278.216] * (-1269.992) (-1278.848) [-1271.085] (-1273.682) -- 0:01:22
601500 -- [-1271.921] (-1269.204) (-1282.610) (-1292.284) * (-1272.640) (-1271.695) [-1284.640] (-1282.623) -- 0:01:22
602000 -- [-1271.073] (-1283.320) (-1286.023) (-1275.925) * (-1269.139) (-1275.436) [-1276.129] (-1286.212) -- 0:01:22
602500 -- [-1272.327] (-1279.060) (-1280.741) (-1271.231) * [-1271.925] (-1272.682) (-1278.134) (-1286.883) -- 0:01:22
603000 -- (-1274.904) (-1288.486) [-1274.533] (-1267.658) * [-1281.146] (-1290.833) (-1274.904) (-1285.811) -- 0:01:22
603500 -- (-1285.391) (-1277.253) [-1275.652] (-1284.947) * (-1280.091) (-1282.096) (-1273.068) [-1269.629] -- 0:01:22
604000 -- (-1274.718) (-1282.040) (-1274.917) [-1275.530] * [-1273.298] (-1278.328) (-1279.831) (-1276.250) -- 0:01:22
604500 -- [-1276.285] (-1286.336) (-1274.629) (-1281.245) * [-1272.130] (-1285.123) (-1281.638) (-1278.487) -- 0:01:22
605000 -- (-1277.465) (-1277.525) [-1265.542] (-1279.851) * (-1278.329) (-1288.384) (-1278.301) [-1280.719] -- 0:01:22
Average standard deviation of split frequencies: 0.005864
605500 -- (-1288.151) [-1272.915] (-1269.664) (-1276.611) * (-1275.291) (-1276.238) [-1275.524] (-1273.723) -- 0:01:22
606000 -- (-1280.732) [-1267.185] (-1271.188) (-1281.226) * (-1272.724) (-1286.705) (-1279.417) [-1269.840] -- 0:01:21
606500 -- (-1277.840) (-1270.284) [-1279.043] (-1287.294) * (-1272.225) [-1281.011] (-1276.549) (-1274.467) -- 0:01:21
607000 -- (-1270.727) (-1276.947) [-1273.673] (-1273.245) * (-1287.172) (-1285.074) [-1269.534] (-1275.129) -- 0:01:21
607500 -- (-1281.919) (-1287.719) (-1272.631) [-1274.736] * (-1275.059) (-1280.600) [-1278.162] (-1282.704) -- 0:01:21
608000 -- [-1276.983] (-1276.861) (-1275.586) (-1279.724) * (-1277.197) [-1267.882] (-1295.268) (-1276.010) -- 0:01:21
608500 -- (-1289.363) (-1272.806) (-1274.999) [-1278.835] * (-1275.811) (-1275.082) (-1297.605) [-1273.421] -- 0:01:21
609000 -- (-1277.630) (-1275.962) (-1277.649) [-1278.564] * [-1279.148] (-1282.582) (-1292.250) (-1283.686) -- 0:01:21
609500 -- (-1279.825) [-1273.027] (-1274.113) (-1278.968) * (-1282.353) (-1277.939) (-1278.008) [-1272.590] -- 0:01:21
610000 -- (-1277.686) (-1270.670) [-1276.093] (-1276.091) * (-1276.024) (-1284.483) (-1273.546) [-1278.539] -- 0:01:21
Average standard deviation of split frequencies: 0.005997
610500 -- [-1266.579] (-1279.018) (-1276.713) (-1273.054) * (-1278.579) [-1277.065] (-1285.444) (-1288.477) -- 0:01:21
611000 -- [-1274.447] (-1278.315) (-1282.213) (-1277.549) * (-1282.214) [-1276.357] (-1278.361) (-1281.665) -- 0:01:20
611500 -- (-1278.161) (-1285.622) (-1280.667) [-1271.078] * (-1272.665) [-1274.015] (-1287.505) (-1287.429) -- 0:01:20
612000 -- (-1282.280) (-1273.151) [-1276.371] (-1290.122) * [-1278.409] (-1270.356) (-1278.214) (-1278.762) -- 0:01:20
612500 -- (-1278.645) (-1279.401) (-1275.822) [-1273.688] * (-1277.297) (-1271.284) [-1282.273] (-1270.131) -- 0:01:20
613000 -- (-1276.832) (-1286.853) [-1276.949] (-1270.927) * (-1273.547) (-1273.582) (-1283.885) [-1284.710] -- 0:01:20
613500 -- (-1273.868) [-1277.903] (-1277.502) (-1272.087) * [-1275.085] (-1275.210) (-1282.112) (-1297.299) -- 0:01:20
614000 -- (-1278.527) [-1268.317] (-1274.407) (-1274.931) * (-1274.000) [-1267.522] (-1280.403) (-1268.755) -- 0:01:20
614500 -- [-1274.167] (-1271.936) (-1278.216) (-1281.135) * (-1274.409) (-1272.012) (-1289.462) [-1273.734] -- 0:01:20
615000 -- (-1277.859) (-1271.854) [-1273.055] (-1272.131) * (-1274.226) [-1266.884] (-1290.473) (-1285.365) -- 0:01:20
Average standard deviation of split frequencies: 0.006240
615500 -- [-1275.759] (-1277.306) (-1266.035) (-1273.993) * (-1268.519) (-1269.859) [-1282.477] (-1274.485) -- 0:01:19
616000 -- (-1277.199) (-1288.225) (-1274.871) [-1269.579] * [-1271.055] (-1270.755) (-1278.509) (-1278.250) -- 0:01:19
616500 -- (-1279.345) (-1281.591) (-1276.190) [-1272.657] * (-1274.807) (-1271.403) (-1283.038) [-1266.028] -- 0:01:19
617000 -- (-1279.131) (-1277.616) (-1279.009) [-1267.771] * (-1285.438) (-1274.753) (-1282.146) [-1269.363] -- 0:01:19
617500 -- [-1270.667] (-1274.873) (-1279.132) (-1273.604) * (-1277.837) (-1273.520) [-1277.006] (-1277.451) -- 0:01:19
618000 -- (-1279.134) (-1278.184) (-1289.653) [-1276.949] * [-1270.396] (-1272.413) (-1276.856) (-1285.623) -- 0:01:19
618500 -- (-1277.050) (-1278.877) (-1277.157) [-1274.983] * (-1273.305) (-1281.007) [-1270.756] (-1275.881) -- 0:01:19
619000 -- (-1277.485) (-1275.858) (-1290.768) [-1279.293] * (-1278.173) (-1272.867) (-1278.000) [-1280.389] -- 0:01:19
619500 -- (-1276.854) (-1277.250) [-1276.989] (-1270.642) * (-1274.657) (-1274.108) (-1271.595) [-1271.802] -- 0:01:19
620000 -- (-1273.927) (-1276.381) (-1272.375) [-1271.717] * (-1280.633) [-1273.444] (-1272.318) (-1280.025) -- 0:01:19
Average standard deviation of split frequencies: 0.006719
620500 -- (-1302.073) (-1278.744) [-1274.589] (-1280.532) * (-1275.452) [-1267.870] (-1282.649) (-1277.608) -- 0:01:18
621000 -- (-1282.576) [-1279.898] (-1279.314) (-1277.972) * (-1266.226) (-1281.275) [-1284.774] (-1288.446) -- 0:01:18
621500 -- (-1284.547) [-1276.598] (-1278.369) (-1276.936) * (-1283.667) [-1280.324] (-1279.851) (-1281.380) -- 0:01:18
622000 -- [-1285.899] (-1282.105) (-1282.971) (-1281.697) * (-1272.603) [-1280.015] (-1273.140) (-1286.451) -- 0:01:18
622500 -- (-1273.304) [-1277.116] (-1277.224) (-1285.886) * [-1269.112] (-1272.615) (-1284.461) (-1278.394) -- 0:01:18
623000 -- [-1273.468] (-1277.448) (-1278.135) (-1282.640) * (-1281.152) (-1277.171) (-1278.696) [-1274.650] -- 0:01:18
623500 -- (-1267.615) (-1288.171) [-1279.872] (-1275.796) * (-1282.035) (-1280.770) [-1270.539] (-1273.304) -- 0:01:18
624000 -- [-1274.979] (-1292.155) (-1276.257) (-1291.513) * (-1281.048) (-1277.630) [-1281.586] (-1274.904) -- 0:01:18
624500 -- (-1280.912) (-1276.511) [-1270.563] (-1270.528) * (-1269.431) (-1274.999) [-1278.841] (-1270.445) -- 0:01:18
625000 -- (-1279.734) (-1277.506) [-1274.407] (-1271.097) * (-1273.497) (-1275.642) (-1282.046) [-1273.546] -- 0:01:18
Average standard deviation of split frequencies: 0.006314
625500 -- (-1287.901) [-1276.993] (-1289.273) (-1290.083) * [-1277.047] (-1274.110) (-1296.113) (-1281.124) -- 0:01:17
626000 -- (-1280.164) [-1273.192] (-1286.215) (-1283.503) * [-1271.160] (-1274.489) (-1281.572) (-1273.626) -- 0:01:17
626500 -- (-1283.128) (-1286.258) (-1290.948) [-1273.745] * [-1271.361] (-1275.830) (-1284.949) (-1272.490) -- 0:01:17
627000 -- (-1278.011) (-1276.299) (-1279.815) [-1273.657] * [-1277.015] (-1280.716) (-1283.050) (-1273.473) -- 0:01:17
627500 -- [-1270.928] (-1281.593) (-1278.230) (-1279.302) * [-1274.794] (-1273.487) (-1284.650) (-1279.508) -- 0:01:17
628000 -- (-1269.136) [-1279.740] (-1274.672) (-1277.665) * [-1278.161] (-1280.935) (-1281.694) (-1270.647) -- 0:01:17
628500 -- (-1270.310) (-1273.274) (-1284.655) [-1267.135] * [-1271.560] (-1268.391) (-1274.424) (-1280.129) -- 0:01:17
629000 -- [-1267.848] (-1285.450) (-1288.939) (-1279.104) * (-1276.369) (-1275.294) [-1274.760] (-1286.780) -- 0:01:17
629500 -- (-1276.776) (-1282.144) (-1275.867) [-1272.431] * (-1274.681) [-1277.663] (-1275.929) (-1275.120) -- 0:01:17
630000 -- (-1276.828) [-1282.766] (-1275.277) (-1284.747) * (-1274.690) [-1279.112] (-1280.172) (-1280.531) -- 0:01:16
Average standard deviation of split frequencies: 0.006095
630500 -- (-1265.117) (-1273.778) [-1277.630] (-1272.559) * (-1275.750) (-1284.828) [-1272.502] (-1284.764) -- 0:01:16
631000 -- [-1273.339] (-1280.228) (-1283.952) (-1278.035) * (-1277.690) (-1275.515) [-1267.928] (-1278.591) -- 0:01:16
631500 -- [-1275.302] (-1278.843) (-1276.913) (-1293.477) * (-1287.407) [-1276.668] (-1272.315) (-1291.022) -- 0:01:16
632000 -- (-1276.551) (-1282.930) [-1273.406] (-1283.761) * (-1279.133) (-1290.745) [-1278.938] (-1280.517) -- 0:01:16
632500 -- (-1270.192) (-1278.276) [-1274.945] (-1285.845) * [-1275.316] (-1286.533) (-1273.265) (-1286.868) -- 0:01:16
633000 -- (-1267.705) (-1282.206) [-1272.108] (-1293.753) * (-1281.775) [-1283.779] (-1276.713) (-1283.691) -- 0:01:16
633500 -- (-1273.522) (-1275.680) [-1272.831] (-1282.236) * (-1275.349) (-1277.133) (-1282.021) [-1265.021] -- 0:01:16
634000 -- [-1273.626] (-1272.077) (-1281.272) (-1285.662) * (-1277.791) (-1280.216) [-1272.561] (-1278.200) -- 0:01:16
634500 -- (-1274.542) [-1281.501] (-1285.908) (-1279.032) * (-1283.901) [-1270.536] (-1282.546) (-1280.894) -- 0:01:16
635000 -- (-1283.279) [-1278.702] (-1285.436) (-1274.629) * [-1284.250] (-1282.471) (-1284.362) (-1278.045) -- 0:01:15
Average standard deviation of split frequencies: 0.006329
635500 -- (-1287.582) [-1268.905] (-1274.129) (-1285.875) * (-1279.027) (-1274.021) (-1284.302) [-1281.022] -- 0:01:15
636000 -- (-1277.403) [-1271.992] (-1275.406) (-1277.670) * (-1290.580) [-1279.683] (-1273.364) (-1282.472) -- 0:01:15
636500 -- (-1278.434) (-1268.542) [-1280.029] (-1279.444) * (-1281.869) (-1282.276) [-1271.844] (-1288.919) -- 0:01:15
637000 -- [-1268.420] (-1282.062) (-1273.891) (-1273.631) * (-1276.044) (-1284.971) (-1280.432) [-1274.613] -- 0:01:15
637500 -- [-1276.529] (-1285.210) (-1284.859) (-1276.131) * (-1275.875) [-1278.954] (-1279.325) (-1286.648) -- 0:01:15
638000 -- (-1277.541) (-1285.212) (-1278.650) [-1271.184] * (-1284.077) (-1288.318) [-1272.282] (-1268.549) -- 0:01:15
638500 -- (-1272.724) [-1276.941] (-1278.057) (-1281.588) * (-1285.388) (-1283.440) [-1269.317] (-1280.713) -- 0:01:15
639000 -- (-1271.438) (-1283.678) [-1278.428] (-1276.384) * (-1287.646) (-1281.897) (-1270.683) [-1268.528] -- 0:01:15
639500 -- (-1294.551) [-1277.143] (-1278.359) (-1276.386) * [-1276.265] (-1276.253) (-1285.598) (-1271.718) -- 0:01:14
640000 -- (-1281.627) (-1278.303) [-1271.762] (-1271.700) * (-1280.311) (-1279.922) (-1278.740) [-1269.130] -- 0:01:14
Average standard deviation of split frequencies: 0.006169
640500 -- (-1279.116) (-1272.311) (-1277.613) [-1274.113] * (-1275.325) (-1283.013) (-1272.443) [-1273.728] -- 0:01:14
641000 -- (-1278.809) (-1269.180) [-1270.673] (-1279.398) * (-1267.137) (-1284.569) [-1269.091] (-1267.719) -- 0:01:14
641500 -- [-1277.973] (-1274.264) (-1284.577) (-1271.200) * (-1275.492) (-1283.220) (-1280.225) [-1269.061] -- 0:01:14
642000 -- (-1281.598) [-1273.060] (-1278.459) (-1276.552) * [-1277.737] (-1274.951) (-1272.079) (-1274.239) -- 0:01:14
642500 -- (-1278.234) [-1283.751] (-1277.951) (-1278.196) * (-1280.926) (-1271.106) [-1279.491] (-1281.321) -- 0:01:14
643000 -- [-1267.758] (-1273.872) (-1280.401) (-1275.492) * (-1268.860) (-1274.131) (-1276.529) [-1276.190] -- 0:01:14
643500 -- (-1275.203) [-1278.170] (-1272.120) (-1280.340) * (-1274.781) [-1274.565] (-1279.170) (-1271.681) -- 0:01:14
644000 -- (-1274.029) (-1267.561) (-1290.507) [-1276.139] * (-1277.166) (-1278.643) [-1273.761] (-1286.117) -- 0:01:14
644500 -- [-1280.217] (-1271.715) (-1268.584) (-1273.487) * (-1276.870) (-1270.910) [-1281.739] (-1279.339) -- 0:01:13
645000 -- [-1279.093] (-1270.938) (-1278.415) (-1288.125) * (-1270.007) (-1277.271) [-1275.072] (-1294.026) -- 0:01:13
Average standard deviation of split frequencies: 0.005950
645500 -- (-1280.144) (-1275.929) [-1277.675] (-1275.779) * [-1275.904] (-1272.862) (-1278.822) (-1273.044) -- 0:01:13
646000 -- [-1270.103] (-1280.635) (-1274.144) (-1271.176) * (-1272.787) [-1275.297] (-1282.271) (-1274.654) -- 0:01:13
646500 -- (-1283.042) (-1280.252) (-1279.157) [-1272.504] * (-1282.768) [-1273.501] (-1275.432) (-1276.755) -- 0:01:13
647000 -- (-1280.320) (-1277.131) [-1271.280] (-1273.109) * (-1277.249) [-1270.358] (-1281.223) (-1275.048) -- 0:01:13
647500 -- [-1278.591] (-1276.509) (-1277.245) (-1275.050) * [-1269.254] (-1279.827) (-1280.677) (-1280.149) -- 0:01:13
648000 -- (-1272.179) [-1274.568] (-1284.399) (-1281.656) * (-1273.078) [-1277.611] (-1278.301) (-1292.077) -- 0:01:13
648500 -- (-1265.503) [-1279.038] (-1281.345) (-1280.187) * (-1281.344) (-1270.420) [-1271.516] (-1277.102) -- 0:01:13
649000 -- (-1278.562) (-1277.829) (-1278.891) [-1279.553] * (-1273.690) (-1280.130) (-1281.572) [-1267.389] -- 0:01:13
649500 -- [-1275.651] (-1272.225) (-1284.679) (-1287.628) * [-1279.351] (-1281.521) (-1275.926) (-1278.408) -- 0:01:12
650000 -- [-1273.037] (-1277.645) (-1284.515) (-1278.027) * [-1278.512] (-1279.496) (-1273.322) (-1283.098) -- 0:01:12
Average standard deviation of split frequencies: 0.006019
650500 -- (-1271.250) [-1271.334] (-1274.549) (-1281.303) * (-1272.056) (-1273.106) [-1269.131] (-1284.927) -- 0:01:12
651000 -- (-1279.080) (-1274.035) [-1277.085] (-1276.236) * (-1271.501) [-1270.460] (-1272.703) (-1279.195) -- 0:01:12
651500 -- (-1273.259) (-1279.696) [-1280.962] (-1284.115) * [-1271.377] (-1272.074) (-1276.857) (-1282.478) -- 0:01:12
652000 -- (-1274.478) (-1282.098) (-1285.336) [-1284.665] * (-1269.384) (-1274.281) [-1273.015] (-1290.251) -- 0:01:12
652500 -- (-1280.416) (-1269.504) (-1278.486) [-1273.004] * (-1285.434) (-1283.166) (-1294.995) [-1274.833] -- 0:01:12
653000 -- (-1283.558) [-1268.449] (-1282.247) (-1276.476) * (-1279.396) [-1273.478] (-1283.098) (-1281.751) -- 0:01:12
653500 -- [-1273.963] (-1276.938) (-1287.496) (-1275.513) * [-1271.265] (-1279.811) (-1277.981) (-1274.309) -- 0:01:12
654000 -- (-1282.457) [-1273.611] (-1275.862) (-1275.291) * (-1275.626) (-1281.752) [-1273.515] (-1284.875) -- 0:01:11
654500 -- (-1273.332) (-1281.443) [-1273.561] (-1273.180) * (-1277.876) [-1271.699] (-1274.380) (-1272.115) -- 0:01:11
655000 -- (-1272.421) (-1292.050) [-1269.359] (-1275.456) * [-1268.565] (-1275.394) (-1282.233) (-1272.625) -- 0:01:11
Average standard deviation of split frequencies: 0.006136
655500 -- (-1274.686) (-1278.656) (-1298.077) [-1266.388] * (-1273.490) (-1279.430) [-1269.016] (-1273.673) -- 0:01:11
656000 -- (-1276.884) (-1275.219) (-1274.478) [-1269.864] * (-1273.234) (-1276.778) [-1273.656] (-1276.403) -- 0:01:11
656500 -- [-1269.834] (-1280.633) (-1276.805) (-1269.920) * (-1279.581) [-1274.540] (-1285.586) (-1276.598) -- 0:01:11
657000 -- (-1278.354) [-1270.444] (-1271.814) (-1271.504) * (-1288.197) (-1276.126) (-1290.557) [-1268.917] -- 0:01:11
657500 -- [-1282.063] (-1272.738) (-1279.677) (-1272.822) * (-1285.394) (-1285.296) (-1280.759) [-1274.153] -- 0:01:11
658000 -- [-1278.930] (-1281.555) (-1271.397) (-1276.583) * (-1281.858) (-1279.436) (-1290.632) [-1277.649] -- 0:01:11
658500 -- (-1278.696) (-1279.454) [-1275.232] (-1267.850) * (-1280.119) (-1280.522) (-1276.799) [-1273.688] -- 0:01:11
659000 -- [-1274.985] (-1270.283) (-1281.953) (-1268.562) * (-1283.932) [-1275.769] (-1281.624) (-1275.114) -- 0:01:10
659500 -- (-1275.012) (-1278.978) (-1277.848) [-1273.759] * (-1286.896) (-1277.663) [-1270.419] (-1274.046) -- 0:01:10
660000 -- [-1273.481] (-1275.617) (-1288.976) (-1269.896) * (-1275.685) (-1281.156) (-1279.608) [-1273.403] -- 0:01:10
Average standard deviation of split frequencies: 0.005708
660500 -- (-1279.406) (-1272.507) (-1293.333) [-1282.578] * (-1280.838) (-1279.932) (-1288.570) [-1273.844] -- 0:01:10
661000 -- [-1270.332] (-1282.149) (-1287.275) (-1270.226) * (-1285.488) [-1276.092] (-1271.461) (-1267.766) -- 0:01:10
661500 -- (-1273.410) (-1277.380) [-1267.098] (-1279.497) * (-1285.699) (-1283.817) [-1271.688] (-1270.979) -- 0:01:10
662000 -- [-1273.600] (-1272.392) (-1280.740) (-1282.470) * (-1274.590) (-1275.317) (-1279.198) [-1269.529] -- 0:01:10
662500 -- (-1278.584) [-1277.266] (-1281.583) (-1276.838) * (-1273.836) (-1272.726) (-1283.084) [-1280.560] -- 0:01:10
663000 -- (-1276.953) (-1275.494) (-1286.193) [-1272.295] * (-1280.781) [-1276.004] (-1281.786) (-1266.785) -- 0:01:10
663500 -- (-1283.792) (-1280.577) [-1267.737] (-1276.087) * [-1275.463] (-1289.672) (-1286.047) (-1276.411) -- 0:01:09
664000 -- (-1284.584) [-1274.856] (-1272.629) (-1272.872) * (-1270.860) (-1272.449) (-1276.487) [-1272.699] -- 0:01:09
664500 -- (-1279.923) (-1278.274) [-1266.748] (-1276.554) * (-1274.045) (-1288.593) (-1278.495) [-1271.914] -- 0:01:09
665000 -- (-1280.786) (-1271.443) (-1278.341) [-1271.772] * (-1275.899) (-1283.785) [-1274.878] (-1273.777) -- 0:01:09
Average standard deviation of split frequencies: 0.005499
665500 -- (-1279.379) [-1278.578] (-1272.716) (-1268.175) * [-1270.520] (-1283.791) (-1268.699) (-1269.399) -- 0:01:09
666000 -- (-1290.509) (-1286.527) [-1270.064] (-1282.134) * (-1280.471) [-1277.069] (-1281.586) (-1275.218) -- 0:01:09
666500 -- (-1280.510) [-1278.273] (-1271.829) (-1269.721) * [-1275.463] (-1294.163) (-1274.472) (-1267.789) -- 0:01:09
667000 -- (-1277.270) (-1277.284) [-1273.837] (-1277.427) * (-1274.601) (-1280.184) (-1278.209) [-1270.001] -- 0:01:09
667500 -- (-1275.228) [-1284.288] (-1280.962) (-1277.407) * [-1276.659] (-1279.917) (-1275.836) (-1270.056) -- 0:01:09
668000 -- (-1287.199) (-1286.171) (-1279.775) [-1274.449] * (-1278.961) [-1282.067] (-1282.238) (-1275.019) -- 0:01:09
668500 -- (-1293.046) (-1283.134) [-1275.800] (-1276.183) * (-1272.969) (-1279.388) (-1275.196) [-1278.362] -- 0:01:08
669000 -- [-1280.923] (-1278.595) (-1271.265) (-1271.172) * [-1269.424] (-1273.994) (-1279.687) (-1284.441) -- 0:01:08
669500 -- (-1284.467) (-1279.600) (-1282.635) [-1284.404] * (-1269.902) [-1280.087] (-1277.788) (-1285.735) -- 0:01:08
670000 -- (-1279.830) (-1287.939) [-1271.736] (-1278.504) * (-1287.335) [-1271.928] (-1291.533) (-1275.597) -- 0:01:08
Average standard deviation of split frequencies: 0.005299
670500 -- (-1287.107) (-1273.434) [-1279.095] (-1280.338) * [-1278.445] (-1277.132) (-1281.986) (-1276.916) -- 0:01:08
671000 -- (-1282.165) [-1271.491] (-1287.985) (-1274.925) * (-1286.255) [-1269.567] (-1275.230) (-1279.397) -- 0:01:08
671500 -- (-1284.062) (-1277.945) (-1272.282) [-1269.713] * (-1280.014) (-1270.944) (-1277.268) [-1289.347] -- 0:01:08
672000 -- (-1276.105) [-1276.444] (-1280.601) (-1287.650) * (-1272.914) [-1270.752] (-1286.607) (-1281.692) -- 0:01:08
672500 -- (-1277.487) (-1290.299) (-1274.296) [-1271.155] * (-1276.685) (-1276.416) (-1276.071) [-1278.968] -- 0:01:08
673000 -- (-1274.045) (-1284.152) (-1289.719) [-1274.341] * (-1277.672) (-1285.901) [-1273.672] (-1276.434) -- 0:01:08
673500 -- (-1280.642) (-1282.231) (-1273.329) [-1274.227] * [-1275.321] (-1281.412) (-1282.823) (-1273.479) -- 0:01:07
674000 -- (-1279.501) (-1292.511) [-1273.475] (-1272.619) * (-1281.554) [-1272.231] (-1276.244) (-1274.348) -- 0:01:07
674500 -- (-1279.663) (-1280.468) [-1273.881] (-1274.265) * [-1270.840] (-1275.195) (-1278.522) (-1277.834) -- 0:01:07
675000 -- (-1288.454) (-1269.436) (-1281.884) [-1280.643] * [-1276.418] (-1282.990) (-1275.744) (-1290.323) -- 0:01:07
Average standard deviation of split frequencies: 0.005471
675500 -- (-1272.411) (-1273.979) (-1273.703) [-1271.231] * (-1282.042) (-1282.591) [-1271.661] (-1283.255) -- 0:01:07
676000 -- [-1270.399] (-1275.267) (-1267.557) (-1273.149) * [-1275.641] (-1280.648) (-1274.992) (-1279.041) -- 0:01:07
676500 -- [-1272.822] (-1283.555) (-1271.891) (-1281.493) * [-1276.953] (-1287.129) (-1278.213) (-1271.163) -- 0:01:07
677000 -- (-1293.515) [-1276.256] (-1273.649) (-1282.444) * (-1273.463) (-1278.678) (-1276.222) [-1272.102] -- 0:01:07
677500 -- (-1283.700) (-1273.536) [-1270.010] (-1282.255) * (-1283.324) (-1281.916) [-1275.827] (-1276.144) -- 0:01:07
678000 -- (-1279.520) (-1274.025) (-1282.649) [-1275.839] * [-1280.642] (-1274.441) (-1281.245) (-1279.878) -- 0:01:06
678500 -- [-1270.498] (-1274.316) (-1282.532) (-1270.733) * [-1283.951] (-1281.959) (-1278.529) (-1282.557) -- 0:01:06
679000 -- (-1280.932) [-1276.181] (-1276.240) (-1272.104) * (-1286.507) [-1274.428] (-1275.276) (-1280.811) -- 0:01:06
679500 -- [-1282.359] (-1270.859) (-1272.353) (-1276.564) * (-1295.946) [-1276.451] (-1277.799) (-1276.328) -- 0:01:06
680000 -- (-1269.272) (-1279.477) [-1280.433] (-1286.353) * (-1281.456) (-1281.372) (-1276.070) [-1276.498] -- 0:01:06
Average standard deviation of split frequencies: 0.005381
680500 -- [-1273.168] (-1270.481) (-1277.356) (-1286.714) * (-1277.530) (-1281.716) [-1281.267] (-1281.538) -- 0:01:06
681000 -- [-1279.226] (-1274.480) (-1285.577) (-1281.185) * [-1279.221] (-1269.002) (-1280.804) (-1280.665) -- 0:01:06
681500 -- (-1277.339) [-1272.904] (-1278.299) (-1285.712) * (-1277.011) (-1267.851) (-1285.490) [-1269.010] -- 0:01:06
682000 -- (-1275.817) (-1283.769) (-1285.653) [-1272.475] * (-1285.680) (-1281.059) (-1278.682) [-1272.486] -- 0:01:06
682500 -- [-1270.317] (-1275.294) (-1289.946) (-1286.596) * [-1282.897] (-1282.920) (-1277.961) (-1280.855) -- 0:01:06
683000 -- (-1275.379) [-1279.543] (-1286.243) (-1276.804) * (-1270.300) [-1275.390] (-1278.387) (-1281.209) -- 0:01:05
683500 -- [-1273.952] (-1275.349) (-1284.552) (-1279.124) * [-1279.309] (-1274.289) (-1284.627) (-1280.405) -- 0:01:05
684000 -- [-1284.541] (-1276.847) (-1286.091) (-1278.141) * (-1271.179) (-1283.517) [-1279.845] (-1279.414) -- 0:01:05
684500 -- (-1280.381) [-1276.218] (-1277.431) (-1281.343) * (-1276.043) (-1275.519) [-1276.734] (-1278.206) -- 0:01:05
685000 -- [-1275.233] (-1283.863) (-1275.842) (-1268.800) * (-1273.732) [-1276.318] (-1276.973) (-1285.546) -- 0:01:05
Average standard deviation of split frequencies: 0.005392
685500 -- [-1269.283] (-1276.011) (-1279.647) (-1269.790) * (-1283.146) (-1275.468) (-1278.755) [-1277.361] -- 0:01:05
686000 -- [-1273.773] (-1278.417) (-1288.648) (-1285.250) * [-1282.007] (-1285.119) (-1282.396) (-1274.431) -- 0:01:05
686500 -- (-1269.209) (-1276.206) (-1276.824) [-1273.454] * [-1267.149] (-1278.203) (-1277.798) (-1278.231) -- 0:01:05
687000 -- (-1292.372) [-1279.797] (-1280.189) (-1277.959) * (-1272.417) (-1287.216) (-1272.852) [-1271.174] -- 0:01:05
687500 -- (-1283.188) [-1272.039] (-1276.371) (-1275.857) * (-1281.133) (-1282.560) (-1279.524) [-1268.365] -- 0:01:05
688000 -- (-1272.413) (-1276.211) [-1279.108] (-1276.334) * [-1269.665] (-1287.797) (-1271.120) (-1279.168) -- 0:01:04
688500 -- (-1279.065) (-1273.687) [-1274.340] (-1276.430) * [-1267.627] (-1287.422) (-1270.802) (-1277.888) -- 0:01:04
689000 -- [-1272.585] (-1267.091) (-1277.540) (-1276.751) * [-1269.674] (-1290.914) (-1278.033) (-1269.031) -- 0:01:04
689500 -- (-1277.151) (-1284.119) [-1268.321] (-1274.605) * (-1265.547) (-1305.278) (-1268.305) [-1269.858] -- 0:01:04
690000 -- [-1278.730] (-1271.193) (-1294.407) (-1266.378) * (-1276.082) (-1284.777) [-1272.569] (-1272.957) -- 0:01:04
Average standard deviation of split frequencies: 0.005828
690500 -- (-1277.436) (-1274.067) (-1278.529) [-1277.421] * (-1286.342) (-1277.572) (-1284.953) [-1282.764] -- 0:01:04
691000 -- (-1279.984) [-1278.863] (-1282.428) (-1288.280) * (-1279.606) (-1283.321) (-1277.112) [-1273.448] -- 0:01:04
691500 -- (-1283.289) [-1281.834] (-1274.729) (-1270.536) * (-1279.583) (-1279.497) (-1276.405) [-1273.901] -- 0:01:04
692000 -- (-1284.292) (-1277.073) [-1277.956] (-1274.560) * (-1283.225) [-1280.899] (-1274.459) (-1276.109) -- 0:01:04
692500 -- [-1270.508] (-1284.702) (-1269.273) (-1280.194) * (-1279.622) (-1294.058) [-1269.831] (-1283.078) -- 0:01:03
693000 -- [-1277.401] (-1282.275) (-1285.835) (-1283.371) * (-1274.922) (-1288.862) [-1280.794] (-1275.245) -- 0:01:03
693500 -- (-1270.777) [-1272.315] (-1294.393) (-1272.452) * (-1287.678) (-1283.873) (-1279.744) [-1280.898] -- 0:01:03
694000 -- [-1281.908] (-1277.498) (-1276.744) (-1276.011) * (-1284.054) (-1288.617) (-1283.806) [-1275.592] -- 0:01:03
694500 -- [-1277.512] (-1283.384) (-1276.662) (-1275.872) * (-1281.089) (-1279.238) (-1282.264) [-1270.875] -- 0:01:03
695000 -- (-1272.627) [-1283.432] (-1276.215) (-1279.773) * (-1279.071) (-1276.449) [-1279.166] (-1286.818) -- 0:01:03
Average standard deviation of split frequencies: 0.005835
695500 -- [-1278.828] (-1275.214) (-1275.126) (-1291.749) * (-1278.757) (-1285.532) [-1271.165] (-1282.451) -- 0:01:03
696000 -- (-1281.874) (-1268.069) (-1287.375) [-1277.461] * (-1277.563) (-1281.792) [-1273.386] (-1287.092) -- 0:01:03
696500 -- (-1274.106) (-1275.356) (-1283.184) [-1273.636] * [-1271.617] (-1272.186) (-1282.917) (-1300.943) -- 0:01:03
697000 -- (-1280.030) [-1270.378] (-1277.288) (-1274.279) * (-1275.626) (-1277.755) [-1276.708] (-1289.363) -- 0:01:03
697500 -- (-1279.375) (-1270.586) [-1273.258] (-1268.821) * (-1283.317) (-1277.299) [-1274.592] (-1290.923) -- 0:01:02
698000 -- (-1280.573) [-1276.362] (-1273.471) (-1287.491) * (-1275.932) (-1286.681) [-1266.906] (-1290.532) -- 0:01:02
698500 -- (-1285.198) [-1269.898] (-1267.116) (-1278.966) * (-1269.796) (-1280.920) [-1267.327] (-1284.896) -- 0:01:02
699000 -- (-1284.885) [-1269.879] (-1274.975) (-1280.136) * (-1269.622) [-1276.591] (-1277.549) (-1277.563) -- 0:01:02
699500 -- (-1274.407) (-1273.335) [-1267.261] (-1275.191) * (-1279.630) (-1285.477) [-1270.642] (-1274.762) -- 0:01:02
700000 -- (-1272.303) [-1275.803] (-1266.204) (-1281.485) * (-1274.189) [-1269.943] (-1272.398) (-1275.208) -- 0:01:02
Average standard deviation of split frequencies: 0.005331
700500 -- (-1276.231) [-1274.935] (-1275.985) (-1276.911) * (-1274.173) (-1267.910) (-1285.137) [-1272.917] -- 0:01:02
701000 -- [-1270.071] (-1276.028) (-1279.060) (-1287.358) * (-1281.294) (-1277.211) [-1266.908] (-1273.365) -- 0:01:02
701500 -- [-1272.014] (-1287.626) (-1284.136) (-1280.562) * (-1279.050) [-1276.562] (-1277.005) (-1268.339) -- 0:01:02
702000 -- (-1274.652) (-1274.428) (-1266.356) [-1273.204] * [-1271.046] (-1278.202) (-1284.495) (-1274.490) -- 0:01:01
702500 -- [-1268.611] (-1280.941) (-1279.522) (-1275.394) * (-1281.259) (-1279.642) [-1274.064] (-1280.151) -- 0:01:01
703000 -- (-1277.436) (-1276.752) [-1272.253] (-1272.023) * (-1281.620) (-1273.702) [-1270.386] (-1270.293) -- 0:01:01
703500 -- (-1277.011) [-1274.122] (-1275.150) (-1266.773) * (-1283.811) (-1273.590) (-1273.465) [-1281.148] -- 0:01:01
704000 -- [-1271.511] (-1274.616) (-1280.613) (-1271.067) * (-1274.903) (-1282.604) (-1283.761) [-1272.063] -- 0:01:01
704500 -- (-1273.547) (-1266.987) (-1274.299) [-1273.744] * (-1272.593) [-1268.592] (-1269.285) (-1286.732) -- 0:01:01
705000 -- (-1280.114) [-1269.281] (-1268.953) (-1276.137) * [-1270.789] (-1279.751) (-1268.528) (-1276.491) -- 0:01:01
Average standard deviation of split frequencies: 0.005496
705500 -- (-1283.442) (-1276.251) (-1282.487) [-1265.099] * (-1276.134) (-1279.871) [-1274.233] (-1281.247) -- 0:01:01
706000 -- (-1271.543) [-1271.563] (-1277.120) (-1275.723) * [-1266.422] (-1277.330) (-1272.570) (-1277.705) -- 0:01:01
706500 -- (-1284.064) (-1279.882) (-1276.479) [-1275.309] * [-1271.453] (-1271.296) (-1274.603) (-1291.451) -- 0:01:01
707000 -- (-1284.140) [-1269.097] (-1276.441) (-1280.857) * (-1270.625) (-1286.686) (-1282.363) [-1282.250] -- 0:01:00
707500 -- (-1283.713) (-1280.377) (-1267.101) [-1271.135] * (-1271.849) [-1275.572] (-1284.411) (-1284.961) -- 0:01:00
708000 -- (-1285.884) (-1277.809) (-1280.134) [-1273.619] * (-1269.175) (-1275.466) [-1271.922] (-1278.168) -- 0:01:00
708500 -- (-1274.430) (-1283.115) [-1267.510] (-1274.214) * (-1274.496) [-1273.804] (-1278.649) (-1272.198) -- 0:01:00
709000 -- [-1276.237] (-1287.172) (-1280.180) (-1272.466) * (-1280.587) (-1274.581) [-1271.774] (-1273.726) -- 0:01:00
709500 -- [-1269.226] (-1271.329) (-1282.670) (-1276.202) * (-1292.710) (-1282.106) (-1276.437) [-1272.424] -- 0:01:00
710000 -- (-1278.837) [-1272.896] (-1277.072) (-1278.839) * (-1282.708) [-1268.930] (-1275.289) (-1273.036) -- 0:01:00
Average standard deviation of split frequencies: 0.004949
710500 -- (-1282.771) [-1280.497] (-1272.880) (-1274.385) * (-1274.631) (-1276.684) [-1275.197] (-1285.315) -- 0:01:00
711000 -- (-1275.592) (-1276.195) [-1267.426] (-1281.976) * (-1284.301) (-1279.788) (-1273.821) [-1273.962] -- 0:01:00
711500 -- (-1281.353) (-1280.682) [-1271.713] (-1276.677) * (-1277.604) (-1279.496) [-1270.684] (-1274.877) -- 0:01:00
712000 -- (-1283.192) (-1275.385) [-1275.720] (-1280.762) * (-1280.080) [-1266.285] (-1270.780) (-1271.314) -- 0:00:59
712500 -- (-1278.388) (-1281.386) (-1269.674) [-1271.120] * (-1279.035) (-1281.840) [-1276.432] (-1281.788) -- 0:00:59
713000 -- (-1278.722) (-1283.047) (-1280.985) [-1268.785] * (-1282.941) [-1275.823] (-1279.889) (-1277.495) -- 0:00:59
713500 -- (-1279.117) (-1282.514) (-1288.139) [-1275.900] * (-1289.228) (-1278.155) (-1279.305) [-1271.873] -- 0:00:59
714000 -- (-1276.017) (-1283.313) (-1277.451) [-1280.074] * (-1284.226) [-1280.210] (-1279.495) (-1276.171) -- 0:00:59
714500 -- (-1286.057) [-1277.239] (-1273.430) (-1275.801) * (-1304.947) (-1272.678) (-1280.583) [-1276.349] -- 0:00:59
715000 -- (-1285.938) (-1274.878) (-1274.106) [-1269.076] * (-1280.852) (-1281.370) [-1271.925] (-1286.910) -- 0:00:59
Average standard deviation of split frequencies: 0.004862
715500 -- (-1286.881) (-1276.589) [-1277.410] (-1280.582) * (-1278.604) (-1280.751) [-1272.963] (-1267.616) -- 0:00:59
716000 -- (-1282.630) (-1276.682) (-1284.878) [-1276.044] * (-1283.139) [-1272.555] (-1275.257) (-1287.342) -- 0:00:59
716500 -- [-1282.437] (-1271.797) (-1278.368) (-1280.498) * (-1279.691) (-1275.960) [-1272.855] (-1283.420) -- 0:00:58
717000 -- (-1279.997) [-1275.004] (-1290.317) (-1277.567) * [-1279.393] (-1273.552) (-1278.631) (-1270.528) -- 0:00:58
717500 -- (-1277.961) (-1280.052) [-1280.369] (-1278.413) * [-1281.009] (-1274.714) (-1277.207) (-1277.437) -- 0:00:58
718000 -- (-1276.615) (-1292.582) (-1285.807) [-1277.201] * (-1277.406) (-1277.331) (-1278.469) [-1279.608] -- 0:00:58
718500 -- [-1276.297] (-1279.774) (-1286.500) (-1280.484) * (-1284.849) [-1280.391] (-1273.406) (-1284.832) -- 0:00:58
719000 -- (-1273.876) (-1274.882) (-1284.636) [-1278.411] * [-1269.321] (-1272.781) (-1284.848) (-1276.001) -- 0:00:58
719500 -- (-1282.640) (-1287.174) (-1282.858) [-1270.570] * (-1268.939) [-1271.084] (-1273.252) (-1281.297) -- 0:00:58
720000 -- (-1287.051) (-1285.593) (-1273.641) [-1279.295] * (-1281.497) (-1274.423) (-1271.282) [-1273.863] -- 0:00:58
Average standard deviation of split frequencies: 0.004579
720500 -- (-1273.950) (-1284.511) (-1283.926) [-1275.668] * (-1277.068) [-1270.111] (-1273.605) (-1287.183) -- 0:00:58
721000 -- (-1281.091) (-1281.976) (-1278.309) [-1274.592] * [-1285.445] (-1287.258) (-1279.006) (-1283.379) -- 0:00:58
721500 -- [-1272.312] (-1282.226) (-1276.782) (-1276.334) * [-1278.811] (-1284.649) (-1281.358) (-1273.242) -- 0:00:57
722000 -- (-1273.356) (-1280.470) (-1278.606) [-1273.181] * [-1279.695] (-1278.209) (-1284.446) (-1289.054) -- 0:00:57
722500 -- (-1290.624) (-1276.500) [-1273.224] (-1270.339) * (-1274.717) (-1280.880) (-1284.567) [-1277.412] -- 0:00:57
723000 -- (-1290.985) (-1281.054) (-1271.710) [-1282.618] * (-1277.102) (-1279.386) [-1273.508] (-1274.190) -- 0:00:57
723500 -- [-1282.454] (-1285.118) (-1283.850) (-1289.527) * (-1283.171) [-1270.183] (-1281.359) (-1278.993) -- 0:00:57
724000 -- (-1278.950) (-1289.642) (-1288.075) [-1277.541] * (-1279.620) (-1281.707) (-1286.636) [-1270.948] -- 0:00:57
724500 -- (-1276.357) (-1278.711) (-1277.597) [-1272.784] * (-1271.129) [-1281.546] (-1282.958) (-1272.553) -- 0:00:57
725000 -- (-1292.604) [-1276.531] (-1297.518) (-1278.636) * (-1286.602) [-1276.188] (-1274.905) (-1279.741) -- 0:00:57
Average standard deviation of split frequencies: 0.004795
725500 -- (-1282.970) [-1275.080] (-1279.759) (-1283.766) * (-1280.467) [-1276.231] (-1280.172) (-1287.087) -- 0:00:57
726000 -- (-1283.197) (-1272.970) [-1271.817] (-1279.998) * (-1285.614) [-1271.683] (-1276.689) (-1283.360) -- 0:00:56
726500 -- (-1282.357) (-1272.617) [-1277.149] (-1291.666) * (-1279.434) (-1270.751) (-1277.210) [-1279.777] -- 0:00:56
727000 -- (-1279.752) (-1271.495) (-1277.597) [-1275.860] * (-1287.714) (-1285.336) (-1286.811) [-1279.002] -- 0:00:56
727500 -- (-1280.699) [-1279.330] (-1279.332) (-1277.174) * (-1283.799) (-1275.413) [-1281.317] (-1279.012) -- 0:00:56
728000 -- (-1279.516) (-1277.634) [-1269.682] (-1269.151) * [-1271.609] (-1275.978) (-1288.032) (-1278.474) -- 0:00:56
728500 -- (-1270.761) [-1283.174] (-1272.782) (-1272.248) * [-1278.553] (-1271.658) (-1283.932) (-1281.204) -- 0:00:56
729000 -- [-1271.737] (-1292.722) (-1275.533) (-1282.317) * [-1281.039] (-1272.374) (-1275.018) (-1288.197) -- 0:00:56
729500 -- [-1276.627] (-1282.376) (-1273.137) (-1277.701) * (-1279.675) (-1273.168) [-1272.100] (-1279.952) -- 0:00:56
730000 -- (-1281.885) (-1282.584) (-1283.117) [-1275.128] * [-1282.823] (-1276.417) (-1275.902) (-1274.393) -- 0:00:56
Average standard deviation of split frequencies: 0.004913
730500 -- [-1272.501] (-1272.753) (-1295.596) (-1273.790) * (-1279.836) (-1277.303) (-1274.000) [-1272.760] -- 0:00:56
731000 -- (-1276.362) [-1275.811] (-1271.737) (-1271.266) * (-1287.362) (-1268.676) (-1270.063) [-1274.262] -- 0:00:55
731500 -- (-1283.805) (-1279.312) [-1276.014] (-1278.736) * (-1273.518) [-1275.980] (-1280.538) (-1274.261) -- 0:00:55
732000 -- (-1280.771) (-1284.440) [-1281.676] (-1274.172) * (-1275.720) [-1277.549] (-1272.627) (-1271.283) -- 0:00:55
732500 -- [-1278.372] (-1285.249) (-1287.612) (-1279.663) * [-1280.858] (-1279.348) (-1282.081) (-1280.215) -- 0:00:55
733000 -- (-1283.303) (-1281.544) (-1281.762) [-1271.201] * (-1285.191) (-1285.713) (-1278.487) [-1281.797] -- 0:00:55
733500 -- [-1275.071] (-1285.690) (-1276.922) (-1290.095) * (-1274.112) [-1284.009] (-1276.108) (-1286.401) -- 0:00:55
734000 -- [-1277.278] (-1280.322) (-1284.907) (-1286.705) * (-1277.145) (-1278.177) (-1288.309) [-1284.009] -- 0:00:55
734500 -- (-1276.412) (-1275.444) (-1274.668) [-1283.335] * (-1280.425) (-1276.043) [-1277.732] (-1286.888) -- 0:00:55
735000 -- (-1280.755) (-1275.508) (-1276.320) [-1271.773] * (-1290.270) [-1269.198] (-1272.200) (-1281.144) -- 0:00:55
Average standard deviation of split frequencies: 0.004434
735500 -- (-1284.695) (-1279.222) (-1283.652) [-1269.561] * (-1282.338) (-1281.015) [-1272.618] (-1281.297) -- 0:00:55
736000 -- [-1276.984] (-1279.432) (-1280.659) (-1268.122) * (-1282.676) [-1273.843] (-1275.723) (-1290.570) -- 0:00:54
736500 -- (-1272.951) (-1280.982) [-1283.077] (-1277.053) * (-1274.656) [-1274.683] (-1273.808) (-1278.862) -- 0:00:54
737000 -- (-1274.435) (-1279.507) (-1284.634) [-1275.634] * (-1278.621) (-1288.569) [-1270.181] (-1275.932) -- 0:00:54
737500 -- (-1273.838) (-1287.386) (-1283.694) [-1284.511] * (-1284.446) (-1278.203) (-1274.762) [-1272.380] -- 0:00:54
738000 -- (-1272.383) (-1274.860) (-1275.906) [-1275.274] * (-1291.485) (-1281.755) [-1270.106] (-1277.128) -- 0:00:54
738500 -- [-1273.272] (-1278.984) (-1277.197) (-1273.195) * (-1275.771) [-1288.556] (-1284.731) (-1279.949) -- 0:00:54
739000 -- (-1277.394) (-1278.025) (-1276.960) [-1272.212] * (-1280.569) (-1273.900) (-1274.141) [-1269.468] -- 0:00:54
739500 -- (-1272.272) (-1275.040) [-1272.198] (-1281.206) * (-1277.786) (-1274.260) (-1289.130) [-1276.181] -- 0:00:54
740000 -- (-1271.434) (-1281.370) (-1270.736) [-1272.442] * (-1292.064) (-1273.582) (-1285.941) [-1272.337] -- 0:00:54
Average standard deviation of split frequencies: 0.004994
740500 -- (-1276.156) (-1271.300) [-1266.722] (-1280.240) * (-1286.327) [-1274.216] (-1277.827) (-1280.504) -- 0:00:53
741000 -- (-1292.922) [-1270.982] (-1269.530) (-1273.553) * (-1279.395) (-1273.910) (-1281.319) [-1271.518] -- 0:00:53
741500 -- (-1272.372) [-1269.996] (-1280.079) (-1276.013) * (-1279.153) [-1272.090] (-1281.771) (-1287.220) -- 0:00:53
742000 -- [-1271.750] (-1274.839) (-1272.307) (-1281.133) * (-1290.242) [-1279.699] (-1281.853) (-1282.072) -- 0:00:53
742500 -- (-1273.247) [-1269.367] (-1277.620) (-1284.645) * [-1283.099] (-1273.425) (-1282.607) (-1279.878) -- 0:00:53
743000 -- (-1276.248) [-1270.476] (-1267.319) (-1289.017) * (-1281.548) [-1273.495] (-1290.511) (-1267.938) -- 0:00:53
743500 -- (-1274.978) [-1271.577] (-1271.907) (-1277.878) * (-1275.421) [-1277.772] (-1276.111) (-1276.953) -- 0:00:53
744000 -- (-1278.286) [-1270.981] (-1280.906) (-1288.435) * (-1277.322) [-1273.040] (-1275.694) (-1275.044) -- 0:00:53
744500 -- (-1269.970) [-1275.308] (-1275.104) (-1273.666) * (-1282.719) (-1278.172) (-1281.370) [-1272.393] -- 0:00:53
745000 -- (-1277.306) [-1271.599] (-1278.341) (-1274.916) * (-1280.760) [-1275.191] (-1279.871) (-1271.029) -- 0:00:53
Average standard deviation of split frequencies: 0.004861
745500 -- (-1277.209) (-1272.044) [-1274.039] (-1278.439) * (-1279.727) (-1277.630) (-1277.844) [-1278.108] -- 0:00:52
746000 -- (-1280.137) (-1274.083) [-1271.933] (-1274.503) * (-1280.277) [-1271.977] (-1278.122) (-1271.851) -- 0:00:52
746500 -- (-1287.085) (-1279.885) (-1272.417) [-1273.568] * [-1273.403] (-1280.241) (-1277.003) (-1276.892) -- 0:00:52
747000 -- (-1291.153) (-1278.444) (-1272.450) [-1271.808] * (-1278.970) (-1293.884) (-1281.123) [-1271.318] -- 0:00:52
747500 -- (-1285.666) (-1279.150) (-1270.407) [-1278.449] * (-1277.740) (-1285.925) (-1291.309) [-1280.869] -- 0:00:52
748000 -- (-1277.640) (-1277.800) [-1267.583] (-1274.758) * [-1279.161] (-1283.952) (-1281.898) (-1273.456) -- 0:00:52
748500 -- (-1277.613) (-1274.680) [-1268.608] (-1275.713) * (-1278.105) (-1278.037) (-1277.173) [-1275.473] -- 0:00:52
749000 -- (-1275.287) (-1288.134) [-1274.644] (-1275.646) * (-1271.018) (-1274.160) (-1283.523) [-1273.358] -- 0:00:52
749500 -- (-1274.769) (-1274.107) (-1275.255) [-1276.536] * (-1276.416) (-1270.911) (-1286.310) [-1272.482] -- 0:00:52
750000 -- [-1273.493] (-1272.151) (-1271.150) (-1276.003) * [-1273.392] (-1281.324) (-1276.473) (-1283.790) -- 0:00:52
Average standard deviation of split frequencies: 0.004879
750500 -- (-1276.006) [-1276.585] (-1277.274) (-1280.479) * (-1278.213) [-1276.968] (-1278.662) (-1274.783) -- 0:00:51
751000 -- (-1281.988) [-1282.997] (-1275.200) (-1284.615) * (-1290.529) [-1273.543] (-1277.975) (-1276.318) -- 0:00:51
751500 -- [-1275.434] (-1283.720) (-1271.333) (-1281.455) * (-1278.443) [-1264.315] (-1283.121) (-1277.539) -- 0:00:51
752000 -- (-1276.456) (-1288.031) [-1279.906] (-1277.699) * [-1274.265] (-1272.628) (-1278.042) (-1276.601) -- 0:00:51
752500 -- [-1270.061] (-1281.304) (-1277.027) (-1285.709) * [-1279.020] (-1273.418) (-1279.155) (-1274.598) -- 0:00:51
753000 -- (-1274.285) (-1266.827) [-1275.201] (-1292.836) * (-1271.426) (-1286.792) [-1278.358] (-1275.896) -- 0:00:51
753500 -- (-1280.259) [-1278.944] (-1282.641) (-1274.360) * [-1271.174] (-1276.013) (-1280.497) (-1274.687) -- 0:00:51
754000 -- (-1279.786) [-1269.866] (-1275.489) (-1278.813) * (-1276.621) (-1273.485) [-1282.725] (-1278.036) -- 0:00:51
754500 -- (-1272.637) [-1271.916] (-1281.529) (-1276.037) * (-1281.016) (-1274.424) (-1286.668) [-1276.225] -- 0:00:51
755000 -- (-1277.613) (-1283.482) (-1270.561) [-1272.290] * [-1275.961] (-1273.217) (-1274.896) (-1283.492) -- 0:00:50
Average standard deviation of split frequencies: 0.005132
755500 -- (-1286.981) (-1276.733) (-1290.249) [-1279.770] * [-1268.953] (-1281.188) (-1276.083) (-1279.647) -- 0:00:50
756000 -- (-1276.711) (-1280.820) [-1272.583] (-1280.004) * [-1289.877] (-1276.648) (-1295.175) (-1283.455) -- 0:00:50
756500 -- (-1274.592) (-1280.467) (-1284.905) [-1272.212] * [-1270.738] (-1271.820) (-1272.173) (-1276.670) -- 0:00:50
757000 -- (-1285.314) [-1268.766] (-1279.153) (-1275.755) * [-1272.768] (-1280.042) (-1277.085) (-1277.876) -- 0:00:50
757500 -- (-1280.595) [-1273.044] (-1285.987) (-1284.911) * [-1281.523] (-1273.801) (-1284.593) (-1284.034) -- 0:00:50
758000 -- (-1279.683) (-1278.827) [-1273.422] (-1277.055) * [-1272.800] (-1270.548) (-1278.654) (-1281.338) -- 0:00:50
758500 -- (-1283.495) (-1285.829) (-1277.320) [-1274.984] * (-1278.322) [-1275.207] (-1278.244) (-1274.626) -- 0:00:50
759000 -- (-1275.416) (-1271.191) (-1271.436) [-1277.162] * [-1268.551] (-1274.607) (-1287.359) (-1274.363) -- 0:00:50
759500 -- [-1281.319] (-1273.825) (-1277.884) (-1272.989) * (-1271.794) [-1280.127] (-1279.054) (-1284.877) -- 0:00:50
760000 -- (-1283.768) (-1285.070) (-1277.788) [-1271.871] * [-1272.873] (-1278.055) (-1284.947) (-1279.395) -- 0:00:49
Average standard deviation of split frequencies: 0.005005
760500 -- [-1279.228] (-1281.993) (-1282.335) (-1279.118) * (-1275.319) [-1272.015] (-1292.367) (-1285.700) -- 0:00:49
761000 -- [-1280.083] (-1269.805) (-1291.438) (-1278.544) * (-1277.234) [-1276.532] (-1285.907) (-1282.209) -- 0:00:49
761500 -- [-1270.411] (-1275.470) (-1281.743) (-1278.536) * [-1277.745] (-1284.077) (-1282.869) (-1274.751) -- 0:00:49
762000 -- (-1288.431) (-1269.446) [-1281.274] (-1280.306) * (-1279.574) [-1273.311] (-1272.736) (-1278.912) -- 0:00:49
762500 -- (-1291.724) [-1270.829] (-1281.453) (-1279.725) * (-1279.966) [-1271.061] (-1273.384) (-1278.864) -- 0:00:49
763000 -- (-1278.667) [-1268.939] (-1274.313) (-1280.134) * (-1273.126) (-1276.392) [-1273.248] (-1279.689) -- 0:00:49
763500 -- (-1286.780) [-1274.445] (-1279.388) (-1272.670) * (-1272.048) [-1268.797] (-1279.971) (-1275.275) -- 0:00:49
764000 -- (-1283.363) [-1267.636] (-1272.311) (-1278.746) * (-1276.006) (-1277.681) [-1276.194] (-1287.423) -- 0:00:49
764500 -- (-1287.872) [-1280.487] (-1275.305) (-1274.251) * (-1281.964) [-1272.287] (-1281.061) (-1273.756) -- 0:00:48
765000 -- (-1277.229) [-1274.434] (-1286.083) (-1275.268) * (-1279.196) [-1278.382] (-1281.750) (-1272.624) -- 0:00:48
Average standard deviation of split frequencies: 0.004639
765500 -- (-1282.394) [-1272.861] (-1285.697) (-1280.583) * (-1271.559) (-1285.885) [-1271.081] (-1266.581) -- 0:00:48
766000 -- (-1279.385) (-1276.764) [-1272.918] (-1277.075) * (-1276.329) (-1287.126) [-1276.101] (-1278.511) -- 0:00:48
766500 -- (-1302.029) [-1277.349] (-1283.239) (-1281.867) * (-1286.957) (-1287.108) (-1272.048) [-1274.148] -- 0:00:48
767000 -- (-1283.940) (-1275.988) (-1284.888) [-1276.906] * (-1272.223) (-1280.083) (-1282.004) [-1275.901] -- 0:00:48
767500 -- (-1286.146) (-1278.896) (-1269.924) [-1282.623] * (-1275.611) (-1284.698) (-1282.032) [-1273.133] -- 0:00:48
768000 -- (-1274.221) [-1265.571] (-1283.241) (-1272.805) * [-1270.169] (-1277.055) (-1274.407) (-1284.321) -- 0:00:48
768500 -- [-1270.953] (-1277.138) (-1275.678) (-1271.214) * (-1277.197) (-1283.990) (-1290.970) [-1276.651] -- 0:00:48
769000 -- (-1283.321) (-1275.452) [-1269.342] (-1280.622) * (-1272.257) (-1273.830) [-1274.149] (-1280.544) -- 0:00:48
769500 -- (-1277.377) (-1274.923) [-1271.726] (-1275.386) * (-1286.233) [-1279.912] (-1280.604) (-1282.374) -- 0:00:47
770000 -- [-1270.909] (-1283.399) (-1278.565) (-1270.229) * (-1274.476) (-1273.210) (-1268.271) [-1273.008] -- 0:00:47
Average standard deviation of split frequencies: 0.004705
770500 -- (-1275.695) (-1273.741) [-1274.641] (-1276.137) * [-1284.140] (-1277.367) (-1281.289) (-1271.716) -- 0:00:47
771000 -- [-1269.857] (-1273.292) (-1289.408) (-1270.794) * (-1287.329) (-1271.657) (-1284.140) [-1271.629] -- 0:00:47
771500 -- [-1272.491] (-1279.542) (-1281.080) (-1284.621) * (-1279.580) [-1274.221] (-1284.257) (-1271.237) -- 0:00:47
772000 -- [-1272.425] (-1275.993) (-1289.313) (-1280.753) * (-1284.572) (-1283.199) (-1286.772) [-1276.343] -- 0:00:47
772500 -- [-1274.010] (-1271.725) (-1290.004) (-1278.552) * (-1273.602) (-1278.272) (-1283.887) [-1278.233] -- 0:00:47
773000 -- (-1279.671) (-1271.312) [-1277.568] (-1273.519) * (-1271.842) (-1277.124) (-1285.823) [-1272.771] -- 0:00:47
773500 -- (-1282.109) (-1273.939) (-1279.718) [-1269.347] * (-1271.710) (-1282.941) [-1270.144] (-1280.145) -- 0:00:47
774000 -- (-1281.213) [-1271.985] (-1275.952) (-1295.441) * (-1269.377) (-1279.688) (-1273.656) [-1275.178] -- 0:00:47
774500 -- (-1274.703) [-1275.026] (-1284.125) (-1274.993) * (-1281.884) (-1284.923) (-1275.293) [-1275.873] -- 0:00:46
775000 -- (-1271.774) (-1283.703) (-1270.436) [-1275.071] * (-1280.969) [-1284.622] (-1289.386) (-1276.020) -- 0:00:46
Average standard deviation of split frequencies: 0.004860
775500 -- (-1283.133) [-1277.582] (-1284.529) (-1281.989) * [-1275.772] (-1279.484) (-1282.250) (-1272.448) -- 0:00:46
776000 -- (-1279.362) [-1275.250] (-1282.343) (-1280.095) * (-1277.916) (-1286.582) (-1277.307) [-1271.865] -- 0:00:46
776500 -- (-1285.846) (-1273.188) (-1275.788) [-1272.387] * (-1277.231) (-1287.358) [-1276.985] (-1272.997) -- 0:00:46
777000 -- [-1276.732] (-1272.803) (-1279.613) (-1276.661) * (-1281.783) (-1284.424) (-1279.199) [-1269.468] -- 0:00:46
777500 -- (-1279.371) [-1273.534] (-1287.251) (-1286.524) * (-1272.050) (-1281.214) (-1275.901) [-1266.828] -- 0:00:46
778000 -- (-1282.608) (-1281.396) (-1271.727) [-1272.681] * [-1276.159] (-1269.668) (-1279.356) (-1276.388) -- 0:00:46
778500 -- [-1273.050] (-1279.895) (-1278.530) (-1270.441) * (-1289.547) [-1269.856] (-1290.625) (-1285.345) -- 0:00:46
779000 -- [-1274.544] (-1281.663) (-1287.533) (-1268.649) * (-1276.093) [-1266.927] (-1290.524) (-1288.555) -- 0:00:45
779500 -- (-1277.919) (-1275.128) (-1273.582) [-1274.166] * (-1270.918) (-1281.243) [-1277.215] (-1269.875) -- 0:00:45
780000 -- (-1273.887) (-1281.960) [-1270.924] (-1274.384) * [-1276.759] (-1285.841) (-1275.908) (-1275.678) -- 0:00:45
Average standard deviation of split frequencies: 0.004645
780500 -- (-1276.653) (-1275.540) [-1271.674] (-1272.060) * (-1273.324) [-1280.854] (-1289.142) (-1281.515) -- 0:00:45
781000 -- (-1279.212) (-1268.857) (-1273.880) [-1276.210] * [-1275.567] (-1286.677) (-1283.676) (-1275.594) -- 0:00:45
781500 -- [-1268.927] (-1274.456) (-1266.166) (-1293.755) * [-1271.151] (-1284.346) (-1282.227) (-1282.494) -- 0:00:45
782000 -- (-1275.807) [-1270.338] (-1286.910) (-1275.595) * (-1278.847) (-1284.019) (-1279.512) [-1281.728] -- 0:00:45
782500 -- (-1277.882) (-1278.614) (-1271.740) [-1277.215] * [-1270.935] (-1278.897) (-1279.046) (-1275.240) -- 0:00:45
783000 -- (-1275.480) (-1291.847) [-1273.528] (-1278.327) * (-1286.915) [-1283.884] (-1281.383) (-1273.720) -- 0:00:45
783500 -- (-1282.842) (-1287.780) (-1280.651) [-1270.059] * (-1276.149) (-1269.765) (-1276.533) [-1280.996] -- 0:00:45
784000 -- (-1281.106) (-1285.495) (-1279.050) [-1271.468] * (-1281.773) (-1276.623) (-1271.095) [-1276.760] -- 0:00:44
784500 -- (-1281.909) (-1284.238) [-1275.419] (-1279.817) * [-1274.123] (-1276.101) (-1289.034) (-1274.748) -- 0:00:44
785000 -- (-1284.256) [-1281.539] (-1273.375) (-1275.812) * (-1273.465) (-1276.511) [-1275.843] (-1285.547) -- 0:00:44
Average standard deviation of split frequencies: 0.005075
785500 -- (-1290.046) [-1265.022] (-1273.979) (-1272.716) * (-1281.603) [-1272.717] (-1274.351) (-1282.610) -- 0:00:44
786000 -- (-1300.084) [-1271.265] (-1284.803) (-1279.669) * [-1282.127] (-1286.543) (-1283.603) (-1274.178) -- 0:00:44
786500 -- (-1288.942) [-1273.404] (-1271.347) (-1279.390) * (-1281.641) [-1277.240] (-1270.824) (-1287.298) -- 0:00:44
787000 -- (-1277.382) [-1276.610] (-1270.987) (-1274.113) * [-1280.726] (-1275.102) (-1281.248) (-1276.974) -- 0:00:44
787500 -- (-1289.426) (-1279.020) [-1272.209] (-1290.336) * (-1281.116) (-1284.180) (-1281.639) [-1284.725] -- 0:00:44
788000 -- (-1280.147) [-1270.419] (-1283.648) (-1279.744) * (-1277.436) [-1276.088] (-1276.771) (-1289.629) -- 0:00:44
788500 -- [-1284.410] (-1282.926) (-1284.185) (-1289.691) * (-1285.291) [-1272.129] (-1283.400) (-1281.380) -- 0:00:43
789000 -- (-1288.723) (-1274.534) [-1271.948] (-1283.427) * [-1275.406] (-1276.259) (-1279.697) (-1282.734) -- 0:00:43
789500 -- (-1272.730) (-1274.671) (-1277.568) [-1278.629] * (-1272.460) (-1282.534) (-1280.853) [-1270.195] -- 0:00:43
790000 -- (-1273.734) (-1283.163) [-1275.961] (-1280.161) * (-1276.554) [-1271.858] (-1277.727) (-1276.647) -- 0:00:43
Average standard deviation of split frequencies: 0.004678
790500 -- [-1272.178] (-1281.823) (-1271.356) (-1276.267) * [-1281.467] (-1270.424) (-1286.219) (-1276.778) -- 0:00:43
791000 -- (-1275.201) [-1271.666] (-1274.448) (-1281.658) * (-1292.045) (-1275.558) (-1284.672) [-1270.801] -- 0:00:43
791500 -- (-1274.324) [-1272.082] (-1277.508) (-1281.896) * [-1283.520] (-1274.907) (-1283.136) (-1272.401) -- 0:00:43
792000 -- (-1277.003) (-1271.565) (-1278.407) [-1271.537] * (-1279.698) [-1270.975] (-1279.793) (-1275.213) -- 0:00:43
792500 -- (-1286.488) (-1279.495) [-1273.501] (-1278.631) * (-1279.599) (-1281.354) [-1272.571] (-1281.835) -- 0:00:43
793000 -- (-1279.877) [-1281.208] (-1275.664) (-1281.223) * (-1279.201) (-1277.819) [-1269.792] (-1273.236) -- 0:00:43
793500 -- (-1283.484) (-1286.150) [-1280.656] (-1272.353) * (-1277.650) [-1269.595] (-1276.420) (-1284.557) -- 0:00:42
794000 -- (-1278.774) (-1272.094) (-1284.493) [-1276.114] * [-1278.053] (-1275.209) (-1268.349) (-1277.607) -- 0:00:42
794500 -- (-1279.631) [-1276.696] (-1291.623) (-1286.453) * (-1281.679) (-1288.283) [-1273.518] (-1274.471) -- 0:00:42
795000 -- (-1294.085) (-1274.098) [-1276.247] (-1279.803) * (-1280.550) (-1287.429) [-1274.310] (-1275.619) -- 0:00:42
Average standard deviation of split frequencies: 0.004692
795500 -- (-1286.807) (-1281.081) [-1275.170] (-1293.624) * (-1272.499) (-1286.881) (-1280.343) [-1272.362] -- 0:00:42
796000 -- (-1284.077) (-1265.255) (-1272.362) [-1284.605] * (-1276.455) (-1282.323) (-1275.682) [-1269.826] -- 0:00:42
796500 -- (-1271.851) (-1268.546) (-1281.185) [-1273.723] * [-1274.941] (-1277.182) (-1281.050) (-1272.004) -- 0:00:42
797000 -- [-1273.488] (-1274.775) (-1278.218) (-1279.059) * (-1277.139) (-1275.457) [-1280.030] (-1274.607) -- 0:00:42
797500 -- (-1282.558) (-1281.722) (-1287.032) [-1269.193] * (-1273.290) [-1273.640] (-1277.321) (-1279.850) -- 0:00:42
798000 -- (-1276.663) [-1280.668] (-1274.191) (-1277.732) * [-1274.907] (-1269.602) (-1276.280) (-1277.329) -- 0:00:42
798500 -- (-1274.617) (-1280.279) [-1276.863] (-1270.773) * (-1284.367) [-1277.178] (-1285.875) (-1273.221) -- 0:00:41
799000 -- (-1276.427) (-1281.146) [-1283.395] (-1297.836) * (-1271.513) [-1277.959] (-1278.679) (-1273.125) -- 0:00:41
799500 -- [-1277.529] (-1273.037) (-1283.565) (-1271.121) * (-1272.761) [-1269.022] (-1285.638) (-1282.106) -- 0:00:41
800000 -- (-1279.997) (-1271.539) (-1273.902) [-1274.781] * [-1278.620] (-1277.296) (-1276.744) (-1278.438) -- 0:00:41
Average standard deviation of split frequencies: 0.004665
800500 -- (-1281.761) [-1273.374] (-1292.369) (-1271.085) * (-1285.549) [-1279.829] (-1277.224) (-1288.951) -- 0:00:41
801000 -- (-1274.102) (-1285.612) (-1288.377) [-1279.953] * (-1289.847) [-1270.483] (-1279.509) (-1286.680) -- 0:00:41
801500 -- [-1275.202] (-1279.504) (-1284.850) (-1285.849) * (-1283.875) (-1279.415) (-1270.481) [-1270.344] -- 0:00:41
802000 -- (-1267.001) [-1273.947] (-1278.757) (-1286.349) * (-1276.922) (-1272.154) [-1280.276] (-1281.005) -- 0:00:41
802500 -- (-1275.478) (-1274.277) [-1272.366] (-1289.882) * (-1281.208) [-1268.538] (-1271.194) (-1273.177) -- 0:00:41
803000 -- (-1286.708) (-1281.156) [-1273.888] (-1276.851) * [-1275.318] (-1279.813) (-1272.086) (-1280.290) -- 0:00:40
803500 -- (-1272.933) (-1277.055) (-1277.639) [-1269.728] * (-1287.834) (-1275.302) (-1267.375) [-1268.692] -- 0:00:40
804000 -- (-1277.269) (-1276.840) [-1284.915] (-1271.837) * (-1282.084) (-1285.387) [-1268.904] (-1276.501) -- 0:00:40
804500 -- (-1275.107) (-1270.415) (-1269.362) [-1279.678] * (-1281.420) (-1291.943) (-1272.103) [-1278.693] -- 0:00:40
805000 -- (-1276.552) (-1272.262) [-1274.404] (-1276.152) * (-1289.599) (-1285.171) [-1273.528] (-1273.995) -- 0:00:40
Average standard deviation of split frequencies: 0.004994
805500 -- (-1272.239) (-1286.824) [-1272.883] (-1273.158) * (-1278.934) (-1280.058) [-1275.328] (-1281.800) -- 0:00:40
806000 -- [-1271.147] (-1285.344) (-1278.513) (-1288.030) * [-1274.692] (-1279.721) (-1282.158) (-1280.846) -- 0:00:40
806500 -- (-1281.163) (-1284.548) [-1273.547] (-1284.584) * [-1277.780] (-1278.321) (-1269.440) (-1276.997) -- 0:00:40
807000 -- [-1279.978] (-1283.762) (-1274.432) (-1276.095) * [-1271.203] (-1281.303) (-1285.492) (-1285.332) -- 0:00:40
807500 -- (-1276.065) (-1283.556) [-1271.561] (-1275.467) * (-1276.651) [-1280.553] (-1274.113) (-1279.148) -- 0:00:40
808000 -- (-1279.995) [-1277.777] (-1285.804) (-1272.601) * (-1283.835) [-1272.682] (-1274.487) (-1276.022) -- 0:00:39
808500 -- (-1271.304) [-1282.347] (-1273.107) (-1279.874) * (-1288.159) (-1280.483) (-1275.818) [-1271.772] -- 0:00:39
809000 -- (-1283.343) (-1273.366) (-1280.135) [-1277.869] * [-1269.528] (-1269.205) (-1275.767) (-1278.585) -- 0:00:39
809500 -- (-1275.221) [-1273.547] (-1272.207) (-1275.143) * [-1281.691] (-1277.197) (-1290.789) (-1286.449) -- 0:00:39
810000 -- (-1287.234) [-1275.714] (-1282.110) (-1271.657) * [-1270.831] (-1271.540) (-1282.237) (-1290.083) -- 0:00:39
Average standard deviation of split frequencies: 0.004965
810500 -- [-1276.961] (-1272.482) (-1281.685) (-1291.448) * (-1280.080) (-1275.467) (-1273.509) [-1277.110] -- 0:00:39
811000 -- (-1275.705) [-1281.609] (-1272.173) (-1282.129) * (-1275.307) [-1278.011] (-1284.071) (-1274.691) -- 0:00:39
811500 -- (-1275.561) (-1287.723) [-1270.296] (-1276.769) * (-1275.809) (-1278.584) (-1272.170) [-1275.224] -- 0:00:39
812000 -- (-1279.159) (-1281.007) [-1276.292] (-1273.916) * [-1269.492] (-1274.864) (-1273.384) (-1276.974) -- 0:00:39
812500 -- (-1285.412) (-1277.547) (-1277.807) [-1269.973] * (-1275.430) (-1276.827) [-1274.170] (-1274.847) -- 0:00:39
813000 -- [-1271.993] (-1274.042) (-1277.258) (-1271.669) * (-1276.269) (-1278.471) [-1275.625] (-1275.401) -- 0:00:38
813500 -- (-1285.071) (-1266.958) (-1283.430) [-1275.842] * (-1276.817) (-1281.242) (-1285.745) [-1270.780] -- 0:00:38
814000 -- (-1281.165) [-1280.951] (-1274.592) (-1275.075) * [-1278.389] (-1270.464) (-1280.964) (-1277.842) -- 0:00:38
814500 -- (-1278.058) [-1278.658] (-1272.340) (-1276.454) * (-1281.108) [-1274.972] (-1274.615) (-1273.137) -- 0:00:38
815000 -- (-1275.628) [-1279.104] (-1284.236) (-1277.835) * (-1279.650) (-1273.492) [-1274.358] (-1285.723) -- 0:00:38
Average standard deviation of split frequencies: 0.004844
815500 -- (-1284.475) (-1291.162) (-1277.675) [-1281.451] * (-1274.105) (-1283.844) [-1271.615] (-1289.081) -- 0:00:38
816000 -- (-1274.615) (-1281.551) (-1275.544) [-1274.141] * (-1272.075) (-1278.109) [-1277.387] (-1281.273) -- 0:00:38
816500 -- (-1276.492) (-1281.795) (-1275.805) [-1275.823] * [-1273.398] (-1275.411) (-1282.747) (-1275.878) -- 0:00:38
817000 -- [-1278.026] (-1287.331) (-1279.809) (-1289.373) * (-1277.436) (-1275.567) [-1278.317] (-1277.793) -- 0:00:38
817500 -- (-1272.275) [-1279.679] (-1279.437) (-1275.526) * (-1280.484) [-1271.945] (-1268.526) (-1285.856) -- 0:00:37
818000 -- (-1283.397) (-1275.813) (-1274.736) [-1271.908] * (-1289.108) [-1278.984] (-1270.589) (-1276.903) -- 0:00:37
818500 -- (-1267.267) [-1268.766] (-1269.778) (-1288.914) * [-1271.275] (-1279.345) (-1272.887) (-1286.258) -- 0:00:37
819000 -- (-1278.015) [-1276.667] (-1283.867) (-1269.256) * (-1279.535) (-1277.271) [-1269.325] (-1288.632) -- 0:00:37
819500 -- (-1283.502) (-1272.013) (-1277.024) [-1277.377] * (-1280.577) (-1271.052) (-1281.037) [-1272.575] -- 0:00:37
820000 -- (-1277.941) (-1279.465) [-1269.045] (-1282.064) * (-1284.037) [-1272.362] (-1287.855) (-1278.168) -- 0:00:37
Average standard deviation of split frequencies: 0.004772
820500 -- (-1272.805) (-1275.080) [-1266.002] (-1277.179) * (-1275.169) (-1277.146) (-1287.206) [-1274.846] -- 0:00:37
821000 -- (-1280.916) [-1276.533] (-1280.753) (-1293.361) * (-1282.066) (-1284.910) (-1280.767) [-1270.646] -- 0:00:37
821500 -- (-1277.515) [-1269.146] (-1274.347) (-1280.088) * (-1278.748) (-1273.121) [-1271.760] (-1271.651) -- 0:00:37
822000 -- (-1279.219) (-1277.632) [-1272.114] (-1277.548) * (-1276.340) (-1273.732) [-1277.148] (-1283.305) -- 0:00:37
822500 -- [-1282.907] (-1286.641) (-1278.285) (-1284.782) * (-1279.096) [-1270.723] (-1268.423) (-1277.697) -- 0:00:36
823000 -- (-1272.170) (-1282.315) [-1277.418] (-1273.950) * (-1275.534) [-1271.719] (-1275.859) (-1282.358) -- 0:00:36
823500 -- (-1271.572) (-1284.557) (-1282.350) [-1273.523] * (-1280.766) [-1272.037] (-1284.735) (-1278.209) -- 0:00:36
824000 -- (-1274.388) (-1284.875) [-1269.016] (-1275.767) * (-1285.704) [-1276.833] (-1272.469) (-1273.550) -- 0:00:36
824500 -- [-1272.440] (-1288.487) (-1270.300) (-1272.604) * (-1274.368) [-1274.164] (-1277.128) (-1272.012) -- 0:00:36
825000 -- (-1275.967) (-1280.399) (-1281.228) [-1279.846] * (-1267.718) (-1278.817) (-1269.663) [-1279.366] -- 0:00:36
Average standard deviation of split frequencies: 0.005663
825500 -- (-1274.452) (-1281.109) (-1283.962) [-1271.273] * (-1279.332) (-1277.613) (-1273.313) [-1270.125] -- 0:00:36
826000 -- [-1269.785] (-1286.433) (-1273.003) (-1281.261) * (-1273.781) [-1274.483] (-1283.788) (-1278.215) -- 0:00:36
826500 -- (-1273.914) (-1276.102) [-1273.713] (-1272.494) * (-1277.033) (-1280.869) (-1279.195) [-1280.863] -- 0:00:36
827000 -- (-1275.109) [-1275.489] (-1275.707) (-1278.785) * [-1279.194] (-1292.635) (-1284.613) (-1275.140) -- 0:00:35
827500 -- [-1275.517] (-1282.052) (-1283.784) (-1277.724) * (-1274.576) (-1301.281) (-1278.351) [-1269.390] -- 0:00:35
828000 -- [-1283.190] (-1289.756) (-1276.086) (-1274.246) * (-1282.356) (-1283.883) (-1276.761) [-1275.258] -- 0:00:35
828500 -- (-1272.344) (-1286.793) (-1283.347) [-1276.759] * (-1282.361) [-1271.930] (-1273.673) (-1285.469) -- 0:00:35
829000 -- [-1265.802] (-1280.862) (-1280.651) (-1283.430) * [-1267.240] (-1286.954) (-1273.514) (-1278.247) -- 0:00:35
829500 -- [-1269.781] (-1270.968) (-1276.738) (-1271.367) * (-1279.644) [-1278.961] (-1277.979) (-1281.089) -- 0:00:35
830000 -- (-1293.709) [-1271.065] (-1279.353) (-1282.736) * (-1275.637) (-1268.395) (-1282.332) [-1272.983] -- 0:00:35
Average standard deviation of split frequencies: 0.005413
830500 -- (-1280.862) (-1275.769) [-1281.888] (-1280.841) * (-1274.877) [-1276.837] (-1289.573) (-1274.267) -- 0:00:35
831000 -- (-1276.587) (-1275.579) [-1279.519] (-1279.212) * (-1277.143) [-1280.182] (-1275.513) (-1277.416) -- 0:00:35
831500 -- (-1280.580) [-1268.161] (-1271.971) (-1271.110) * (-1278.044) (-1284.551) [-1280.407] (-1288.102) -- 0:00:35
832000 -- (-1279.964) (-1278.475) [-1283.619] (-1280.434) * (-1275.849) (-1276.172) [-1271.754] (-1286.302) -- 0:00:34
832500 -- (-1274.160) (-1277.199) [-1277.289] (-1280.027) * (-1272.029) [-1281.975] (-1275.221) (-1291.649) -- 0:00:34
833000 -- (-1273.341) (-1286.870) [-1272.725] (-1274.436) * [-1276.144] (-1273.854) (-1284.798) (-1281.770) -- 0:00:34
833500 -- (-1274.471) (-1272.580) (-1279.554) [-1268.898] * (-1276.718) (-1277.046) [-1268.691] (-1280.904) -- 0:00:34
834000 -- (-1281.512) (-1278.131) [-1271.225] (-1276.513) * (-1280.463) [-1277.179] (-1274.921) (-1276.078) -- 0:00:34
834500 -- (-1287.110) [-1278.403] (-1274.422) (-1273.219) * [-1271.847] (-1276.482) (-1273.433) (-1275.114) -- 0:00:34
835000 -- (-1289.304) (-1274.739) [-1275.775] (-1284.212) * (-1279.108) (-1273.970) (-1274.741) [-1271.817] -- 0:00:34
Average standard deviation of split frequencies: 0.005465
835500 -- (-1281.690) (-1277.558) (-1281.606) [-1279.507] * (-1271.411) [-1270.015] (-1279.600) (-1275.041) -- 0:00:34
836000 -- (-1279.764) [-1280.298] (-1275.149) (-1275.403) * (-1275.566) [-1272.906] (-1277.756) (-1269.526) -- 0:00:34
836500 -- (-1282.971) [-1275.048] (-1286.528) (-1272.686) * (-1280.263) (-1273.112) (-1288.220) [-1277.520] -- 0:00:34
837000 -- (-1283.231) [-1274.841] (-1285.724) (-1275.988) * (-1277.499) (-1285.051) [-1283.643] (-1266.421) -- 0:00:33
837500 -- (-1290.535) [-1273.089] (-1283.923) (-1271.945) * [-1270.867] (-1272.809) (-1283.131) (-1267.964) -- 0:00:33
838000 -- (-1287.903) (-1275.638) [-1276.063] (-1279.913) * [-1270.903] (-1276.450) (-1277.817) (-1274.437) -- 0:00:33
838500 -- [-1270.870] (-1273.260) (-1267.879) (-1279.687) * (-1276.065) [-1275.611] (-1293.590) (-1267.079) -- 0:00:33
839000 -- [-1268.871] (-1275.229) (-1277.280) (-1278.306) * (-1275.879) (-1277.391) (-1277.159) [-1268.362] -- 0:00:33
839500 -- (-1276.570) (-1278.715) (-1285.612) [-1275.283] * (-1281.074) (-1278.117) (-1270.518) [-1270.056] -- 0:00:33
840000 -- [-1277.492] (-1276.839) (-1279.853) (-1272.310) * (-1280.930) (-1278.257) [-1272.292] (-1284.269) -- 0:00:33
Average standard deviation of split frequencies: 0.005478
840500 -- (-1285.480) [-1271.763] (-1272.046) (-1275.638) * [-1278.587] (-1270.911) (-1273.886) (-1279.647) -- 0:00:33
841000 -- (-1282.006) [-1270.973] (-1291.781) (-1292.077) * (-1279.188) (-1276.253) [-1276.351] (-1271.727) -- 0:00:33
841500 -- (-1279.734) [-1277.632] (-1281.473) (-1276.779) * (-1271.951) [-1277.667] (-1270.064) (-1271.432) -- 0:00:32
842000 -- (-1272.845) [-1276.055] (-1277.794) (-1272.108) * (-1273.707) (-1275.991) [-1268.979] (-1270.987) -- 0:00:32
842500 -- (-1272.205) (-1277.439) (-1276.642) [-1278.184] * (-1273.576) (-1274.933) [-1272.296] (-1286.373) -- 0:00:32
843000 -- (-1272.681) (-1274.482) [-1271.523] (-1274.877) * (-1275.305) [-1273.399] (-1286.352) (-1277.266) -- 0:00:32
843500 -- (-1272.448) (-1277.494) (-1275.830) [-1285.131] * [-1275.240] (-1281.606) (-1279.137) (-1281.503) -- 0:00:32
844000 -- [-1275.775] (-1274.377) (-1279.642) (-1273.104) * (-1278.980) [-1271.606] (-1277.630) (-1278.540) -- 0:00:32
844500 -- (-1279.830) (-1278.153) [-1274.542] (-1276.165) * (-1280.483) (-1286.013) (-1281.360) [-1278.534] -- 0:00:32
845000 -- (-1284.845) (-1272.776) (-1275.359) [-1280.467] * [-1279.604] (-1277.674) (-1275.652) (-1270.712) -- 0:00:32
Average standard deviation of split frequencies: 0.005572
845500 -- (-1284.019) (-1269.557) (-1283.419) [-1281.987] * (-1281.998) (-1290.338) [-1273.550] (-1281.111) -- 0:00:32
846000 -- (-1276.748) (-1285.501) (-1281.028) [-1276.551] * (-1275.066) (-1291.995) [-1272.918] (-1291.004) -- 0:00:32
846500 -- (-1286.712) (-1273.906) (-1277.987) [-1267.714] * (-1276.746) (-1292.477) [-1273.254] (-1285.019) -- 0:00:31
847000 -- (-1281.373) [-1265.564] (-1274.435) (-1273.589) * [-1279.185] (-1280.769) (-1277.674) (-1291.079) -- 0:00:31
847500 -- [-1273.106] (-1273.753) (-1273.350) (-1272.421) * (-1276.605) (-1282.458) (-1275.093) [-1279.630] -- 0:00:31
848000 -- [-1277.004] (-1272.318) (-1274.551) (-1286.727) * (-1273.079) (-1287.526) [-1273.887] (-1277.696) -- 0:00:31
848500 -- (-1274.229) (-1274.006) (-1284.901) [-1278.967] * [-1271.654] (-1279.741) (-1276.939) (-1269.995) -- 0:00:31
849000 -- (-1289.390) [-1272.684] (-1284.072) (-1284.508) * (-1284.978) (-1287.116) (-1276.159) [-1271.414] -- 0:00:31
849500 -- [-1276.359] (-1268.098) (-1277.349) (-1287.789) * (-1278.628) (-1284.894) [-1269.984] (-1281.695) -- 0:00:31
850000 -- (-1285.330) (-1272.747) [-1278.690] (-1292.005) * [-1272.421] (-1283.729) (-1284.108) (-1276.443) -- 0:00:31
Average standard deviation of split frequencies: 0.005542
850500 -- (-1277.480) [-1273.022] (-1277.666) (-1289.290) * (-1270.590) (-1292.399) (-1274.915) [-1273.181] -- 0:00:31
851000 -- (-1279.969) [-1271.679] (-1280.092) (-1276.763) * (-1281.986) [-1271.800] (-1277.961) (-1277.191) -- 0:00:30
851500 -- (-1284.976) (-1280.815) (-1288.162) [-1282.684] * (-1276.699) (-1287.275) (-1278.564) [-1270.122] -- 0:00:30
852000 -- (-1277.558) (-1279.826) (-1278.995) [-1279.609] * (-1284.972) [-1276.988] (-1278.123) (-1282.012) -- 0:00:30
852500 -- (-1281.754) [-1278.225] (-1276.180) (-1275.541) * (-1291.635) (-1272.064) (-1297.049) [-1272.021] -- 0:00:30
853000 -- (-1284.559) (-1275.458) (-1275.698) [-1270.164] * [-1276.434] (-1276.159) (-1285.236) (-1277.947) -- 0:00:30
853500 -- (-1290.103) (-1283.944) (-1282.175) [-1267.697] * [-1274.414] (-1273.944) (-1280.632) (-1271.978) -- 0:00:30
854000 -- (-1278.981) (-1280.138) [-1271.467] (-1278.551) * (-1279.614) (-1297.103) (-1288.447) [-1276.007] -- 0:00:30
854500 -- [-1274.378] (-1278.510) (-1277.878) (-1272.735) * [-1277.027] (-1282.367) (-1278.702) (-1276.790) -- 0:00:30
855000 -- [-1275.169] (-1284.664) (-1272.872) (-1276.461) * [-1278.773] (-1283.358) (-1283.020) (-1284.759) -- 0:00:30
Average standard deviation of split frequencies: 0.006142
855500 -- (-1285.721) [-1277.738] (-1275.789) (-1282.181) * (-1278.043) (-1278.354) (-1274.213) [-1277.203] -- 0:00:30
856000 -- (-1278.292) [-1271.917] (-1277.649) (-1278.912) * (-1284.759) [-1272.901] (-1275.175) (-1282.835) -- 0:00:29
856500 -- (-1285.269) (-1278.383) [-1273.208] (-1270.514) * (-1280.192) (-1285.601) [-1275.700] (-1275.886) -- 0:00:29
857000 -- (-1275.205) (-1276.592) [-1271.408] (-1278.888) * (-1287.326) [-1268.132] (-1280.453) (-1285.852) -- 0:00:29
857500 -- (-1273.895) [-1272.934] (-1280.416) (-1271.806) * [-1279.956] (-1286.031) (-1285.333) (-1275.689) -- 0:00:29
858000 -- (-1281.393) (-1268.140) (-1282.838) [-1275.970] * (-1286.579) (-1270.223) [-1272.408] (-1276.030) -- 0:00:29
858500 -- (-1277.615) (-1269.537) [-1271.441] (-1274.435) * (-1279.265) [-1274.430] (-1291.921) (-1277.574) -- 0:00:29
859000 -- [-1280.779] (-1273.112) (-1280.769) (-1274.422) * [-1284.547] (-1282.945) (-1287.060) (-1283.525) -- 0:00:29
859500 -- (-1273.642) [-1270.353] (-1277.778) (-1287.346) * (-1283.422) [-1278.070] (-1284.766) (-1286.053) -- 0:00:29
860000 -- (-1276.970) (-1285.006) (-1283.705) [-1274.894] * (-1282.138) [-1281.022] (-1278.358) (-1282.597) -- 0:00:29
Average standard deviation of split frequencies: 0.005899
860500 -- (-1279.523) [-1269.250] (-1280.148) (-1274.812) * (-1279.378) (-1291.891) [-1269.047] (-1289.562) -- 0:00:29
861000 -- (-1291.304) [-1275.623] (-1284.527) (-1272.857) * (-1270.444) (-1281.519) [-1271.224] (-1285.234) -- 0:00:28
861500 -- (-1282.907) [-1271.916] (-1278.479) (-1273.277) * (-1273.859) (-1271.341) [-1282.559] (-1270.847) -- 0:00:28
862000 -- (-1274.914) [-1271.542] (-1274.223) (-1274.174) * (-1276.026) [-1274.645] (-1277.377) (-1277.557) -- 0:00:28
862500 -- (-1274.163) (-1272.689) (-1278.697) [-1275.900] * (-1269.529) [-1276.853] (-1279.570) (-1275.553) -- 0:00:28
863000 -- (-1277.324) [-1277.653] (-1280.049) (-1277.109) * (-1268.097) [-1287.037] (-1276.747) (-1274.048) -- 0:00:28
863500 -- (-1286.524) (-1281.078) (-1276.940) [-1290.527] * (-1276.936) (-1279.218) [-1273.832] (-1279.394) -- 0:00:28
864000 -- [-1273.359] (-1281.417) (-1279.801) (-1270.634) * (-1267.701) (-1275.006) (-1274.053) [-1276.780] -- 0:00:28
864500 -- [-1272.514] (-1267.845) (-1283.138) (-1269.196) * (-1281.304) (-1278.422) (-1277.133) [-1278.851] -- 0:00:28
865000 -- (-1279.057) [-1273.506] (-1275.554) (-1274.555) * (-1274.384) [-1270.316] (-1272.747) (-1281.554) -- 0:00:28
Average standard deviation of split frequencies: 0.005946
865500 -- [-1279.838] (-1276.653) (-1276.369) (-1279.531) * (-1274.989) (-1279.999) [-1279.205] (-1280.375) -- 0:00:27
866000 -- [-1277.853] (-1281.389) (-1276.622) (-1271.496) * [-1279.548] (-1276.148) (-1270.010) (-1272.134) -- 0:00:27
866500 -- (-1276.608) (-1280.206) (-1285.354) [-1274.622] * [-1271.251] (-1277.827) (-1280.316) (-1274.727) -- 0:00:27
867000 -- (-1276.047) (-1281.738) (-1276.696) [-1274.282] * [-1277.822] (-1274.905) (-1277.427) (-1275.922) -- 0:00:27
867500 -- (-1270.078) (-1280.252) (-1276.097) [-1274.152] * (-1273.135) [-1268.960] (-1283.688) (-1276.183) -- 0:00:27
868000 -- (-1276.301) [-1274.197] (-1271.989) (-1285.196) * (-1279.938) (-1281.912) (-1282.163) [-1270.471] -- 0:00:27
868500 -- (-1275.330) (-1281.833) [-1274.433] (-1274.771) * (-1287.215) [-1282.069] (-1279.325) (-1282.409) -- 0:00:27
869000 -- (-1279.629) (-1278.216) (-1283.061) [-1279.321] * (-1275.973) [-1271.575] (-1282.982) (-1272.271) -- 0:00:27
869500 -- [-1270.166] (-1280.033) (-1277.456) (-1280.201) * [-1277.587] (-1286.366) (-1289.337) (-1271.266) -- 0:00:27
870000 -- (-1278.603) (-1270.654) [-1279.727] (-1281.359) * (-1277.840) (-1284.374) (-1284.561) [-1269.702] -- 0:00:27
Average standard deviation of split frequencies: 0.005747
870500 -- (-1270.903) (-1291.952) [-1271.327] (-1275.759) * (-1280.569) (-1278.042) [-1282.512] (-1277.557) -- 0:00:26
871000 -- (-1272.300) (-1274.741) (-1287.785) [-1269.794] * [-1273.040] (-1275.484) (-1285.909) (-1277.957) -- 0:00:26
871500 -- (-1280.242) (-1274.738) (-1276.364) [-1269.598] * (-1270.432) [-1273.116] (-1272.323) (-1272.513) -- 0:00:26
872000 -- [-1274.336] (-1284.903) (-1276.859) (-1278.315) * (-1283.122) (-1278.139) (-1284.228) [-1274.146] -- 0:00:26
872500 -- (-1275.491) (-1276.336) [-1278.603] (-1273.590) * (-1270.651) (-1279.735) [-1273.475] (-1284.588) -- 0:00:26
873000 -- (-1282.951) (-1276.657) (-1277.830) [-1273.140] * (-1272.036) [-1276.239] (-1268.482) (-1290.570) -- 0:00:26
873500 -- [-1284.016] (-1277.840) (-1272.418) (-1285.463) * (-1281.659) (-1277.726) (-1274.674) [-1273.242] -- 0:00:26
874000 -- (-1291.948) (-1278.772) (-1267.907) [-1277.062] * (-1291.090) (-1273.487) [-1275.480] (-1287.719) -- 0:00:26
874500 -- (-1281.934) (-1275.321) [-1269.124] (-1266.967) * (-1277.925) [-1269.493] (-1274.919) (-1275.893) -- 0:00:26
875000 -- (-1280.476) [-1273.097] (-1291.423) (-1269.867) * [-1271.446] (-1282.653) (-1274.567) (-1278.204) -- 0:00:26
Average standard deviation of split frequencies: 0.005671
875500 -- (-1284.126) (-1281.629) (-1291.385) [-1279.977] * [-1277.042] (-1278.547) (-1280.564) (-1276.622) -- 0:00:25
876000 -- (-1282.227) (-1279.234) [-1275.036] (-1274.515) * [-1270.915] (-1270.218) (-1287.014) (-1272.334) -- 0:00:25
876500 -- [-1282.555] (-1284.457) (-1282.372) (-1278.472) * (-1276.964) (-1285.812) (-1279.922) [-1277.817] -- 0:00:25
877000 -- (-1276.046) (-1276.745) [-1274.670] (-1276.547) * [-1276.982] (-1272.081) (-1268.929) (-1275.283) -- 0:00:25
877500 -- (-1277.348) (-1276.856) [-1272.145] (-1280.086) * [-1268.859] (-1270.633) (-1291.303) (-1268.488) -- 0:00:25
878000 -- (-1277.946) [-1272.885] (-1273.807) (-1272.821) * (-1271.069) (-1277.664) [-1277.338] (-1285.656) -- 0:00:25
878500 -- (-1279.102) (-1278.255) (-1272.782) [-1268.307] * [-1269.619] (-1274.944) (-1277.192) (-1278.249) -- 0:00:25
879000 -- (-1290.038) [-1268.777] (-1286.480) (-1278.071) * [-1274.757] (-1272.767) (-1285.454) (-1275.175) -- 0:00:25
879500 -- [-1279.441] (-1273.174) (-1277.601) (-1276.888) * (-1277.558) [-1277.856] (-1286.741) (-1268.475) -- 0:00:25
880000 -- (-1285.125) (-1289.713) (-1273.623) [-1266.552] * [-1280.433] (-1281.595) (-1280.445) (-1273.088) -- 0:00:24
Average standard deviation of split frequencies: 0.005806
880500 -- [-1276.753] (-1285.473) (-1278.005) (-1270.011) * (-1270.925) (-1287.323) [-1276.480] (-1279.810) -- 0:00:24
881000 -- (-1282.098) (-1274.418) (-1276.081) [-1274.014] * (-1287.623) [-1284.350] (-1273.111) (-1278.900) -- 0:00:24
881500 -- (-1269.085) (-1283.519) (-1272.596) [-1273.878] * (-1293.038) (-1282.616) [-1278.293] (-1292.772) -- 0:00:24
882000 -- (-1279.861) (-1276.592) [-1270.464] (-1274.731) * (-1278.550) (-1276.768) [-1270.200] (-1288.058) -- 0:00:24
882500 -- (-1272.777) (-1279.483) (-1272.802) [-1280.665] * (-1287.897) (-1277.911) (-1276.298) [-1274.341] -- 0:00:24
883000 -- [-1272.252] (-1271.874) (-1279.579) (-1278.502) * (-1272.818) (-1277.552) (-1278.310) [-1278.914] -- 0:00:24
883500 -- (-1279.357) (-1287.455) (-1273.442) [-1269.718] * (-1294.468) (-1272.449) (-1281.934) [-1268.897] -- 0:00:24
884000 -- (-1272.914) [-1279.403] (-1285.280) (-1278.875) * [-1279.805] (-1275.349) (-1285.593) (-1280.759) -- 0:00:24
884500 -- (-1286.512) (-1277.811) [-1268.062] (-1275.547) * [-1282.822] (-1264.820) (-1285.675) (-1272.639) -- 0:00:24
885000 -- (-1271.731) (-1279.043) [-1275.402] (-1279.378) * (-1289.450) [-1281.474] (-1282.423) (-1278.248) -- 0:00:23
Average standard deviation of split frequencies: 0.005894
885500 -- (-1273.547) (-1273.806) [-1279.477] (-1280.995) * (-1277.596) [-1277.949] (-1275.477) (-1278.348) -- 0:00:23
886000 -- (-1279.186) (-1278.053) [-1271.707] (-1273.634) * (-1280.439) (-1281.293) [-1283.413] (-1270.597) -- 0:00:23
886500 -- [-1272.013] (-1285.424) (-1282.335) (-1275.234) * (-1280.016) (-1281.910) (-1278.468) [-1277.725] -- 0:00:23
887000 -- (-1269.251) (-1274.708) (-1275.449) [-1273.070] * (-1282.469) (-1283.595) [-1269.575] (-1280.015) -- 0:00:23
887500 -- [-1269.582] (-1274.430) (-1273.640) (-1284.892) * (-1281.627) [-1269.751] (-1277.544) (-1266.463) -- 0:00:23
888000 -- (-1275.945) (-1277.126) [-1271.880] (-1293.530) * (-1281.213) [-1275.195] (-1271.829) (-1273.629) -- 0:00:23
888500 -- [-1283.483] (-1270.841) (-1273.182) (-1285.029) * (-1276.705) (-1277.966) (-1272.554) [-1281.322] -- 0:00:23
889000 -- [-1272.029] (-1282.563) (-1273.189) (-1292.002) * [-1278.692] (-1280.418) (-1279.133) (-1280.213) -- 0:00:23
889500 -- (-1271.222) [-1280.049] (-1271.364) (-1284.054) * (-1272.507) (-1289.382) (-1280.945) [-1273.772] -- 0:00:22
890000 -- [-1284.597] (-1281.265) (-1274.382) (-1281.054) * [-1270.318] (-1289.824) (-1278.610) (-1273.383) -- 0:00:22
Average standard deviation of split frequencies: 0.006148
890500 -- (-1281.088) [-1277.170] (-1269.022) (-1275.554) * (-1282.669) (-1277.062) (-1279.975) [-1273.448] -- 0:00:22
891000 -- (-1268.897) [-1272.656] (-1276.593) (-1273.395) * (-1276.901) (-1275.699) [-1270.649] (-1277.604) -- 0:00:22
891500 -- (-1273.258) (-1276.698) (-1270.453) [-1275.104] * [-1281.058] (-1271.788) (-1280.180) (-1280.019) -- 0:00:22
892000 -- (-1271.796) [-1267.062] (-1275.358) (-1279.805) * (-1278.357) (-1273.602) [-1274.560] (-1283.180) -- 0:00:22
892500 -- (-1274.585) (-1277.884) (-1268.916) [-1271.347] * (-1277.245) (-1272.803) (-1275.546) [-1284.029] -- 0:00:22
893000 -- (-1280.721) (-1281.755) (-1277.290) [-1273.706] * (-1275.528) (-1280.419) (-1279.851) [-1270.778] -- 0:00:22
893500 -- (-1270.104) (-1276.256) [-1268.618] (-1269.025) * (-1274.955) (-1283.779) (-1285.101) [-1275.212] -- 0:00:22
894000 -- [-1270.272] (-1284.460) (-1268.654) (-1274.793) * (-1272.300) (-1290.152) (-1285.888) [-1264.187] -- 0:00:22
894500 -- (-1277.325) (-1273.987) [-1271.706] (-1286.770) * (-1277.489) (-1292.837) [-1269.112] (-1273.275) -- 0:00:21
895000 -- (-1284.243) [-1272.766] (-1280.458) (-1277.037) * (-1274.921) (-1281.608) (-1278.899) [-1270.414] -- 0:00:21
Average standard deviation of split frequencies: 0.005949
895500 -- [-1279.807] (-1268.487) (-1286.185) (-1274.527) * (-1290.402) (-1295.672) [-1274.080] (-1290.732) -- 0:00:21
896000 -- (-1284.012) (-1277.199) [-1276.437] (-1270.157) * (-1292.547) (-1272.972) (-1271.479) [-1269.929] -- 0:00:21
896500 -- (-1270.315) (-1269.528) [-1278.902] (-1291.096) * [-1276.639] (-1279.125) (-1292.053) (-1271.546) -- 0:00:21
897000 -- (-1276.613) (-1277.988) (-1277.541) [-1278.272] * (-1279.422) (-1281.501) (-1272.549) [-1278.882] -- 0:00:21
897500 -- (-1277.494) (-1284.162) [-1275.514] (-1274.745) * (-1274.935) (-1280.235) (-1274.974) [-1282.594] -- 0:00:21
898000 -- [-1275.624] (-1272.790) (-1281.906) (-1276.655) * (-1287.128) [-1280.334] (-1276.202) (-1285.820) -- 0:00:21
898500 -- (-1288.802) (-1271.638) (-1284.271) [-1264.318] * (-1267.794) (-1278.321) [-1272.046] (-1276.606) -- 0:00:21
899000 -- (-1284.572) [-1275.104] (-1278.048) (-1276.953) * (-1274.762) [-1277.480] (-1276.931) (-1287.494) -- 0:00:21
899500 -- (-1279.221) (-1275.573) [-1279.427] (-1272.008) * (-1279.294) [-1276.066] (-1287.051) (-1293.611) -- 0:00:20
900000 -- (-1285.637) (-1277.867) [-1279.693] (-1277.380) * (-1271.067) [-1271.333] (-1277.190) (-1277.160) -- 0:00:20
Average standard deviation of split frequencies: 0.005717
900500 -- (-1271.687) (-1273.542) (-1277.979) [-1269.504] * (-1273.686) (-1279.536) [-1274.070] (-1285.083) -- 0:00:20
901000 -- [-1270.597] (-1282.078) (-1275.780) (-1276.797) * [-1273.603] (-1286.415) (-1276.781) (-1274.742) -- 0:00:20
901500 -- (-1278.638) (-1291.236) (-1290.240) [-1273.585] * (-1272.812) (-1270.568) [-1266.839] (-1273.044) -- 0:00:20
902000 -- (-1269.681) [-1270.340] (-1288.427) (-1275.978) * (-1276.034) [-1285.772] (-1282.708) (-1281.050) -- 0:00:20
902500 -- (-1277.681) (-1278.608) (-1274.242) [-1271.055] * (-1276.000) [-1271.109] (-1274.132) (-1278.164) -- 0:00:20
903000 -- (-1294.567) [-1271.573] (-1276.695) (-1278.941) * (-1276.375) [-1271.242] (-1278.919) (-1285.303) -- 0:00:20
903500 -- (-1283.124) (-1284.585) [-1272.666] (-1274.144) * (-1276.285) (-1283.727) [-1272.588] (-1276.445) -- 0:00:20
904000 -- [-1277.241] (-1280.326) (-1273.334) (-1288.664) * (-1285.728) (-1285.166) (-1271.191) [-1275.549] -- 0:00:19
904500 -- (-1273.732) [-1277.968] (-1280.297) (-1280.673) * (-1278.029) (-1278.836) [-1272.400] (-1277.389) -- 0:00:19
905000 -- [-1273.660] (-1273.396) (-1272.996) (-1286.545) * (-1268.435) (-1274.261) [-1274.774] (-1277.613) -- 0:00:19
Average standard deviation of split frequencies: 0.005443
905500 -- [-1267.169] (-1275.324) (-1274.113) (-1288.232) * (-1285.940) [-1268.117] (-1273.627) (-1277.832) -- 0:00:19
906000 -- [-1284.327] (-1277.576) (-1282.935) (-1288.120) * (-1286.314) (-1273.579) [-1281.535] (-1276.815) -- 0:00:19
906500 -- [-1277.184] (-1278.422) (-1279.655) (-1285.342) * (-1275.892) (-1277.886) [-1272.293] (-1286.854) -- 0:00:19
907000 -- (-1271.664) [-1281.047] (-1297.669) (-1279.642) * (-1279.049) [-1271.890] (-1272.501) (-1277.972) -- 0:00:19
907500 -- [-1269.641] (-1283.874) (-1281.372) (-1279.829) * (-1281.985) (-1280.572) (-1279.917) [-1264.234] -- 0:00:19
908000 -- (-1280.290) (-1273.430) (-1287.389) [-1274.376] * (-1276.489) [-1268.326] (-1282.123) (-1274.259) -- 0:00:19
908500 -- (-1278.436) (-1279.582) (-1278.150) [-1275.577] * (-1274.249) (-1276.131) (-1279.750) [-1275.951] -- 0:00:19
909000 -- (-1283.081) [-1271.788] (-1276.456) (-1277.359) * (-1278.120) (-1271.908) (-1280.524) [-1274.408] -- 0:00:18
909500 -- (-1278.011) [-1268.941] (-1280.438) (-1278.479) * (-1277.033) [-1271.891] (-1276.716) (-1270.467) -- 0:00:18
910000 -- [-1274.774] (-1276.769) (-1293.299) (-1281.245) * (-1279.109) (-1270.476) [-1279.326] (-1276.421) -- 0:00:18
Average standard deviation of split frequencies: 0.005694
910500 -- [-1275.571] (-1288.048) (-1290.318) (-1297.177) * (-1283.102) [-1270.234] (-1288.884) (-1280.548) -- 0:00:18
911000 -- (-1284.786) [-1274.038] (-1275.705) (-1276.462) * (-1281.188) [-1276.006] (-1289.772) (-1273.682) -- 0:00:18
911500 -- (-1280.086) (-1285.948) [-1275.233] (-1290.087) * (-1284.811) (-1272.332) (-1287.328) [-1274.979] -- 0:00:18
912000 -- (-1272.674) (-1276.917) (-1277.109) [-1288.979] * [-1279.755] (-1266.047) (-1289.342) (-1289.076) -- 0:00:18
912500 -- (-1273.693) (-1275.546) (-1280.523) [-1277.936] * [-1276.735] (-1277.232) (-1302.614) (-1285.700) -- 0:00:18
913000 -- (-1279.849) (-1278.104) (-1276.977) [-1272.108] * [-1273.671] (-1282.208) (-1282.483) (-1282.379) -- 0:00:18
913500 -- [-1268.948] (-1275.010) (-1280.975) (-1277.052) * (-1289.095) [-1272.233] (-1277.626) (-1276.850) -- 0:00:17
914000 -- (-1277.412) (-1274.852) (-1277.393) [-1271.408] * (-1278.195) [-1276.038] (-1275.031) (-1270.387) -- 0:00:17
914500 -- (-1274.489) (-1277.333) (-1287.374) [-1272.362] * (-1275.639) (-1273.508) (-1276.423) [-1276.286] -- 0:00:17
915000 -- (-1281.777) (-1270.056) (-1289.719) [-1273.441] * [-1272.943] (-1280.810) (-1281.826) (-1274.319) -- 0:00:17
Average standard deviation of split frequencies: 0.005582
915500 -- (-1283.503) (-1279.768) (-1275.296) [-1274.554] * [-1277.955] (-1278.415) (-1280.049) (-1280.032) -- 0:00:17
916000 -- (-1285.634) (-1274.127) (-1281.129) [-1269.848] * (-1278.258) (-1276.902) (-1276.471) [-1275.673] -- 0:00:17
916500 -- (-1283.407) [-1270.083] (-1277.866) (-1276.875) * (-1289.452) (-1271.178) [-1274.237] (-1285.340) -- 0:00:17
917000 -- (-1275.599) (-1278.014) [-1285.451] (-1278.266) * [-1275.358] (-1285.405) (-1278.909) (-1274.312) -- 0:00:17
917500 -- (-1275.758) (-1274.393) (-1280.606) [-1277.362] * (-1275.503) (-1273.191) [-1270.418] (-1287.574) -- 0:00:17
918000 -- (-1272.601) [-1273.699] (-1288.792) (-1273.736) * (-1280.761) (-1271.529) [-1275.263] (-1273.715) -- 0:00:17
918500 -- (-1285.244) [-1277.287] (-1288.469) (-1281.716) * (-1278.542) (-1282.554) (-1283.472) [-1273.372] -- 0:00:16
919000 -- (-1279.838) [-1275.039] (-1285.070) (-1292.522) * (-1285.409) (-1281.693) (-1274.779) [-1279.455] -- 0:00:16
919500 -- (-1281.140) (-1274.127) (-1285.532) [-1282.313] * (-1276.286) (-1281.280) (-1286.201) [-1273.512] -- 0:00:16
920000 -- (-1270.514) [-1277.142] (-1284.399) (-1287.924) * (-1281.894) (-1285.643) (-1277.710) [-1275.118] -- 0:00:16
Average standard deviation of split frequencies: 0.005396
920500 -- (-1271.315) (-1281.000) (-1277.454) [-1278.891] * (-1281.097) (-1286.085) (-1280.579) [-1267.254] -- 0:00:16
921000 -- [-1276.461] (-1281.321) (-1287.567) (-1271.709) * [-1268.262] (-1282.041) (-1278.148) (-1274.986) -- 0:00:16
921500 -- (-1280.821) (-1266.481) (-1275.986) [-1276.064] * (-1280.045) (-1275.997) (-1279.388) [-1271.021] -- 0:00:16
922000 -- (-1279.086) [-1273.602] (-1277.577) (-1279.163) * (-1279.916) (-1276.155) [-1273.795] (-1271.168) -- 0:00:16
922500 -- (-1276.251) (-1277.004) (-1283.278) [-1272.646] * [-1275.104] (-1280.178) (-1277.133) (-1280.113) -- 0:00:16
923000 -- (-1269.693) (-1272.481) (-1285.473) [-1274.612] * (-1283.352) (-1279.472) [-1266.254] (-1274.188) -- 0:00:16
923500 -- (-1268.798) (-1278.753) (-1296.517) [-1272.205] * (-1286.402) (-1289.031) [-1266.881] (-1270.206) -- 0:00:15
924000 -- (-1278.818) [-1276.574] (-1289.145) (-1276.492) * (-1272.709) (-1274.347) [-1269.519] (-1278.043) -- 0:00:15
924500 -- (-1278.316) (-1284.786) (-1273.519) [-1275.243] * (-1276.535) (-1286.994) [-1272.837] (-1281.246) -- 0:00:15
925000 -- (-1288.264) (-1277.182) (-1274.737) [-1288.565] * [-1285.930] (-1288.805) (-1273.975) (-1268.769) -- 0:00:15
Average standard deviation of split frequencies: 0.005561
925500 -- (-1284.537) (-1273.298) [-1279.000] (-1277.311) * (-1283.452) (-1279.234) [-1271.424] (-1277.242) -- 0:00:15
926000 -- (-1290.409) [-1276.168] (-1273.124) (-1268.070) * (-1288.972) [-1286.573] (-1275.216) (-1272.745) -- 0:00:15
926500 -- (-1285.754) [-1273.368] (-1280.315) (-1282.454) * (-1278.183) (-1281.467) (-1274.931) [-1272.505] -- 0:00:15
927000 -- [-1281.511] (-1281.236) (-1281.035) (-1277.370) * (-1282.449) (-1276.506) (-1273.875) [-1277.953] -- 0:00:15
927500 -- [-1273.825] (-1281.492) (-1272.114) (-1272.774) * (-1266.847) (-1273.242) (-1266.376) [-1272.631] -- 0:00:15
928000 -- (-1284.116) [-1268.435] (-1267.802) (-1267.621) * [-1269.669] (-1273.815) (-1271.803) (-1270.584) -- 0:00:14
928500 -- (-1289.510) (-1280.921) [-1271.844] (-1274.319) * (-1274.983) [-1274.857] (-1291.476) (-1269.850) -- 0:00:14
929000 -- (-1274.597) (-1270.104) [-1277.361] (-1280.104) * [-1275.127] (-1283.092) (-1281.803) (-1271.399) -- 0:00:14
929500 -- (-1274.784) [-1265.617] (-1284.908) (-1281.132) * [-1271.886] (-1284.167) (-1272.121) (-1273.632) -- 0:00:14
930000 -- (-1275.035) (-1281.646) (-1284.841) [-1279.881] * (-1274.872) (-1281.380) (-1274.510) [-1276.815] -- 0:00:14
Average standard deviation of split frequencies: 0.005338
930500 -- [-1271.879] (-1272.465) (-1287.761) (-1269.025) * (-1271.153) (-1280.773) [-1275.572] (-1268.445) -- 0:00:14
931000 -- (-1273.607) [-1276.216] (-1268.925) (-1275.481) * (-1271.954) (-1278.240) (-1279.481) [-1276.850] -- 0:00:14
931500 -- [-1267.850] (-1272.918) (-1276.552) (-1276.389) * (-1295.502) [-1278.826] (-1279.614) (-1275.441) -- 0:00:14
932000 -- (-1277.628) (-1280.004) (-1287.631) [-1277.272] * (-1271.764) (-1280.013) (-1284.662) [-1265.822] -- 0:00:14
932500 -- (-1278.485) [-1273.124] (-1273.996) (-1276.003) * (-1282.735) (-1274.092) (-1272.722) [-1266.811] -- 0:00:14
933000 -- (-1275.769) (-1287.049) (-1272.036) [-1268.400] * (-1272.864) (-1281.574) (-1277.546) [-1274.021] -- 0:00:13
933500 -- (-1283.700) (-1276.449) [-1269.789] (-1271.589) * (-1278.760) (-1274.391) [-1270.987] (-1272.103) -- 0:00:13
934000 -- [-1275.083] (-1283.889) (-1272.398) (-1273.697) * (-1273.921) (-1281.617) [-1280.792] (-1280.258) -- 0:00:13
934500 -- (-1273.683) [-1274.497] (-1284.949) (-1273.050) * (-1291.847) [-1275.149] (-1269.901) (-1276.969) -- 0:00:13
935000 -- (-1273.068) (-1281.100) [-1273.990] (-1284.022) * (-1281.845) [-1266.290] (-1276.610) (-1272.552) -- 0:00:13
Average standard deviation of split frequencies: 0.005230
935500 -- [-1275.441] (-1277.612) (-1281.501) (-1281.643) * [-1274.567] (-1281.499) (-1287.635) (-1277.391) -- 0:00:13
936000 -- (-1276.920) [-1277.636] (-1276.339) (-1286.456) * (-1276.220) (-1288.753) (-1287.616) [-1273.339] -- 0:00:13
936500 -- (-1276.164) [-1273.457] (-1270.697) (-1286.309) * [-1276.185] (-1275.886) (-1294.997) (-1279.423) -- 0:00:13
937000 -- (-1273.493) (-1276.442) [-1274.345] (-1273.179) * (-1278.242) [-1279.582] (-1280.535) (-1283.578) -- 0:00:13
937500 -- [-1272.089] (-1271.400) (-1275.161) (-1280.063) * (-1281.586) (-1274.444) [-1279.126] (-1272.192) -- 0:00:13
938000 -- (-1278.661) [-1274.871] (-1282.366) (-1280.463) * (-1273.702) (-1275.548) (-1283.196) [-1275.743] -- 0:00:12
938500 -- (-1280.942) (-1279.206) [-1274.730] (-1279.987) * [-1269.609] (-1273.828) (-1274.142) (-1275.528) -- 0:00:12
939000 -- (-1274.964) [-1276.503] (-1292.187) (-1274.335) * [-1268.006] (-1277.525) (-1281.787) (-1285.936) -- 0:00:12
939500 -- (-1274.893) [-1274.753] (-1274.417) (-1276.363) * [-1275.623] (-1280.238) (-1280.328) (-1276.101) -- 0:00:12
940000 -- (-1274.676) [-1269.081] (-1270.654) (-1278.992) * (-1274.098) (-1277.995) (-1276.056) [-1276.369] -- 0:00:12
Average standard deviation of split frequencies: 0.005204
940500 -- [-1276.246] (-1271.969) (-1281.774) (-1270.823) * (-1275.452) [-1272.189] (-1273.357) (-1281.074) -- 0:00:12
941000 -- (-1268.664) (-1268.747) (-1276.120) [-1273.000] * [-1275.431] (-1279.945) (-1280.275) (-1278.780) -- 0:00:12
941500 -- (-1279.077) (-1278.070) [-1273.103] (-1280.709) * [-1285.172] (-1278.261) (-1282.187) (-1284.950) -- 0:00:12
942000 -- (-1264.385) [-1276.122] (-1284.370) (-1280.974) * (-1276.938) [-1270.485] (-1286.596) (-1275.629) -- 0:00:12
942500 -- (-1268.866) [-1269.613] (-1277.709) (-1287.105) * (-1270.109) (-1282.308) [-1276.758] (-1275.845) -- 0:00:11
943000 -- [-1277.355] (-1272.504) (-1284.803) (-1274.916) * (-1275.561) (-1278.377) [-1270.769] (-1280.651) -- 0:00:11
943500 -- (-1279.886) (-1278.131) (-1277.868) [-1278.820] * (-1286.419) [-1272.679] (-1270.545) (-1274.541) -- 0:00:11
944000 -- (-1280.513) (-1278.631) (-1281.458) [-1280.882] * (-1294.977) [-1280.816] (-1273.267) (-1272.293) -- 0:00:11
944500 -- (-1277.110) [-1276.000] (-1272.204) (-1284.782) * (-1274.596) (-1274.684) [-1270.192] (-1272.082) -- 0:00:11
945000 -- (-1272.870) (-1272.116) [-1275.426] (-1270.815) * (-1279.387) (-1271.453) (-1283.599) [-1278.353] -- 0:00:11
Average standard deviation of split frequencies: 0.005405
945500 -- [-1269.286] (-1286.575) (-1276.814) (-1275.899) * (-1278.902) (-1270.546) (-1272.718) [-1275.367] -- 0:00:11
946000 -- [-1271.698] (-1286.768) (-1275.557) (-1290.423) * (-1285.517) (-1276.724) [-1282.532] (-1279.797) -- 0:00:11
946500 -- (-1275.199) (-1268.119) (-1287.567) [-1272.184] * (-1279.332) (-1278.512) (-1274.768) [-1272.278] -- 0:00:11
947000 -- (-1276.439) [-1274.535] (-1272.387) (-1271.692) * (-1275.203) (-1282.729) (-1274.509) [-1267.112] -- 0:00:11
947500 -- [-1282.241] (-1283.029) (-1281.872) (-1277.903) * (-1279.633) (-1288.089) [-1269.814] (-1269.828) -- 0:00:10
948000 -- (-1283.140) (-1274.638) [-1277.734] (-1278.373) * (-1281.838) (-1280.931) [-1274.771] (-1272.227) -- 0:00:10
948500 -- (-1275.556) [-1277.158] (-1279.900) (-1277.536) * [-1278.282] (-1279.647) (-1287.583) (-1276.566) -- 0:00:10
949000 -- (-1286.158) (-1277.775) (-1277.331) [-1269.516] * [-1275.706] (-1285.710) (-1275.619) (-1274.498) -- 0:00:10
949500 -- (-1277.795) [-1266.189] (-1277.391) (-1275.166) * (-1279.460) [-1281.304] (-1276.711) (-1284.828) -- 0:00:10
950000 -- [-1278.211] (-1276.084) (-1274.619) (-1283.736) * (-1272.541) [-1274.988] (-1278.064) (-1285.259) -- 0:00:10
Average standard deviation of split frequencies: 0.005226
950500 -- (-1272.644) (-1276.785) [-1274.020] (-1274.708) * (-1276.790) [-1268.913] (-1277.655) (-1275.306) -- 0:00:10
951000 -- (-1282.916) (-1270.185) [-1271.215] (-1280.678) * [-1267.731] (-1278.915) (-1288.550) (-1280.334) -- 0:00:10
951500 -- (-1281.565) [-1267.863] (-1275.393) (-1275.397) * (-1270.143) (-1270.659) (-1289.412) [-1276.629] -- 0:00:10
952000 -- (-1271.774) (-1273.412) [-1276.209] (-1282.575) * (-1269.559) (-1277.574) (-1281.511) [-1281.554] -- 0:00:09
952500 -- (-1272.732) (-1275.902) (-1272.692) [-1278.779] * (-1271.555) [-1276.100] (-1282.107) (-1277.532) -- 0:00:09
953000 -- (-1287.229) (-1274.799) [-1278.563] (-1282.575) * (-1272.464) (-1272.618) [-1271.659] (-1287.305) -- 0:00:09
953500 -- (-1282.164) [-1269.967] (-1271.242) (-1280.846) * (-1275.086) (-1270.354) [-1274.903] (-1288.021) -- 0:00:09
954000 -- [-1270.292] (-1265.050) (-1283.437) (-1282.799) * (-1275.720) (-1283.115) (-1276.557) [-1274.353] -- 0:00:09
954500 -- (-1279.716) (-1279.748) (-1274.245) [-1273.803] * [-1281.388] (-1275.197) (-1280.030) (-1277.546) -- 0:00:09
955000 -- (-1276.051) (-1276.093) (-1286.047) [-1266.849] * (-1275.712) (-1286.171) (-1282.186) [-1275.868] -- 0:00:09
Average standard deviation of split frequencies: 0.005310
955500 -- (-1277.836) [-1270.359] (-1280.053) (-1268.770) * (-1270.568) (-1284.947) (-1280.790) [-1280.145] -- 0:00:09
956000 -- (-1267.127) [-1276.282] (-1279.816) (-1283.651) * [-1274.707] (-1283.008) (-1270.721) (-1281.241) -- 0:00:09
956500 -- (-1274.144) (-1281.398) [-1270.316] (-1272.371) * (-1274.580) [-1279.600] (-1268.471) (-1273.842) -- 0:00:09
957000 -- (-1279.338) (-1277.627) (-1271.237) [-1274.332] * (-1281.154) [-1273.362] (-1276.617) (-1270.452) -- 0:00:08
957500 -- (-1278.475) (-1280.734) [-1267.708] (-1277.022) * (-1280.291) (-1278.415) [-1275.476] (-1287.535) -- 0:00:08
958000 -- (-1286.607) [-1272.324] (-1272.215) (-1278.942) * (-1270.538) (-1294.937) (-1279.445) [-1276.823] -- 0:00:08
958500 -- [-1276.381] (-1278.379) (-1280.679) (-1286.981) * [-1272.188] (-1275.879) (-1278.274) (-1286.163) -- 0:00:08
959000 -- (-1271.656) (-1278.469) [-1270.919] (-1275.954) * (-1282.960) (-1281.007) [-1272.359] (-1279.727) -- 0:00:08
959500 -- [-1271.140] (-1292.630) (-1278.848) (-1265.356) * [-1271.752] (-1282.953) (-1272.176) (-1270.058) -- 0:00:08
960000 -- [-1279.946] (-1289.575) (-1275.558) (-1276.637) * [-1275.249] (-1272.956) (-1278.855) (-1271.536) -- 0:00:08
Average standard deviation of split frequencies: 0.005020
960500 -- (-1278.658) (-1282.804) [-1278.500] (-1276.696) * (-1275.924) [-1272.273] (-1276.918) (-1272.423) -- 0:00:08
961000 -- [-1277.351] (-1274.631) (-1273.984) (-1277.459) * (-1278.140) (-1277.390) (-1275.185) [-1272.917] -- 0:00:08
961500 -- [-1283.690] (-1274.101) (-1275.158) (-1270.208) * (-1276.315) (-1288.859) [-1270.870] (-1271.994) -- 0:00:08
962000 -- (-1281.994) (-1272.759) [-1278.294] (-1270.009) * (-1292.873) (-1276.184) [-1270.679] (-1283.115) -- 0:00:07
962500 -- (-1287.793) [-1276.611] (-1280.198) (-1284.340) * (-1274.914) (-1283.766) [-1267.027] (-1282.859) -- 0:00:07
963000 -- (-1277.568) [-1269.290] (-1287.649) (-1274.724) * (-1277.714) (-1277.283) (-1275.750) [-1274.786] -- 0:00:07
963500 -- (-1276.743) (-1276.587) [-1276.885] (-1271.021) * (-1273.327) (-1277.986) [-1275.563] (-1271.044) -- 0:00:07
964000 -- (-1276.634) (-1276.352) [-1275.210] (-1287.917) * (-1276.819) [-1277.458] (-1284.321) (-1275.310) -- 0:00:07
964500 -- [-1282.938] (-1273.006) (-1269.384) (-1287.080) * [-1271.457] (-1281.407) (-1277.309) (-1276.598) -- 0:00:07
965000 -- (-1271.684) [-1270.184] (-1281.006) (-1274.394) * [-1282.126] (-1283.001) (-1272.669) (-1288.880) -- 0:00:07
Average standard deviation of split frequencies: 0.004392
965500 -- (-1283.927) (-1279.486) (-1283.386) [-1273.799] * (-1271.782) (-1276.545) (-1286.973) [-1277.953] -- 0:00:07
966000 -- [-1279.572] (-1281.213) (-1278.658) (-1290.187) * [-1269.821] (-1285.309) (-1285.001) (-1279.715) -- 0:00:07
966500 -- (-1269.899) (-1274.955) (-1280.475) [-1279.087] * (-1293.262) (-1288.624) [-1274.256] (-1271.460) -- 0:00:06
967000 -- (-1272.991) (-1279.410) (-1273.276) [-1277.415] * (-1274.748) (-1281.964) (-1272.153) [-1277.979] -- 0:00:06
967500 -- (-1279.860) [-1270.925] (-1275.515) (-1279.287) * (-1282.021) (-1277.069) [-1270.876] (-1283.456) -- 0:00:06
968000 -- (-1288.668) (-1276.955) [-1278.824] (-1275.448) * (-1279.699) (-1280.748) [-1277.521] (-1286.098) -- 0:00:06
968500 -- (-1284.829) (-1273.286) [-1271.626] (-1280.017) * [-1276.044] (-1270.189) (-1272.256) (-1282.381) -- 0:00:06
969000 -- (-1279.354) [-1275.485] (-1272.898) (-1284.125) * (-1281.041) [-1271.244] (-1275.551) (-1281.798) -- 0:00:06
969500 -- (-1271.204) (-1275.583) (-1283.705) [-1277.721] * (-1281.327) [-1265.653] (-1283.568) (-1275.788) -- 0:00:06
970000 -- [-1279.038] (-1278.724) (-1271.613) (-1277.938) * (-1295.859) (-1279.160) (-1273.053) [-1269.100] -- 0:00:06
Average standard deviation of split frequencies: 0.004446
970500 -- (-1270.924) [-1271.422] (-1272.769) (-1274.978) * (-1284.618) (-1276.775) (-1276.557) [-1271.890] -- 0:00:06
971000 -- (-1278.090) (-1273.221) (-1275.027) [-1273.320] * (-1273.962) (-1279.377) (-1279.622) [-1271.520] -- 0:00:06
971500 -- (-1272.727) (-1281.286) (-1285.082) [-1274.527] * (-1267.745) (-1277.640) (-1274.250) [-1269.601] -- 0:00:05
972000 -- (-1277.259) (-1284.458) [-1272.079] (-1283.881) * (-1270.768) (-1293.867) [-1278.757] (-1272.098) -- 0:00:05
972500 -- (-1273.973) (-1290.097) (-1269.264) [-1274.069] * (-1276.829) (-1273.179) [-1280.144] (-1284.717) -- 0:00:05
973000 -- (-1277.639) (-1289.140) [-1271.671] (-1279.817) * (-1278.155) (-1268.198) (-1277.672) [-1272.868] -- 0:00:05
973500 -- (-1286.728) (-1275.913) (-1282.109) [-1271.083] * (-1277.967) [-1266.861] (-1281.283) (-1267.623) -- 0:00:05
974000 -- [-1277.070] (-1281.334) (-1282.773) (-1274.210) * (-1271.503) [-1276.988] (-1286.977) (-1289.889) -- 0:00:05
974500 -- [-1272.002] (-1287.826) (-1290.014) (-1269.989) * (-1273.738) (-1288.601) [-1279.555] (-1274.326) -- 0:00:05
975000 -- (-1269.790) [-1271.738] (-1286.163) (-1275.808) * [-1278.037] (-1275.825) (-1276.275) (-1272.101) -- 0:00:05
Average standard deviation of split frequencies: 0.004236
975500 -- (-1278.808) (-1281.064) (-1280.992) [-1276.082] * (-1274.323) (-1276.795) (-1271.571) [-1271.802] -- 0:00:05
976000 -- (-1280.724) (-1280.800) (-1287.645) [-1269.981] * (-1276.175) (-1276.741) (-1272.475) [-1273.894] -- 0:00:04
976500 -- (-1272.106) [-1276.450] (-1282.660) (-1280.113) * (-1279.190) (-1276.349) (-1278.496) [-1280.863] -- 0:00:04
977000 -- (-1271.504) (-1279.683) [-1278.529] (-1280.127) * (-1289.134) (-1272.548) (-1269.032) [-1279.120] -- 0:00:04
977500 -- (-1270.339) [-1273.133] (-1287.465) (-1279.440) * (-1282.685) (-1279.038) [-1272.487] (-1283.780) -- 0:00:04
978000 -- [-1273.743] (-1282.324) (-1274.932) (-1280.620) * (-1287.762) (-1274.356) [-1270.691] (-1288.362) -- 0:00:04
978500 -- (-1276.531) (-1285.977) (-1286.436) [-1270.257] * [-1273.368] (-1270.705) (-1271.384) (-1284.215) -- 0:00:04
979000 -- [-1273.748] (-1282.523) (-1280.536) (-1277.235) * (-1279.396) (-1269.478) (-1276.556) [-1275.961] -- 0:00:04
979500 -- (-1282.531) [-1284.065] (-1291.444) (-1276.174) * [-1269.846] (-1290.859) (-1272.205) (-1274.166) -- 0:00:04
980000 -- (-1274.086) (-1284.424) (-1282.243) [-1270.389] * (-1284.295) (-1287.210) [-1272.694] (-1286.254) -- 0:00:04
Average standard deviation of split frequencies: 0.004511
980500 -- (-1281.385) (-1282.355) [-1277.502] (-1285.250) * [-1283.810] (-1281.345) (-1276.802) (-1282.833) -- 0:00:04
981000 -- (-1282.204) [-1281.445] (-1286.538) (-1282.495) * [-1276.960] (-1287.109) (-1273.296) (-1278.077) -- 0:00:03
981500 -- (-1274.499) (-1290.225) [-1283.246] (-1277.899) * (-1278.076) (-1276.928) [-1269.702] (-1278.228) -- 0:00:03
982000 -- (-1296.308) (-1289.463) [-1273.923] (-1279.470) * (-1285.916) (-1293.677) [-1276.630] (-1282.239) -- 0:00:03
982500 -- (-1280.637) (-1280.741) (-1279.480) [-1274.306] * (-1279.768) (-1285.573) [-1284.429] (-1284.980) -- 0:00:03
983000 -- (-1277.002) (-1283.678) (-1276.297) [-1274.420] * (-1281.688) (-1281.195) [-1275.700] (-1282.445) -- 0:00:03
983500 -- (-1288.917) (-1283.935) [-1277.970] (-1279.750) * (-1272.641) (-1272.840) (-1280.408) [-1270.001] -- 0:00:03
984000 -- (-1273.976) (-1274.680) [-1268.074] (-1280.970) * (-1284.843) (-1280.083) (-1283.044) [-1278.483] -- 0:00:03
984500 -- (-1275.366) (-1286.385) [-1273.152] (-1284.963) * (-1275.695) (-1286.636) [-1272.609] (-1286.463) -- 0:00:03
985000 -- (-1277.188) (-1272.459) [-1274.813] (-1280.287) * [-1276.235] (-1282.414) (-1278.331) (-1289.078) -- 0:00:03
Average standard deviation of split frequencies: 0.004634
985500 -- (-1275.676) (-1276.594) [-1275.143] (-1273.818) * [-1276.818] (-1291.218) (-1274.929) (-1279.771) -- 0:00:03
986000 -- [-1282.567] (-1282.473) (-1278.757) (-1281.740) * (-1273.376) (-1274.628) [-1272.031] (-1278.634) -- 0:00:02
986500 -- (-1266.585) [-1282.097] (-1269.503) (-1270.941) * (-1275.487) (-1278.031) [-1282.734] (-1278.640) -- 0:00:02
987000 -- (-1279.275) (-1272.863) [-1277.413] (-1276.406) * [-1268.720] (-1276.148) (-1278.035) (-1280.226) -- 0:00:02
987500 -- (-1277.974) (-1278.595) [-1270.328] (-1281.746) * (-1273.275) [-1269.773] (-1271.757) (-1278.758) -- 0:00:02
988000 -- (-1273.824) [-1281.551] (-1268.834) (-1281.022) * (-1285.847) [-1267.707] (-1278.728) (-1272.301) -- 0:00:02
988500 -- [-1276.532] (-1277.155) (-1277.759) (-1293.658) * (-1280.732) [-1268.129] (-1271.922) (-1287.975) -- 0:00:02
989000 -- (-1275.473) [-1275.355] (-1267.691) (-1290.308) * (-1275.937) (-1277.189) [-1274.074] (-1283.041) -- 0:00:02
989500 -- (-1276.601) (-1269.395) [-1273.382] (-1291.205) * (-1277.591) (-1275.628) (-1274.901) [-1279.868] -- 0:00:02
990000 -- [-1277.151] (-1277.940) (-1277.229) (-1285.655) * (-1276.875) (-1278.779) [-1270.848] (-1271.607) -- 0:00:02
Average standard deviation of split frequencies: 0.004575
990500 -- (-1280.910) (-1281.808) [-1278.313] (-1276.209) * [-1271.935] (-1278.148) (-1282.934) (-1280.936) -- 0:00:01
991000 -- [-1288.167] (-1278.811) (-1286.620) (-1274.293) * [-1274.581] (-1275.380) (-1292.691) (-1280.090) -- 0:00:01
991500 -- (-1278.995) (-1276.307) (-1273.064) [-1277.555] * (-1280.102) (-1270.556) (-1284.544) [-1273.154] -- 0:00:01
992000 -- (-1272.681) (-1267.843) [-1269.570] (-1284.670) * [-1276.664] (-1273.214) (-1283.559) (-1279.884) -- 0:00:01
992500 -- (-1276.860) (-1268.076) [-1275.724] (-1286.008) * [-1273.531] (-1281.353) (-1278.303) (-1279.962) -- 0:00:01
993000 -- (-1280.627) (-1278.229) (-1275.546) [-1270.084] * [-1275.235] (-1275.564) (-1268.724) (-1279.294) -- 0:00:01
993500 -- [-1274.666] (-1277.217) (-1276.349) (-1276.602) * [-1279.781] (-1280.670) (-1276.428) (-1282.467) -- 0:00:01
994000 -- (-1277.831) [-1275.974] (-1289.946) (-1276.707) * [-1280.795] (-1278.945) (-1281.969) (-1272.306) -- 0:00:01
994500 -- (-1271.670) (-1281.062) (-1278.758) [-1278.691] * (-1281.224) (-1274.685) (-1276.048) [-1272.622] -- 0:00:01
995000 -- [-1279.994] (-1280.847) (-1276.030) (-1286.510) * [-1274.131] (-1275.766) (-1279.585) (-1271.375) -- 0:00:01
Average standard deviation of split frequencies: 0.004442
995500 -- (-1276.578) [-1280.933] (-1280.887) (-1277.860) * [-1279.753] (-1286.019) (-1289.674) (-1279.051) -- 0:00:00
996000 -- (-1276.785) [-1271.359] (-1272.234) (-1287.005) * (-1287.426) (-1281.682) (-1276.604) [-1268.168] -- 0:00:00
996500 -- (-1276.955) [-1269.774] (-1282.663) (-1277.499) * (-1272.759) (-1276.247) (-1279.406) [-1270.896] -- 0:00:00
997000 -- (-1282.580) [-1270.552] (-1282.869) (-1293.579) * (-1276.841) [-1273.979] (-1277.820) (-1275.462) -- 0:00:00
997500 -- (-1281.915) (-1274.632) [-1274.857] (-1293.311) * [-1270.865] (-1276.461) (-1282.075) (-1278.183) -- 0:00:00
998000 -- (-1283.041) [-1266.688] (-1279.415) (-1273.588) * (-1267.820) [-1269.563] (-1277.231) (-1280.712) -- 0:00:00
998500 -- (-1270.719) [-1275.660] (-1285.375) (-1271.658) * [-1270.190] (-1275.168) (-1280.742) (-1279.716) -- 0:00:00
999000 -- (-1280.083) (-1280.717) [-1270.696] (-1276.109) * (-1277.293) [-1277.125] (-1277.644) (-1279.207) -- 0:00:00
999500 -- (-1275.806) (-1266.932) (-1269.500) [-1280.029] * (-1278.671) [-1275.272] (-1277.441) (-1285.753) -- 0:00:00
1000000 -- (-1271.143) (-1274.739) [-1271.775] (-1278.534) * [-1280.402] (-1275.721) (-1276.757) (-1283.488) -- 0:00:00
Average standard deviation of split frequencies: 0.004276
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1271.143462 -- 22.047682
Chain 1 -- -1271.143457 -- 22.047682
Chain 2 -- -1274.739285 -- 19.121325
Chain 2 -- -1274.739283 -- 19.121325
Chain 3 -- -1271.775411 -- 20.109593
Chain 3 -- -1271.775411 -- 20.109593
Chain 4 -- -1278.534082 -- 22.284885
Chain 4 -- -1278.534073 -- 22.284885
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1280.402410 -- 22.022062
Chain 1 -- -1280.402406 -- 22.022062
Chain 2 -- -1275.720729 -- 19.910166
Chain 2 -- -1275.720720 -- 19.910166
Chain 3 -- -1276.756681 -- 20.379751
Chain 3 -- -1276.756688 -- 20.379751
Chain 4 -- -1283.488414 -- 22.469901
Chain 4 -- -1283.488424 -- 22.469901
Analysis completed in 3 mins 28 seconds
Analysis used 208.52 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1261.17
Likelihood of best state for "cold" chain of run 2 was -1261.17
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.0 % ( 45 %) Dirichlet(Revmat{all})
73.8 % ( 52 %) Slider(Revmat{all})
29.8 % ( 30 %) Dirichlet(Pi{all})
30.9 % ( 31 %) Slider(Pi{all})
58.2 % ( 39 %) Multiplier(Alpha{1,2})
46.3 % ( 32 %) Multiplier(Alpha{3})
48.3 % ( 16 %) Slider(Pinvar{all})
17.9 % ( 16 %) ExtSPR(Tau{all},V{all})
5.3 % ( 4 %) ExtTBR(Tau{all},V{all})
19.9 % ( 14 %) NNI(Tau{all},V{all})
18.6 % ( 9 %) ParsSPR(Tau{all},V{all})
26.8 % ( 27 %) Multiplier(V{all})
47.7 % ( 54 %) Nodeslider(V{all})
26.0 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
59.0 % ( 49 %) Dirichlet(Revmat{all})
73.8 % ( 61 %) Slider(Revmat{all})
29.3 % ( 26 %) Dirichlet(Pi{all})
30.8 % ( 25 %) Slider(Pi{all})
56.6 % ( 26 %) Multiplier(Alpha{1,2})
46.0 % ( 25 %) Multiplier(Alpha{3})
48.3 % ( 30 %) Slider(Pinvar{all})
18.0 % ( 15 %) ExtSPR(Tau{all},V{all})
5.5 % ( 8 %) ExtTBR(Tau{all},V{all})
19.9 % ( 20 %) NNI(Tau{all},V{all})
18.6 % ( 26 %) ParsSPR(Tau{all},V{all})
26.8 % ( 28 %) Multiplier(V{all})
48.0 % ( 39 %) Nodeslider(V{all})
25.8 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.36
2 | 167174 0.76 0.55
3 | 165964 166971 0.78
4 | 166919 166910 166062
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 167227 0.76 0.55
3 | 166323 166180 0.77
4 | 167189 166108 166973
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1272.10
| * |
| 2 2 1 |
| 2 1 2 |
| 2 11 2 2 1 2 |
| 1 1 1 1 21 2 2 2 2|
| 2 1 2 * 1 1 1 1 |
| 11 1 11 12 2 * 2 2 2 2 22 1 112 |
| 2 12 1 11 1 * * 11 * 1 1 1 21122 1 |
| 1 2 2 2 2 211 2* * 22 21|
|1 2 21 2 2 2 2 1 2 1 |
|2 1 11 211 1 |
| 2 2 2 |
| 2 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1277.57
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1268.65 -1288.77
2 -1269.10 -1288.52
--------------------------------------
TOTAL -1268.85 -1288.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.597175 0.010589 0.414757 0.807198 0.586482 1356.58 1373.95 1.001
r(A<->C){all} 0.070146 0.000767 0.018002 0.124506 0.067771 669.45 758.23 1.002
r(A<->G){all} 0.192573 0.004000 0.081809 0.319676 0.185741 297.94 463.39 1.000
r(A<->T){all} 0.176646 0.004723 0.054089 0.313885 0.168674 674.68 756.99 1.004
r(C<->G){all} 0.106215 0.000915 0.051155 0.165961 0.103492 939.79 990.41 1.000
r(C<->T){all} 0.415162 0.005956 0.265335 0.564465 0.415464 429.81 458.13 1.002
r(G<->T){all} 0.039257 0.000797 0.000006 0.093596 0.033561 733.18 776.33 1.001
pi(A){all} 0.261266 0.000361 0.225538 0.298512 0.260944 1187.66 1205.31 1.000
pi(C){all} 0.286420 0.000365 0.250574 0.324394 0.286059 1077.56 1159.49 1.000
pi(G){all} 0.246841 0.000323 0.212079 0.280494 0.247058 1217.33 1220.34 1.000
pi(T){all} 0.205473 0.000299 0.173392 0.240658 0.204950 1223.44 1247.52 1.000
alpha{1,2} 0.053358 0.001032 0.000120 0.105918 0.053610 726.78 908.71 1.000
alpha{3} 2.303848 0.657002 0.902346 3.883531 2.171919 1227.80 1364.40 1.000
pinvar{all} 0.568607 0.002934 0.460516 0.673115 0.571043 721.17 796.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ...*******
12 -- .....*****
13 -- ...**.....
14 -- .**.......
15 -- .....*.*..
16 -- ........**
17 -- ......*.**
18 -- .....*.***
19 -- .....***..
20 -- ......*.*.
21 -- .......**.
22 -- ......***.
23 -- .....**.**
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3000 0.999334 0.000000 0.999334 0.999334 2
12 2983 0.993671 0.001413 0.992672 0.994670 2
13 2970 0.989340 0.000942 0.988674 0.990007 2
14 2946 0.981346 0.007537 0.976016 0.986676 2
15 1969 0.655896 0.007066 0.650899 0.660893 2
16 1614 0.537642 0.008480 0.531646 0.543638 2
17 712 0.237175 0.008480 0.231179 0.243171 2
18 600 0.199867 0.002827 0.197868 0.201865 2
19 476 0.158561 0.002827 0.156562 0.160560 2
20 441 0.146902 0.002355 0.145237 0.148568 2
21 405 0.134910 0.004240 0.131912 0.137908 2
22 396 0.131912 0.003769 0.129247 0.134577 2
23 360 0.119920 0.005653 0.115923 0.123917 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.021885 0.000122 0.003227 0.042935 0.019998 1.000 2
length{all}[2] 0.016041 0.000072 0.001388 0.031815 0.014524 1.000 2
length{all}[3] 0.008396 0.000041 0.000010 0.021168 0.006976 1.000 2
length{all}[4] 0.032550 0.000198 0.007051 0.058597 0.030746 1.000 2
length{all}[5] 0.029630 0.000179 0.007464 0.056920 0.027447 1.000 2
length{all}[6] 0.054922 0.000626 0.009623 0.102776 0.051360 1.000 2
length{all}[7] 0.048213 0.000344 0.014679 0.084184 0.045446 1.000 2
length{all}[8] 0.114969 0.001294 0.050497 0.184586 0.110057 1.000 2
length{all}[9] 0.049640 0.000424 0.014302 0.089368 0.046615 1.000 2
length{all}[10] 0.055953 0.000482 0.018801 0.097758 0.052747 1.000 2
length{all}[11] 0.033681 0.000248 0.007899 0.065558 0.031221 1.000 2
length{all}[12] 0.042293 0.000366 0.008927 0.079086 0.039420 1.000 2
length{all}[13] 0.026355 0.000210 0.002373 0.053967 0.023693 1.000 2
length{all}[14] 0.013922 0.000076 0.001131 0.031764 0.012131 1.000 2
length{all}[15] 0.030908 0.000309 0.003768 0.063913 0.027708 1.002 2
length{all}[16] 0.016422 0.000122 0.000108 0.037343 0.014430 0.999 2
length{all}[17] 0.009216 0.000081 0.000030 0.025280 0.006535 1.002 2
length{all}[18] 0.008774 0.000073 0.000013 0.024678 0.006442 1.000 2
length{all}[19] 0.008406 0.000073 0.000004 0.025388 0.005924 0.999 2
length{all}[20] 0.011755 0.000111 0.000047 0.032846 0.008952 1.002 2
length{all}[21] 0.016169 0.000158 0.000257 0.039238 0.013215 0.998 2
length{all}[22] 0.014525 0.000097 0.000170 0.033178 0.012425 0.998 2
length{all}[23] 0.024085 0.000283 0.000124 0.057568 0.019703 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004276
Maximum standard deviation of split frequencies = 0.008480
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /----------------- C4 (4)
| /----------------99----------------+
| | \----------------- C5 (5)
| |
| | /----------------- C6 (6)
|-------100-------+ /--------66-------+
| | | \----------------- C8 (8)
+ | |
| \-------99-------+----------------------------------- C7 (7)
| |
| | /----------------- C9 (9)
| \--------54-------+
| \----------------- C10 (10)
|
| /----------------- C2 (2)
\-------------------------98-------------------------+
\----------------- C3 (3)
Phylogram (based on average branch lengths):
/------- C1 (1)
|
| /----------- C4 (4)
| /-------+
| | \--------- C5 (5)
| |
| | /------------------ C6 (6)
|----------+ /---------+
| | | \-------------------------------------- C8 (8)
+ | |
| \------------+---------------- C7 (7)
| |
| | /---------------- C9 (9)
| \----+
| \------------------- C10 (10)
|
| /----- C2 (2)
\---+
\--- C3 (3)
|----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (147 trees sampled):
50 % credible set contains 6 trees
90 % credible set contains 35 trees
95 % credible set contains 54 trees
99 % credible set contains 117 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 507
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sequences read..
Counting site patterns.. 0:00
96 patterns at 169 / 169 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
93696 bytes for conP
13056 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
327936 bytes for conP, adjusted
0.027432 0.034596 0.028455 0.035856 0.039052 0.047390 0.012050 0.066569 0.110279 0.062719 0.013748 0.048981 0.067889 0.010023 0.011166 0.012837 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -1390.265554
Iterating by ming2
Initial: fx= 1390.265554
x= 0.02743 0.03460 0.02845 0.03586 0.03905 0.04739 0.01205 0.06657 0.11028 0.06272 0.01375 0.04898 0.06789 0.01002 0.01117 0.01284 0.30000 1.30000
1 h-m-p 0.0000 0.0001 306.4219 +YCCCCC 1385.299724 5 0.0001 34 | 0/18
2 h-m-p 0.0001 0.0012 339.9686 YCCC 1381.316584 3 0.0002 60 | 0/18
3 h-m-p 0.0001 0.0005 333.6396 +YCYCCC 1367.282118 5 0.0004 90 | 0/18
4 h-m-p 0.0000 0.0000 3585.2969 +YYCCCC 1363.786498 5 0.0000 120 | 0/18
5 h-m-p 0.0000 0.0002 2224.3262 +CYYCCC 1346.130509 5 0.0001 150 | 0/18
6 h-m-p 0.0000 0.0000 4469.1745 +YYYYC 1333.428168 4 0.0000 176 | 0/18
7 h-m-p 0.0001 0.0003 616.6149 +YYYCCC 1326.001315 5 0.0002 205 | 0/18
8 h-m-p 0.0000 0.0002 1545.5327 YYCCC 1323.209214 4 0.0000 232 | 0/18
9 h-m-p 0.0003 0.0025 221.7418 +YYYYYYC 1312.434595 6 0.0012 260 | 0/18
10 h-m-p 0.0002 0.0008 615.6858 +YYYYCCCCCC 1282.922067 9 0.0007 296 | 0/18
11 h-m-p 0.0000 0.0000 11297.4071 +YYCYCCC 1275.752418 6 0.0000 327 | 0/18
12 h-m-p 0.0000 0.0002 887.8764 +YYCYCCC 1268.917611 6 0.0001 358 | 0/18
13 h-m-p 0.0001 0.0003 190.2721 YCCC 1268.642045 3 0.0000 384 | 0/18
14 h-m-p 0.0008 0.0082 11.0625 YCCC 1268.373427 3 0.0015 410 | 0/18
15 h-m-p 0.0018 0.0091 9.2168 YCCCCC 1267.076268 5 0.0037 440 | 0/18
16 h-m-p 0.0005 0.0024 38.9948 YCYCCC 1262.552878 5 0.0013 469 | 0/18
17 h-m-p 0.0009 0.0046 19.3786 CCCC 1262.169950 3 0.0009 496 | 0/18
18 h-m-p 0.0008 0.0051 21.9333 +YYCCC 1260.300759 4 0.0026 524 | 0/18
19 h-m-p 0.0013 0.0067 29.2075 +YYYYCCCCC 1247.764397 8 0.0054 558 | 0/18
20 h-m-p 0.0008 0.0042 44.9139 +CYYYC 1226.076422 4 0.0037 585 | 0/18
21 h-m-p 0.3221 1.6103 0.1786 YCCCCC 1211.596969 5 0.8236 615 | 0/18
22 h-m-p 0.1200 0.5999 0.2516 YCCCCC 1204.944831 5 0.2878 663 | 0/18
23 h-m-p 0.1412 0.7058 0.1345 +YCYCCC 1201.948671 5 0.4008 711 | 0/18
24 h-m-p 0.2034 1.0171 0.1366 YYCCC 1200.039729 4 0.3022 756 | 0/18
25 h-m-p 0.3759 1.8794 0.0945 +YCYCCC 1195.461604 5 1.0842 804 | 0/18
26 h-m-p 0.3631 1.8153 0.1526 YCCCC 1190.775193 4 0.8751 850 | 0/18
27 h-m-p 0.5246 2.6230 0.1175 CCC 1188.569036 2 0.6791 893 | 0/18
28 h-m-p 0.9997 4.9984 0.0444 CCCCC 1187.067954 4 1.3936 940 | 0/18
29 h-m-p 0.3060 1.5299 0.1174 CCCCC 1185.896702 4 0.4896 987 | 0/18
30 h-m-p 1.1172 5.9036 0.0514 CYC 1184.751536 2 1.0809 1029 | 0/18
31 h-m-p 1.6000 8.0000 0.0143 CYC 1183.981130 2 1.7231 1071 | 0/18
32 h-m-p 0.5437 2.7183 0.0184 YCYCC 1183.178422 4 1.4435 1116 | 0/18
33 h-m-p 0.4636 8.0000 0.0572 +CCCC 1182.064278 3 2.5276 1162 | 0/18
34 h-m-p 0.9764 5.8077 0.1482 +YYCCC 1178.939479 4 2.9507 1208 | 0/18
35 h-m-p 0.7311 3.6556 0.1501 YCCC 1177.475570 3 1.2696 1252 | 0/18
36 h-m-p 0.4840 2.4201 0.0724 YCCCC 1176.457112 4 1.1748 1298 | 0/18
37 h-m-p 0.8524 4.2618 0.0914 YCCCC 1175.331916 4 2.0870 1344 | 0/18
38 h-m-p 1.4112 7.0559 0.0847 CCCC 1174.310929 3 1.0721 1389 | 0/18
39 h-m-p 1.4562 8.0000 0.0623 YYCCC 1172.865269 4 2.1920 1434 | 0/18
40 h-m-p 1.6000 8.0000 0.0332 YCCCC 1171.560535 4 3.0690 1480 | 0/18
41 h-m-p 1.2183 6.0915 0.0571 YCCC 1170.203457 3 3.1001 1524 | 0/18
42 h-m-p 1.2560 6.2799 0.0620 CCCC 1169.102756 3 1.6402 1569 | 0/18
43 h-m-p 1.6000 8.0000 0.0217 CCC 1168.572001 2 1.6456 1612 | 0/18
44 h-m-p 0.9998 7.3139 0.0357 YC 1168.146201 1 1.7598 1652 | 0/18
45 h-m-p 1.3733 6.8666 0.0235 CCCC 1167.547944 3 1.6848 1697 | 0/18
46 h-m-p 0.6484 8.0000 0.0611 +YC 1167.087230 1 1.7038 1738 | 0/18
47 h-m-p 1.6000 8.0000 0.0222 CCC 1166.733515 2 2.2717 1781 | 0/18
48 h-m-p 1.0209 8.0000 0.0493 +YCC 1166.410082 2 2.8408 1824 | 0/18
49 h-m-p 1.6000 8.0000 0.0390 CCC 1166.268375 2 1.9079 1867 | 0/18
50 h-m-p 1.6000 8.0000 0.0256 CCC 1166.154988 2 2.4118 1910 | 0/18
51 h-m-p 1.6000 8.0000 0.0086 CCC 1166.099748 2 1.6561 1953 | 0/18
52 h-m-p 1.6000 8.0000 0.0022 CC 1166.090088 1 1.4987 1994 | 0/18
53 h-m-p 1.3336 8.0000 0.0025 CC 1166.088631 1 1.5792 2035 | 0/18
54 h-m-p 1.5646 8.0000 0.0025 YC 1166.087610 1 2.6731 2075 | 0/18
55 h-m-p 1.6000 8.0000 0.0003 C 1166.087435 0 1.4083 2114 | 0/18
56 h-m-p 1.6000 8.0000 0.0001 YC 1166.087371 1 2.9043 2154 | 0/18
57 h-m-p 0.9502 8.0000 0.0002 YC 1166.087336 1 2.3652 2194 | 0/18
58 h-m-p 1.6000 8.0000 0.0003 C 1166.087332 0 1.2889 2233 | 0/18
59 h-m-p 1.6000 8.0000 0.0001 Y 1166.087332 0 0.9957 2272 | 0/18
60 h-m-p 1.6000 8.0000 0.0000 Y 1166.087332 0 1.1197 2311 | 0/18
61 h-m-p 1.6000 8.0000 0.0000 C 1166.087332 0 0.4000 2350 | 0/18
62 h-m-p 0.5857 8.0000 0.0000 --C 1166.087332 0 0.0092 2391
Out..
lnL = -1166.087332
2392 lfun, 2392 eigenQcodon, 38272 P(t)
Time used: 0:10
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
0.027432 0.034596 0.028455 0.035856 0.039052 0.047390 0.012050 0.066569 0.110279 0.062719 0.013748 0.048981 0.067889 0.010023 0.011166 0.012837 1.403815 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.621781
np = 19
lnL0 = -1221.431697
Iterating by ming2
Initial: fx= 1221.431697
x= 0.02743 0.03460 0.02845 0.03586 0.03905 0.04739 0.01205 0.06657 0.11028 0.06272 0.01375 0.04898 0.06789 0.01002 0.01117 0.01284 1.40382 0.81675 0.13654
1 h-m-p 0.0000 0.0002 382.6895 +++ 1203.081669 m 0.0002 25 | 0/19
2 h-m-p 0.0000 0.0000 6883.8070 +CYCYC 1175.523200 4 0.0000 55 | 0/19
3 h-m-p 0.0000 0.0000 206.7922 CYCCC 1175.167171 4 0.0000 84 | 0/19
4 h-m-p 0.0000 0.0005 214.6505 ++YYC 1171.907745 2 0.0002 110 | 0/19
5 h-m-p 0.0003 0.0016 57.5064 YCYCCC 1170.731609 5 0.0008 140 | 0/19
6 h-m-p 0.0003 0.0015 78.2800 CCCC 1170.174555 3 0.0004 168 | 0/19
7 h-m-p 0.0003 0.0017 41.7019 CCCC 1169.976294 3 0.0004 196 | 0/19
8 h-m-p 0.0012 0.0059 7.0541 CC 1169.963847 1 0.0004 220 | 0/19
9 h-m-p 0.0007 0.0343 4.6628 +YC 1169.939469 1 0.0018 244 | 0/19
10 h-m-p 0.0008 0.0161 11.0963 YC 1169.877086 1 0.0019 267 | 0/19
11 h-m-p 0.0006 0.0093 31.7580 +YCCC 1169.706459 3 0.0017 295 | 0/19
12 h-m-p 0.0010 0.0098 53.9518 +YCCC 1169.272903 3 0.0026 323 | 0/19
13 h-m-p 0.0006 0.0069 246.3156 +CCCCC 1167.138034 4 0.0028 354 | 0/19
14 h-m-p 0.0005 0.0027 355.5496 CYC 1166.587258 2 0.0005 379 | 0/19
15 h-m-p 0.0009 0.0046 40.1182 YC 1166.537032 1 0.0004 402 | 0/19
16 h-m-p 0.0028 0.0231 5.6327 CC 1166.524573 1 0.0006 426 | 0/19
17 h-m-p 0.0029 0.1082 1.1725 +YCCC 1166.005878 3 0.0244 454 | 0/19
18 h-m-p 0.0005 0.0026 40.6012 +YYYCC 1163.392186 4 0.0020 482 | 0/19
19 h-m-p 0.0019 0.0097 11.8121 CC 1163.360617 1 0.0005 506 | 0/19
20 h-m-p 0.0028 0.0904 1.9262 YC 1163.320419 1 0.0065 529 | 0/19
21 h-m-p 0.0006 0.1085 22.3340 +++YYYYCCCCCC 1159.384218 9 0.0433 568 | 0/19
22 h-m-p 0.3085 1.5425 0.2599 CYC 1159.167670 2 0.2940 593 | 0/19
23 h-m-p 1.0838 8.0000 0.0705 YCCC 1159.000412 3 0.5397 639 | 0/19
24 h-m-p 1.6000 8.0000 0.0140 YCC 1158.960085 2 1.0555 683 | 0/19
25 h-m-p 0.4116 8.0000 0.0358 +YC 1158.922106 1 1.0693 726 | 0/19
26 h-m-p 1.2336 8.0000 0.0310 YC 1158.897998 1 0.9630 768 | 0/19
27 h-m-p 1.6000 8.0000 0.0068 YC 1158.895126 1 0.9572 810 | 0/19
28 h-m-p 1.2223 8.0000 0.0053 YC 1158.894701 1 0.6216 852 | 0/19
29 h-m-p 1.6000 8.0000 0.0007 Y 1158.894650 0 0.7415 893 | 0/19
30 h-m-p 1.2921 8.0000 0.0004 Y 1158.894641 0 0.6260 934 | 0/19
31 h-m-p 1.6000 8.0000 0.0001 C 1158.894640 0 0.6304 975 | 0/19
32 h-m-p 1.6000 8.0000 0.0000 Y 1158.894640 0 0.6437 1016 | 0/19
33 h-m-p 1.6000 8.0000 0.0000 Y 1158.894640 0 1.0895 1057 | 0/19
34 h-m-p 1.6000 8.0000 0.0000 Y 1158.894640 0 1.0922 1098 | 0/19
35 h-m-p 1.6000 8.0000 0.0000 Y 1158.894640 0 1.0907 1139 | 0/19
36 h-m-p 1.6000 8.0000 0.0000 C 1158.894640 0 1.6000 1180 | 0/19
37 h-m-p 1.6000 8.0000 0.0000 -C 1158.894640 0 0.1000 1222
Out..
lnL = -1158.894640
1223 lfun, 3669 eigenQcodon, 39136 P(t)
Time used: 0:19
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
initial w for M2:NSpselection reset.
0.027432 0.034596 0.028455 0.035856 0.039052 0.047390 0.012050 0.066569 0.110279 0.062719 0.013748 0.048981 0.067889 0.010023 0.011166 0.012837 1.415839 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.034883
np = 21
lnL0 = -1305.791752
Iterating by ming2
Initial: fx= 1305.791752
x= 0.02743 0.03460 0.02845 0.03586 0.03905 0.04739 0.01205 0.06657 0.11028 0.06272 0.01375 0.04898 0.06789 0.01002 0.01117 0.01284 1.41584 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0003 301.2892 ++YYC 1301.257289 2 0.0001 30 | 0/21
2 h-m-p 0.0003 0.0016 128.1831 +YCYC 1297.780205 3 0.0008 59 | 0/21
3 h-m-p 0.0002 0.0011 281.1409 ++ 1276.857173 m 0.0011 83 | 0/21
4 h-m-p 0.0000 0.0000 11047.8938
h-m-p: 1.29555238e-20 6.47776191e-20 1.10478938e+04 1276.857173
.. | 0/21
5 h-m-p 0.0000 0.0007 10719.1965 YCYYCYCCCC 1265.453887 9 0.0000 142 | 0/21
6 h-m-p 0.0001 0.0007 212.2775 ++ 1234.665111 m 0.0007 166 | 1/21
7 h-m-p 0.0002 0.0009 152.6218 +YYYCCC 1229.446199 5 0.0007 198 | 1/21
8 h-m-p 0.0001 0.0005 392.1796 +CYCCC 1224.467920 4 0.0004 230 | 1/21
9 h-m-p 0.0000 0.0002 5224.1358 +YCC 1213.243477 2 0.0001 258 | 1/21
10 h-m-p 0.0008 0.0038 117.8357 +YCCCC 1208.057337 4 0.0020 290 | 0/21
11 h-m-p 0.0000 0.0000 43298.8422 YCCC 1206.181774 3 0.0000 319 | 0/21
12 h-m-p 0.0007 0.0080 100.2450 +CCCC 1200.595237 3 0.0032 350 | 0/21
13 h-m-p 0.0008 0.0040 107.4130 +YYYCCC 1193.680356 5 0.0030 382 | 0/21
14 h-m-p 0.0010 0.0051 97.4013 YCYCCC 1189.219221 5 0.0027 414 | 0/21
15 h-m-p 0.0015 0.0075 52.7879 CCCCC 1188.147661 4 0.0018 446 | 0/21
16 h-m-p 0.0010 0.0050 28.3333 CCCCC 1187.861326 4 0.0012 478 | 0/21
17 h-m-p 0.0020 0.0182 17.3258 CYC 1187.690435 2 0.0018 505 | 0/21
18 h-m-p 0.0019 0.0243 16.1660 YCC 1187.436243 2 0.0036 532 | 0/21
19 h-m-p 0.0011 0.0585 53.7549 ++YYYC 1183.978041 3 0.0166 561 | 0/21
20 h-m-p 0.0014 0.0071 255.9121 YCCC 1181.270254 3 0.0027 590 | 0/21
21 h-m-p 0.0016 0.0081 96.3367 CCCC 1180.595456 3 0.0017 620 | 0/21
22 h-m-p 0.0065 0.0323 13.9379 YC 1180.455231 1 0.0032 645 | 0/21
23 h-m-p 0.0050 0.1379 9.0870 YCCC 1180.249433 3 0.0095 674 | 0/21
24 h-m-p 0.0024 0.1193 35.7001 ++YCYCCC 1172.318991 5 0.0870 709 | 0/21
25 h-m-p 0.1945 0.9723 2.3584 +YYCCC 1167.176110 4 0.6692 740 | 0/21
26 h-m-p 0.2000 0.9998 1.5941 YYC 1166.451992 2 0.1653 766 | 0/21
27 h-m-p 0.0779 0.4142 3.3821 YCCCCC 1164.034980 5 0.1611 799 | 0/21
28 h-m-p 0.4637 2.3183 0.5696 CCCC 1162.967707 3 0.5187 829 | 0/21
29 h-m-p 0.4425 2.6899 0.6678 CYCCC 1162.099902 4 0.7976 881 | 0/21
30 h-m-p 0.6128 4.2723 0.8693 CCCC 1161.322261 3 0.8465 932 | 0/21
31 h-m-p 0.3308 1.6541 1.3956 CCCCC 1160.880037 4 0.3944 985 | 0/21
32 h-m-p 0.5636 2.8181 0.8487 CCY 1160.541499 2 0.5606 1013 | 0/21
33 h-m-p 0.9553 6.4522 0.4980 YYC 1160.393725 2 0.7716 1060 | 0/21
34 h-m-p 0.6269 8.0000 0.6130 CCC 1160.317388 2 0.5202 1109 | 0/21
35 h-m-p 0.4673 5.6271 0.6823 YCCC 1160.227881 3 0.9548 1159 | 0/21
36 h-m-p 0.7792 7.4562 0.8360 CC 1160.142164 1 0.7811 1206 | 0/21
37 h-m-p 0.8573 6.2094 0.7617 YC 1159.955297 1 1.7976 1252 | 0/21
38 h-m-p 0.5859 6.2971 2.3368 CCCCC 1159.690807 4 0.8782 1305 | 0/21
39 h-m-p 0.7290 3.7537 2.8149 CYC 1159.439179 2 0.6410 1332 | 0/21
40 h-m-p 0.6751 3.7581 2.6729 YCCC 1159.306028 3 0.4743 1361 | 0/21
41 h-m-p 1.2550 7.0083 1.0102 YC 1159.172641 1 0.8512 1386 | 0/21
42 h-m-p 0.4765 6.5345 1.8045 YCCC 1159.045218 3 0.8392 1415 | 0/21
43 h-m-p 1.6000 8.0000 0.9294 YC 1158.994683 1 0.6609 1440 | 0/21
44 h-m-p 1.5500 8.0000 0.3963 YC 1158.964796 1 0.8142 1486 | 0/21
45 h-m-p 1.6000 8.0000 0.1541 YC 1158.942941 1 0.9018 1532 | 0/21
46 h-m-p 1.0072 8.0000 0.1380 CC 1158.921444 1 0.8842 1579 | 0/21
47 h-m-p 1.4314 8.0000 0.0852 YC 1158.911983 1 0.8353 1625 | 0/21
48 h-m-p 1.0569 8.0000 0.0673 YC 1158.909015 1 0.5494 1671 | 0/21
49 h-m-p 0.5574 8.0000 0.0664 CC 1158.907567 1 0.6885 1718 | 0/21
50 h-m-p 0.2769 8.0000 0.1651 +C 1158.905413 0 1.0901 1764 | 0/21
51 h-m-p 1.6000 8.0000 0.0448 YC 1158.904132 1 0.8421 1810 | 0/21
52 h-m-p 0.4793 8.0000 0.0787 CC 1158.903885 1 0.7119 1857 | 0/21
53 h-m-p 1.6000 8.0000 0.0173 YC 1158.903857 1 0.8356 1903 | 0/21
54 h-m-p 1.6000 8.0000 0.0061 +YC 1158.903760 1 4.3835 1950 | 0/21
55 h-m-p 0.4638 8.0000 0.0579 +++ 1158.902895 m 8.0000 1996 | 0/21
56 h-m-p 0.9279 8.0000 0.4993 +YC 1158.898624 1 5.3943 2043 | 0/21
57 h-m-p 1.6000 8.0000 0.9183 C 1158.896295 0 1.6000 2088 | 0/21
58 h-m-p 1.4679 8.0000 1.0009 CC 1158.895534 1 2.0549 2135 | 0/21
59 h-m-p 1.3480 8.0000 1.5259 CC 1158.895086 1 1.1077 2161 | 0/21
60 h-m-p 1.6000 8.0000 1.0389 C 1158.894896 0 1.4187 2185 | 0/21
61 h-m-p 1.3930 8.0000 1.0581 C 1158.894785 0 1.3528 2209 | 0/21
62 h-m-p 1.4897 8.0000 0.9609 C 1158.894713 0 1.8249 2233 | 0/21
63 h-m-p 1.5444 8.0000 1.1354 Y 1158.894669 0 2.6058 2278 | 0/21
64 h-m-p 1.6000 8.0000 0.0393 Y 1158.894661 0 0.9826 2302 | 0/21
65 h-m-p 0.0424 8.0000 0.9110 ++Y 1158.894655 0 1.5769 2349 | 0/21
66 h-m-p 1.6000 8.0000 0.7976 Y 1158.894646 0 3.3871 2394 | 0/21
67 h-m-p 1.6000 8.0000 0.9594 C 1158.894643 0 2.1212 2439 | 0/21
68 h-m-p 1.6000 8.0000 0.9426 Y 1158.894641 0 2.5622 2484 | 0/21
69 h-m-p 1.6000 8.0000 0.9600 C 1158.894641 0 2.3469 2529 | 0/21
70 h-m-p 1.6000 8.0000 1.0104 Y 1158.894641 0 2.7425 2574 | 0/21
71 h-m-p 1.0099 8.0000 2.7439 -------Y 1158.894641 0 0.0000 2605 | 0/21
72 h-m-p 0.0160 8.0000 0.0301 ++C 1158.894641 0 0.2569 2631 | 0/21
73 h-m-p 1.6000 8.0000 0.0006 C 1158.894641 0 0.5228 2676 | 0/21
74 h-m-p 0.3907 8.0000 0.0008 +C 1158.894641 0 2.0918 2722 | 0/21
75 h-m-p 1.6000 8.0000 0.0006 Y 1158.894641 0 1.0453 2767 | 0/21
76 h-m-p 1.6000 8.0000 0.0000 +Y 1158.894641 0 4.2857 2813 | 0/21
77 h-m-p 1.6000 8.0000 0.0000 ----Y 1158.894641 0 0.0010 2862
Out..
lnL = -1158.894641
2863 lfun, 11452 eigenQcodon, 137424 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1187.244481 S = -1157.975625 -21.260811
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 96 patterns 0:56
did 20 / 96 patterns 0:56
did 30 / 96 patterns 0:56
did 40 / 96 patterns 0:56
did 50 / 96 patterns 0:56
did 60 / 96 patterns 0:56
did 70 / 96 patterns 0:56
did 80 / 96 patterns 0:56
did 90 / 96 patterns 0:56
did 96 / 96 patterns 0:56
Time used: 0:56
Model 3: discrete
TREE # 1
(1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
0.027432 0.034596 0.028455 0.035856 0.039052 0.047390 0.012050 0.066569 0.110279 0.062719 0.013748 0.048981 0.067889 0.010023 0.011166 0.012837 1.415839 0.923969 0.634343 0.008612 0.021551 0.030103
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 25.914156
np = 22
lnL0 = -1167.948287
Iterating by ming2
Initial: fx= 1167.948287
x= 0.02743 0.03460 0.02845 0.03586 0.03905 0.04739 0.01205 0.06657 0.11028 0.06272 0.01375 0.04898 0.06789 0.01002 0.01117 0.01284 1.41584 0.92397 0.63434 0.00861 0.02155 0.03010
1 h-m-p 0.0000 0.0001 246.9789 ++ 1164.798633 m 0.0001 27 | 1/22
2 h-m-p 0.0002 0.0016 93.1756 YCCCC 1164.388705 4 0.0001 59 | 1/22
3 h-m-p 0.0001 0.0005 97.6488 CYCCC 1163.871392 4 0.0002 91 | 1/22
4 h-m-p 0.0001 0.0004 143.0959 ++ 1161.873797 m 0.0004 116 | 2/22
5 h-m-p 0.0003 0.0014 36.4197 CYC 1161.733688 2 0.0003 144 | 2/22
6 h-m-p 0.0004 0.0020 22.4589 CCC 1161.707068 2 0.0001 173 | 2/22
7 h-m-p 0.0003 0.0041 11.6411 YC 1161.698237 1 0.0002 199 | 2/22
8 h-m-p 0.0003 0.0117 6.9387 C 1161.693988 0 0.0003 224 | 2/22
9 h-m-p 0.0009 0.0463 2.6916 CC 1161.689449 1 0.0014 251 | 2/22
10 h-m-p 0.0003 0.0320 13.0772 +YC 1161.676752 1 0.0008 278 | 2/22
11 h-m-p 0.0005 0.0164 21.8160 CC 1161.656551 1 0.0008 305 | 2/22
12 h-m-p 0.0004 0.0189 48.6644 +CCC 1161.542513 2 0.0020 335 | 2/22
13 h-m-p 0.0005 0.0226 186.4141 +YCCC 1160.710374 3 0.0038 366 | 2/22
14 h-m-p 0.0008 0.0040 329.8900 YCCC 1160.589883 3 0.0003 396 | 2/22
15 h-m-p 0.0013 0.0064 44.3064 CYC 1160.575106 2 0.0003 424 | 2/22
16 h-m-p 0.0021 0.0244 6.2407 YC 1160.572811 1 0.0004 450 | 2/22
17 h-m-p 0.0023 0.1189 1.0472 CC 1160.571513 1 0.0020 477 | 2/22
18 h-m-p 0.0004 0.1831 6.2476 ++CC 1160.534515 1 0.0094 506 | 2/22
19 h-m-p 0.0005 0.0197 114.8479 +YCC 1160.427121 2 0.0015 535 | 2/22
20 h-m-p 0.1190 6.4034 1.4092 CYC 1160.312123 2 0.1388 563 | 1/22
21 h-m-p 0.0002 0.0092 924.3533 CYC 1160.284769 2 0.0000 591 | 1/22
22 h-m-p 0.0001 0.0100 437.1118 ++YYC 1159.922484 2 0.0013 620 | 1/22
23 h-m-p 0.6961 6.1356 0.8440 YCCC 1159.620204 3 1.2265 650 | 0/22
24 h-m-p 0.0003 0.0015 2678.0479 YCCC 1159.577131 3 0.0000 701 | 0/22
25 h-m-p 0.4222 8.0000 0.2742 +YCC 1159.428476 2 1.3744 730 | 0/22
26 h-m-p 1.6000 8.0000 0.1331 CCC 1159.346078 2 2.3140 781 | 0/22
27 h-m-p 1.6000 8.0000 0.1839 YCCC 1159.132561 3 3.2283 833 | 0/22
28 h-m-p 1.0148 5.0741 0.1429 YCC 1158.926203 2 2.0443 883 | 0/22
29 h-m-p 0.7596 8.0000 0.3846 CCC 1158.872408 2 0.7475 934 | 0/22
30 h-m-p 1.6000 8.0000 0.0659 YCC 1158.851356 2 0.9964 984 | 0/22
31 h-m-p 0.7981 4.7820 0.0823 CC 1158.845812 1 0.7079 1033 | 0/22
32 h-m-p 1.6000 8.0000 0.0131 YC 1158.844619 1 1.2536 1081 | 0/22
33 h-m-p 1.6000 8.0000 0.0015 YC 1158.844466 1 2.6127 1129 | 0/22
34 h-m-p 1.6000 8.0000 0.0023 ++ 1158.843968 m 8.0000 1176 | 0/22
35 h-m-p 1.6000 8.0000 0.0084 +YC 1158.842804 1 4.9412 1225 | 0/22
36 h-m-p 1.6000 8.0000 0.0098 C 1158.842609 0 1.3236 1272 | 0/22
37 h-m-p 1.6000 8.0000 0.0006 Y 1158.842604 0 1.1178 1319 | 0/22
38 h-m-p 1.1246 8.0000 0.0006 C 1158.842604 0 1.0818 1366 | 0/22
39 h-m-p 1.6000 8.0000 0.0001 Y 1158.842604 0 1.0263 1413 | 0/22
40 h-m-p 1.6000 8.0000 0.0000 -C 1158.842604 0 0.1000 1461 | 0/22
41 h-m-p 0.1049 8.0000 0.0000 Y 1158.842604 0 0.0262 1508 | 0/22
42 h-m-p 0.0272 8.0000 0.0000 Y 1158.842604 0 0.0186 1555 | 0/22
43 h-m-p 0.0187 8.0000 0.0000 C 1158.842604 0 0.0187 1602 | 0/22
44 h-m-p 0.0181 8.0000 0.0000 -------------.. | 0/22
45 h-m-p 0.0160 8.0000 0.0034 ------------- | 0/22
46 h-m-p 0.0160 8.0000 0.0034 -------------
Out..
lnL = -1158.842604
1777 lfun, 7108 eigenQcodon, 85296 P(t)
Time used: 1:18
Model 7: beta
TREE # 1
(1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
0.027432 0.034596 0.028455 0.035856 0.039052 0.047390 0.012050 0.066569 0.110279 0.062719 0.013748 0.048981 0.067889 0.010023 0.011166 0.012837 1.406532 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.606401
np = 19
lnL0 = -1258.040172
Iterating by ming2
Initial: fx= 1258.040172
x= 0.02743 0.03460 0.02845 0.03586 0.03905 0.04739 0.01205 0.06657 0.11028 0.06272 0.01375 0.04898 0.06789 0.01002 0.01117 0.01284 1.40653 1.09130 1.18071
1 h-m-p 0.0000 0.0002 260.5109 ++YCCC 1255.255245 3 0.0001 50 | 0/19
2 h-m-p 0.0003 0.0016 77.2119 CYC 1254.374730 2 0.0004 94 | 0/19
3 h-m-p 0.0001 0.0006 175.7611 +YYCCCC 1251.938857 5 0.0004 144 | 0/19
4 h-m-p 0.0001 0.0005 534.4362 +YYCCC 1247.907173 4 0.0003 192 | 0/19
5 h-m-p 0.0001 0.0007 847.0814 ++ 1227.957790 m 0.0007 233 | 0/19
6 h-m-p 0.0000 0.0000 8811.6783
h-m-p: 6.39880139e-22 3.19940070e-21 8.81167829e+03 1227.957790
.. | 0/19
7 h-m-p 0.0000 0.0003 709.7976 ++CCCCC 1215.969513 4 0.0001 322 | 0/19
8 h-m-p 0.0000 0.0002 174.8475 +YCYCCC 1211.309077 5 0.0002 372 | 0/19
9 h-m-p 0.0000 0.0001 1668.4769 +YYCYCCC 1202.721551 6 0.0000 423 | 0/19
10 h-m-p 0.0000 0.0001 351.2765 +YYYCCC 1199.824360 5 0.0001 472 | 0/19
11 h-m-p 0.0000 0.0001 1599.3986 +CYYCCC 1185.567640 5 0.0001 522 | 0/19
12 h-m-p 0.0001 0.0003 716.4986 +YYYYCCC 1170.586219 6 0.0002 572 | 0/19
13 h-m-p 0.0002 0.0010 64.6961 CCCCC 1170.073548 4 0.0003 621 | 0/19
14 h-m-p 0.0003 0.0021 71.9383 CCCC 1169.625139 3 0.0003 668 | 0/19
15 h-m-p 0.0004 0.0018 47.4862 YCC 1169.505012 2 0.0002 712 | 0/19
16 h-m-p 0.0004 0.0037 20.9643 YC 1169.466587 1 0.0002 754 | 0/19
17 h-m-p 0.0005 0.0224 10.4192 +YC 1169.388491 1 0.0014 797 | 0/19
18 h-m-p 0.0003 0.0066 44.7163 YCCC 1169.255475 3 0.0006 843 | 0/19
19 h-m-p 0.0003 0.0067 74.9223 +CCCCC 1168.541628 4 0.0018 893 | 0/19
20 h-m-p 0.0006 0.0029 166.9431 CCCCC 1167.867971 4 0.0008 942 | 0/19
21 h-m-p 0.0004 0.0022 268.7180 CYCCC 1166.780854 4 0.0007 990 | 0/19
22 h-m-p 0.0003 0.0016 125.9125 YC 1166.679848 1 0.0002 1032 | 0/19
23 h-m-p 0.0054 0.0292 3.7757 CCC 1166.647829 2 0.0019 1077 | 0/19
24 h-m-p 0.0009 0.0810 8.4060 ++CCCC 1165.741624 3 0.0187 1126 | 0/19
25 h-m-p 0.0005 0.0023 284.9286 CCCCC 1164.306688 4 0.0008 1175 | 0/19
26 h-m-p 0.1377 1.0784 1.7202 CCC 1163.560926 2 0.1608 1220 | 0/19
27 h-m-p 0.4497 2.2486 0.2842 CCCC 1162.368536 3 0.5597 1267 | 0/19
28 h-m-p 0.9909 4.9545 0.1535 CCCC 1161.207492 3 1.4685 1314 | 0/19
29 h-m-p 0.7325 3.6625 0.0858 CCCCC 1160.716637 4 0.9990 1363 | 0/19
30 h-m-p 0.7421 8.0000 0.1155 YCCC 1160.592591 3 1.2915 1409 | 0/19
31 h-m-p 1.6000 8.0000 0.0886 YCC 1160.529262 2 1.2888 1453 | 0/19
32 h-m-p 1.2844 8.0000 0.0889 CC 1160.497468 1 1.6604 1496 | 0/19
33 h-m-p 1.4075 8.0000 0.1048 YCCC 1160.452074 3 2.4071 1542 | 0/19
34 h-m-p 0.7839 6.0738 0.3219 +YYYCCC 1160.290518 5 2.7733 1591 | 0/19
35 h-m-p 0.4030 2.0148 0.4720 CYCCC 1160.214208 4 0.7010 1639 | 0/19
36 h-m-p 0.1143 0.5716 1.2824 YYYYYYC 1160.189282 6 0.1144 1686 | 0/19
37 h-m-p 1.6000 8.0000 0.0702 YCC 1160.162174 2 0.8921 1730 | 0/19
38 h-m-p 0.8029 6.5580 0.0781 YYYC 1160.158523 3 0.8093 1774 | 0/19
39 h-m-p 1.6000 8.0000 0.0348 YC 1160.155096 1 0.2576 1816 | 0/19
40 h-m-p 0.2148 8.0000 0.0417 +CYC 1160.152401 2 1.6918 1861 | 0/19
41 h-m-p 1.6000 8.0000 0.0094 YC 1160.151539 1 1.1503 1903 | 0/19
42 h-m-p 0.3981 8.0000 0.0272 CC 1160.151285 1 0.7116 1946 | 0/19
43 h-m-p 1.6000 8.0000 0.0037 C 1160.151168 0 1.7043 1987 | 0/19
44 h-m-p 0.9471 8.0000 0.0066 YC 1160.151095 1 1.9554 2029 | 0/19
45 h-m-p 1.6000 8.0000 0.0002 C 1160.151062 0 1.6765 2070 | 0/19
46 h-m-p 0.0438 8.0000 0.0089 +++Y 1160.150983 0 1.8976 2114 | 0/19
47 h-m-p 1.6000 8.0000 0.0008 C 1160.150963 0 1.2889 2155 | 0/19
48 h-m-p 0.2426 8.0000 0.0042 ++C 1160.150910 0 3.8817 2198 | 0/19
49 h-m-p 1.3758 8.0000 0.0120 ----------C 1160.150910 0 0.0000 2249 | 0/19
50 h-m-p 0.0160 8.0000 0.0019 ++Y 1160.150900 0 0.5413 2292 | 0/19
51 h-m-p 1.6000 8.0000 0.0001 C 1160.150898 0 1.5935 2333 | 0/19
52 h-m-p 0.5145 8.0000 0.0004 ---------C 1160.150898 0 0.0000 2383
Out..
lnL = -1160.150898
2384 lfun, 26224 eigenQcodon, 381440 P(t)
Time used: 2:48
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
initial w for M8:NSbetaw>1 reset.
0.027432 0.034596 0.028455 0.035856 0.039052 0.047390 0.012050 0.066569 0.110279 0.062719 0.013748 0.048981 0.067889 0.010023 0.011166 0.012837 1.408055 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.379616
np = 21
lnL0 = -1223.491936
Iterating by ming2
Initial: fx= 1223.491936
x= 0.02743 0.03460 0.02845 0.03586 0.03905 0.04739 0.01205 0.06657 0.11028 0.06272 0.01375 0.04898 0.06789 0.01002 0.01117 0.01284 1.40805 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0003 514.4111 +++ 1193.044912 m 0.0003 48 | 0/21
2 h-m-p 0.0000 0.0000 128.3199
h-m-p: 0.00000000e+00 0.00000000e+00 1.28319852e+02 1193.044912
.. | 0/21
3 h-m-p 0.0000 0.0004 189.2488 +++ 1187.931932 m 0.0004 136 | 0/21
4 h-m-p 0.0000 0.0000 3796.0397 YCYC 1186.329007 3 0.0000 185 | 0/21
5 h-m-p 0.0000 0.0002 321.7562 +YYYCCC 1181.296932 5 0.0002 238 | 0/21
6 h-m-p 0.0000 0.0001 601.8095 ++ 1175.731580 m 0.0001 283 | 1/21
7 h-m-p 0.0000 0.0000 2055.4434 +YYCCCC 1172.270345 5 0.0000 337 | 1/21
8 h-m-p 0.0000 0.0001 822.8313 +YYCCCC 1168.887759 5 0.0001 390 | 1/21
9 h-m-p 0.0000 0.0001 803.7360 CYCCCC 1167.698338 5 0.0000 443 | 1/21
10 h-m-p 0.0001 0.0005 62.7510 CC 1167.481301 1 0.0001 489 | 1/21
11 h-m-p 0.0001 0.0021 53.1514 YCCC 1167.276263 3 0.0002 538 | 1/21
12 h-m-p 0.0002 0.0028 61.0041 CCC 1167.150863 2 0.0002 586 | 1/21
13 h-m-p 0.0002 0.0036 39.3012 YCC 1167.083658 2 0.0002 633 | 1/21
14 h-m-p 0.0003 0.0104 24.5977 +YCC 1166.919968 2 0.0010 681 | 1/21
15 h-m-p 0.0010 0.0050 18.5001 YC 1166.871430 1 0.0005 726 | 1/21
16 h-m-p 0.0003 0.0084 36.3008 +CCCC 1166.620764 3 0.0014 777 | 1/21
17 h-m-p 0.0006 0.0177 88.9786 +YCCCC 1164.020650 4 0.0061 829 | 1/21
18 h-m-p 0.0004 0.0021 168.4515 YCC 1163.798146 2 0.0003 876 | 1/21
19 h-m-p 0.0013 0.0067 28.2476 CC 1163.745705 1 0.0005 922 | 1/21
20 h-m-p 0.0063 0.0778 2.1678 YCC 1163.729540 2 0.0042 969 | 1/21
21 h-m-p 0.0005 0.1045 18.7857 +++YCCC 1162.986901 3 0.0209 1021 | 1/21
22 h-m-p 0.0012 0.0061 69.3205 CC 1162.930769 1 0.0005 1067 | 1/21
23 h-m-p 0.0590 3.5180 0.5447 ++YCC 1161.614119 2 0.6588 1116 | 1/21
24 h-m-p 1.6000 8.0000 0.1928 CYCC 1161.047010 3 1.3253 1165 | 0/21
25 h-m-p 0.0018 0.0131 138.6808 -CC 1161.031065 1 0.0002 1212 | 0/21
26 h-m-p 0.0501 2.3941 0.4976 ++YCC 1160.590806 2 1.4399 1262 | 0/21
27 h-m-p 0.1279 0.6395 0.7269 ++ 1160.226242 m 0.6395 1307 | 1/21
28 h-m-p 0.1089 0.5961 0.2325 +YC 1159.882896 1 0.2723 1354 | 1/21
29 h-m-p 0.2232 2.7119 0.2836 +
QuantileBeta(0.15, 0.00500, 2.14204) = 1.235051e-160 2000 rounds
YYCC 1159.550158 3 0.7244 1403 | 1/21
30 h-m-p 0.7040 3.5200 0.1505 YCCCCC 1159.335613 5 0.9079 1456 | 1/21
31 h-m-p 1.6000 8.0000 0.0490 YCC 1159.268482 2 1.0149 1503 | 1/21
32 h-m-p 1.6000 8.0000 0.0223 YYC 1159.243466 2 1.1723 1549 | 1/21
33 h-m-p 1.6000 8.0000 0.0089 CC 1159.235544 1 1.3587 1595 | 1/21
34 h-m-p 1.6000 8.0000 0.0062 C 1159.233458 0 1.6089 1639 | 1/21
35 h-m-p 1.6000 8.0000 0.0033 CC 1159.232364 1 2.1911 1685 | 1/21
36 h-m-p 0.7179 8.0000 0.0099 +CC 1159.230650 1 3.4692 1732 | 1/21
37 h-m-p 1.6000 8.0000 0.0118 YC 1159.228767 1 2.9548 1777 | 1/21
38 h-m-p 1.6000 8.0000 0.0134 CC 1159.227332 1 2.4499 1823 | 1/21
39 h-m-p 1.6000 8.0000 0.0161 C 1159.226676 0 1.8450 1867 | 1/21
40 h-m-p 1.6000 8.0000 0.0131 ++ 1159.224990 m 8.0000 1911 | 1/21
41 h-m-p 1.6000 8.0000 0.0571 ++ 1159.217743 m 8.0000 1955 | 1/21
42 h-m-p 1.6000 8.0000 0.2789 ++ 1159.181043 m 8.0000 1999 | 1/21
43 h-m-p 1.6000 8.0000 0.9950 YCCC 1159.141878 3 3.2812 2048 | 1/21
44 h-m-p 1.6000 8.0000 1.0595 +YC 1159.086465 1 4.1815 2094 | 1/21
45 h-m-p 1.6000 8.0000 1.8296 YCC 1159.061060 2 3.0323 2141 | 1/21
46 h-m-p 1.6000 8.0000 2.8067 YCC 1159.035382 2 3.4628 2188 | 1/21
47 h-m-p 1.6000 8.0000 3.6908 YC 1159.021843 1 2.8383 2233 | 1/21
48 h-m-p 1.6000 8.0000 4.8684 YC 1159.010260 1 3.5376 2278 | 1/21
49 h-m-p 1.1038 5.5190 7.7590 YC 1159.000972 1 2.5737 2323 | 1/21
50 h-m-p 0.4346 2.1728 10.5176 ++ 1158.994869 m 2.1728 2367 | 2/21
51 h-m-p 0.2706 4.1421 0.7608 ---------------.. | 2/21
52 h-m-p 0.0000 0.0089 3.4004 +YC 1158.993990 1 0.0002 2469 | 2/21
53 h-m-p 0.0003 0.0073 1.9985 YC 1158.993812 1 0.0001 2513 | 2/21
54 h-m-p 0.0001 0.0433 2.9059 C 1158.993637 0 0.0001 2556 | 2/21
55 h-m-p 0.0002 0.0501 1.5268 +YC 1158.993291 1 0.0006 2601 | 2/21
56 h-m-p 0.0001 0.0470 5.9042 +CC 1158.991395 1 0.0008 2647 | 2/21
57 h-m-p 0.0002 0.0193 22.8730 +C 1158.983959 0 0.0009 2691 | 2/21
58 h-m-p 0.0002 0.0089 99.3074 +YC 1158.960449 1 0.0006 2736 | 2/21
59 h-m-p 0.0005 0.0053 137.0178 YCC 1158.941548 2 0.0004 2782 | 2/21
60 h-m-p 0.0009 0.0127 53.2220 CC 1158.934980 1 0.0003 2827 | 2/21
61 h-m-p 0.0060 0.1256 2.9484 -CC 1158.934428 1 0.0006 2873 | 2/21
62 h-m-p 0.0006 0.0395 2.6395 YC 1158.934200 1 0.0003 2917 | 2/21
63 h-m-p 0.0013 0.1778 0.6210 Y 1158.934137 0 0.0005 2960 | 2/21
64 h-m-p 0.0010 0.5039 0.3499 YC 1158.934116 1 0.0005 3004 | 2/21
65 h-m-p 0.0048 2.4009 0.2094 YC 1158.933957 1 0.0108 3048 | 2/21
66 h-m-p 0.0006 0.2916 3.8784 +C 1158.933316 0 0.0024 3092 | 2/21
67 h-m-p 0.0018 0.1418 5.2108 C 1158.933164 0 0.0004 3135 | 2/21
68 h-m-p 0.0094 0.8234 0.2354 -Y 1158.933160 0 0.0003 3179 | 2/21
69 h-m-p 0.0095 4.7703 0.0199 Y 1158.933159 0 0.0015 3222 | 2/21
70 h-m-p 0.0160 8.0000 0.0295 +C 1158.933085 0 0.0571 3266 | 2/21
71 h-m-p 0.0011 0.5346 2.4908 YC 1158.932846 1 0.0022 3310 | 2/21
72 h-m-p 1.6000 8.0000 0.0003 Y 1158.932845 0 0.9661 3353 | 2/21
73 h-m-p 1.6000 8.0000 0.0000 Y 1158.932845 0 0.6696 3396 | 2/21
74 h-m-p 1.6000 8.0000 0.0000 ---Y 1158.932845 0 0.0063 3442
Out..
lnL = -1158.932845
3443 lfun, 41316 eigenQcodon, 605968 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1194.994848 S = -1157.980718 -29.134616
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 96 patterns 5:11
did 20 / 96 patterns 5:11
did 30 / 96 patterns 5:11
did 40 / 96 patterns 5:11
did 50 / 96 patterns 5:11
did 60 / 96 patterns 5:12
did 70 / 96 patterns 5:12
did 80 / 96 patterns 5:12
did 90 / 96 patterns 5:12
did 96 / 96 patterns 5:12
Time used: 5:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=169
D_melanogaster_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_sechellia_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_simulans_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_yakuba_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_erecta_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_takahashii_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_biarmipes_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_eugracilis_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_rhopaloa_zetaCOP-PB MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_elegans_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
*******************:******************************
D_melanogaster_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_sechellia_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_simulans_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_yakuba_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_erecta_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_takahashii_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_biarmipes_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_eugracilis_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_rhopaloa_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_elegans_zetaCOP-PB RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
**************************************************
D_melanogaster_zetaCOP-PB ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_sechellia_zetaCOP-PB ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_simulans_zetaCOP-PB ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_yakuba_zetaCOP-PB ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_erecta_zetaCOP-PB ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_takahashii_zetaCOP-PB ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
D_biarmipes_zetaCOP-PB ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_eugracilis_zetaCOP-PB ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
D_rhopaloa_zetaCOP-PB ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
D_elegans_zetaCOP-PB ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
************: ***************:********:***********
D_melanogaster_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
D_sechellia_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
D_simulans_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
D_yakuba_zetaCOP-PB PIAEQTVAQVTNTLNGIFW
D_erecta_zetaCOP-PB PIAEQTVAQVTNTLNGIFW
D_takahashii_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
D_biarmipes_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
D_eugracilis_zetaCOP-PB PIAEQTVAQVTSTLNGLFW
D_rhopaloa_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
D_elegans_zetaCOP-PB PIAEQTVAQVTNTLNGLFW
***********.****:**
>D_melanogaster_zetaCOP-PB ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATTATGCTGGACGGACTCACCTGCGTGTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTGTCCGTGCTCAACTGCCTCTACGATTCCATTAGCCTG ATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT ATTTTGG >D_sechellia_zetaCOP-PB ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT CATCATGCTGGCTTTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCCATTGCCGAACAAACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT ATTTTGG >D_simulans_zetaCOP-PB ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTATTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTTAATGGTCT ATTTTGG >D_yakuba_zetaCOP-PB ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGATGGACTTACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT CATCATGCTGGCCTTTGACGAGATCTGCGACGGAGGCATAATTCTGGATG CCGATCCGTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCAATTGCCGAACAGACCGTCGCCCAGGTAACTAATACCCTTAATGGTAT ATTTTGG >D_erecta_zetaCOP-PB ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCTTGTCCA CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTCTACAA GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCTATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAATACCTGGAGAT CATCATGCTGGCCTTTGACGAGATCTGCGATGGAGGCATAATTCTGGATG CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCAATTGCCGAACAGACCGTTGCCCAGGTAACTAATACCCTTAATGGTAT ATTTTGG >D_takahashii_zetaCOP-PB ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGACGGCAACCGCATCCTGGCCAAGTACTACGACAAAAACATTCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATAATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCGGTGCTCAACTGCCTGTACGACTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT CATCATGCTGGCCTTCGATGAGATCTGCGACGGAGGCATAATCCTGGATG CCGATCCATCGTCCATTGTGAAACGTGTCGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTAAATGGTCT ATTTTGG >D_biarmipes_zetaCOP-PB ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGACGGGAACCGCATCCTGGCCAAGTACTACGACAAGAACATACTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG ATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATTATCCTGGACG CGGATCCCTCGTCCGTGGTGAAACGCGTCGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACTCTAAATGGTCT ATTCTGG >D_eugracilis_zetaCOP-PB ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGATGGAAACCGCATCCTGGCCAAATACTACGATAAAAACATCTTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATAATGCTGGACGGACTCACCTGCGTCTACAA AAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTGATCCTGCTGTCTGTGCTCAACTGCCTGTACGACTCCATCAGCCTA ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT CATCATGCTGGCCTTTGATGAAATCTGCGACGGAGGCATGATTCTGGATG CGGATCCCTCCTCCGTAGTGAAACGCGTCGATCTGCGCAACGATGACATT CCTATTGCCGAACAAACCGTTGCCCAGGTAACTAGCACCCTAAATGGTCT ATTTTGG >D_rhopaloa_zetaCOP-PB ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA TGATGGAGACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAATGCCTACGAGAATG AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTA ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGACAACCTGGAGAT CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATGATCCTGGATG CGGATCCCTCGTCCGTGGTGAAACGAGTCGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTAACTAACACCCTAAATGGTCT ATTTTGG >D_elegans_zetaCOP-PB ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA TGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGACTGGTGCTGGAGAACCTGGAGAT CATCATGCTCGCCTTCGACGAGATCTGTGACGGAGGAATGATCCTGGATG CGGATCCCTCATCCGTCGTGAAACGAGTCGATCTGCGCAACGATGACATT CCCATCGCCGAACAGACCGTTGCCCAGGTAACTAACACTCTAAATGGTCT ATTTTGG
>D_melanogaster_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW >D_sechellia_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW >D_simulans_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW >D_yakuba_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGIFW >D_erecta_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGIFW >D_takahashii_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW >D_biarmipes_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW >D_eugracilis_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI PIAEQTVAQVTSTLNGLFW >D_rhopaloa_zetaCOP-PB MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW >D_elegans_zetaCOP-PB MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI PIAEQTVAQVTNTLNGLFW
#NEXUS
[ID: 7882132110]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_zetaCOP-PB
D_sechellia_zetaCOP-PB
D_simulans_zetaCOP-PB
D_yakuba_zetaCOP-PB
D_erecta_zetaCOP-PB
D_takahashii_zetaCOP-PB
D_biarmipes_zetaCOP-PB
D_eugracilis_zetaCOP-PB
D_rhopaloa_zetaCOP-PB
D_elegans_zetaCOP-PB
;
end;
begin trees;
translate
1 D_melanogaster_zetaCOP-PB,
2 D_sechellia_zetaCOP-PB,
3 D_simulans_zetaCOP-PB,
4 D_yakuba_zetaCOP-PB,
5 D_erecta_zetaCOP-PB,
6 D_takahashii_zetaCOP-PB,
7 D_biarmipes_zetaCOP-PB,
8 D_eugracilis_zetaCOP-PB,
9 D_rhopaloa_zetaCOP-PB,
10 D_elegans_zetaCOP-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01999804,((4:0.03074562,5:0.02744727)0.989:0.02369269,((6:0.0513604,8:0.1100573)0.656:0.02770838,7:0.04544609,(9:0.04661488,10:0.05274664)0.538:0.01443026)0.994:0.03942018)0.999:0.03122092,(2:0.01452356,3:0.006975546)0.981:0.01213128);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01999804,((4:0.03074562,5:0.02744727):0.02369269,((6:0.0513604,8:0.1100573):0.02770838,7:0.04544609,(9:0.04661488,10:0.05274664):0.01443026):0.03942018):0.03122092,(2:0.01452356,3:0.006975546):0.01213128);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1268.65 -1288.77
2 -1269.10 -1288.52
--------------------------------------
TOTAL -1268.85 -1288.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaCOP-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.597175 0.010589 0.414757 0.807198 0.586482 1356.58 1373.95 1.001
r(A<->C){all} 0.070146 0.000767 0.018002 0.124506 0.067771 669.45 758.23 1.002
r(A<->G){all} 0.192573 0.004000 0.081809 0.319676 0.185741 297.94 463.39 1.000
r(A<->T){all} 0.176646 0.004723 0.054089 0.313885 0.168674 674.68 756.99 1.004
r(C<->G){all} 0.106215 0.000915 0.051155 0.165961 0.103492 939.79 990.41 1.000
r(C<->T){all} 0.415162 0.005956 0.265335 0.564465 0.415464 429.81 458.13 1.002
r(G<->T){all} 0.039257 0.000797 0.000006 0.093596 0.033561 733.18 776.33 1.001
pi(A){all} 0.261266 0.000361 0.225538 0.298512 0.260944 1187.66 1205.31 1.000
pi(C){all} 0.286420 0.000365 0.250574 0.324394 0.286059 1077.56 1159.49 1.000
pi(G){all} 0.246841 0.000323 0.212079 0.280494 0.247058 1217.33 1220.34 1.000
pi(T){all} 0.205473 0.000299 0.173392 0.240658 0.204950 1223.44 1247.52 1.000
alpha{1,2} 0.053358 0.001032 0.000120 0.105918 0.053610 726.78 908.71 1.000
alpha{3} 2.303848 0.657002 0.902346 3.883531 2.171919 1227.80 1364.40 1.000
pinvar{all} 0.568607 0.002934 0.460516 0.673115 0.571043 721.17 796.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/443/zetaCOP-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 169
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 4 4 2 | Ser TCT 0 0 0 0 1 0 | Tyr TAT 0 0 1 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 3 3 5 | TCC 4 5 5 5 3 4 | TAC 6 6 5 6 7 6 | TGC 4 4 4 4 4 4
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 2 1 | TCG 2 1 1 1 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 2 1 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 1
CTC 6 6 6 6 6 6 | CCC 2 2 2 0 1 1 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 4
CTA 1 2 2 0 0 2 | CCA 0 0 0 1 1 1 | Gln CAA 0 1 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 13 12 12 12 12 13 | CCG 0 0 0 1 0 0 | CAG 3 2 3 3 3 3 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 4 4 3 3 4 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 2 | Ser AGT 0 0 0 0 0 0
ATC 11 13 13 13 13 12 | ACC 3 3 3 3 3 3 | AAC 12 12 12 12 11 13 | AGC 2 2 2 2 2 2
ATA 0 0 0 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 2 | Arg AGA 0 0 0 0 0 0
Met ATG 8 8 8 8 8 8 | ACG 3 3 3 3 3 3 | AAG 11 11 11 11 11 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 2 2 1 2 1 | Ala GCT 0 1 0 0 0 0 | Asp GAT 7 8 7 8 7 5 | Gly GGT 1 1 1 1 1 1
GTC 0 0 0 2 1 2 | GCC 5 5 5 7 6 7 | GAC 8 8 8 8 8 10 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 1 0 1 0 0 0 | Glu GAA 3 2 3 2 3 2 | GGA 3 3 3 3 3 2
GTG 7 8 8 7 7 6 | GCG 1 1 1 0 1 0 | GAG 7 7 7 7 7 8 | GGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 1 2 2 1 | Ser TCT 0 1 0 0 | Tyr TAT 0 0 0 0 | Cys TGT 0 0 0 1
TTC 6 5 5 6 | TCC 5 5 5 5 | TAC 6 6 6 6 | TGC 4 4 4 3
Leu TTA 0 0 0 0 | TCA 0 0 0 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 1 2 1 1 | TCG 1 0 1 0 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 0 1 0 0 | His CAT 0 0 0 0 | Arg CGT 0 0 0 0
CTC 6 4 5 8 | CCC 2 1 2 2 | CAC 1 1 1 1 | CGC 5 5 4 3
CTA 2 3 3 2 | CCA 0 0 0 0 | Gln CAA 0 1 0 0 | CGA 0 0 1 2
CTG 13 13 13 11 | CCG 0 0 0 0 | CAG 3 2 3 3 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 4 3 2 1 | Thr ACT 2 1 1 2 | Asn AAT 3 2 6 3 | Ser AGT 0 0 0 0
ATC 12 12 14 15 | ACC 2 3 3 2 | AAC 12 12 8 12 | AGC 2 3 2 2
ATA 1 1 0 0 | ACA 0 0 0 0 | Lys AAA 1 4 1 1 | Arg AGA 0 0 0 0
Met ATG 8 9 9 9 | ACG 3 3 3 3 | AAG 11 8 11 11 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 | Ala GCT 0 0 0 0 | Asp GAT 3 7 5 5 | Gly GGT 1 1 1 1
GTC 2 2 2 3 | GCC 6 6 6 6 | GAC 12 8 12 10 | GGC 3 3 3 3
GTA 1 2 1 1 | GCA 0 0 0 0 | Glu GAA 2 3 2 2 | GGA 2 4 3 3
GTG 7 6 7 6 | GCG 1 1 1 1 | GAG 8 7 7 8 | GGG 2 0 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.14793 C:0.45562 A:0.05917 G:0.33728
Average T:0.22682 C:0.25838 A:0.26233 G:0.25247
#2: D_sechellia_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.14201 C:0.47337 A:0.05917 G:0.32544
Average T:0.22485 C:0.26430 A:0.26233 G:0.24852
#3: D_simulans_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.13609 C:0.46746 A:0.06509 G:0.33136
Average T:0.22288 C:0.26233 A:0.26430 G:0.25049
#4: D_yakuba_zetaCOP-PB
position 1: T:0.14793 C:0.18343 A:0.36686 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.13609 C:0.47929 A:0.05917 G:0.32544
Average T:0.22288 C:0.26430 A:0.26430 G:0.24852
#5: D_erecta_zetaCOP-PB
position 1: T:0.15976 C:0.17751 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.13609 C:0.46154 A:0.06509 G:0.33728
Average T:0.22682 C:0.25641 A:0.26430 G:0.25247
#6: D_takahashii_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.36686 G:0.29586
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.10059 C:0.49704 A:0.07101 G:0.33136
Average T:0.21105 C:0.27219 A:0.26824 G:0.24852
#7: D_biarmipes_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.08876 C:0.50888 A:0.05325 G:0.34911
Average T:0.20710 C:0.27613 A:0.26036 G:0.25641
#8: D_eugracilis_zetaCOP-PB
position 1: T:0.15385 C:0.18343 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36095 G:0.12426
position 3: T:0.11243 C:0.47337 A:0.10651 G:0.30769
Average T:0.21696 C:0.26233 A:0.27613 G:0.24458
#9: D_rhopaloa_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.35503 G:0.30769
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.10651 C:0.48521 A:0.06509 G:0.34320
Average T:0.21302 C:0.26824 A:0.26233 G:0.25641
#10: D_elegans_zetaCOP-PB
position 1: T:0.14793 C:0.18935 A:0.36095 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36686 G:0.11834
position 3: T:0.08876 C:0.51479 A:0.07101 G:0.32544
Average T:0.20710 C:0.27811 A:0.26627 G:0.24852
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 25 | Ser S TCT 2 | Tyr Y TAT 1 | Cys C TGT 1
TTC 45 | TCC 46 | TAC 60 | TGC 39
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 11 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 1 | His H CAT 0 | Arg R CGT 1
CTC 59 | CCC 15 | CAC 10 | CGC 46
CTA 17 | CCA 3 | Gln Q CAA 2 | CGA 3
CTG 124 | CCG 1 | CAG 28 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 34 | Thr T ACT 12 | Asn N AAT 31 | Ser S AGT 0
ATC 128 | ACC 28 | AAC 116 | AGC 21
ATA 8 | ACA 0 | Lys K AAA 14 | Arg R AGA 0
Met M ATG 83 | ACG 30 | AAG 106 | AGG 0
------------------------------------------------------------------------------
Val V GTT 15 | Ala A GCT 1 | Asp D GAT 62 | Gly G GGT 10
GTC 14 | GCC 59 | GAC 92 | GGC 36
GTA 11 | GCA 2 | Glu E GAA 24 | GGA 29
GTG 69 | GCG 8 | GAG 73 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14970 C:0.18698 A:0.36154 G:0.30178
position 2: T:0.38462 C:0.13018 A:0.36627 G:0.11893
position 3: T:0.11953 C:0.48166 A:0.06746 G:0.33136
Average T:0.21795 C:0.26627 A:0.26509 G:0.25069
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_zetaCOP-PB
D_sechellia_zetaCOP-PB 0.0339 (0.0025 0.0749)
D_simulans_zetaCOP-PB -1.0000 (0.0000 0.0651) 0.0932 (0.0025 0.0272)
D_yakuba_zetaCOP-PB 0.0280 (0.0051 0.1814) 0.0149 (0.0025 0.1702) 0.0298 (0.0051 0.1702)
D_erecta_zetaCOP-PB 0.0319 (0.0051 0.1589) 0.0448 (0.0076 0.1702) 0.0298 (0.0051 0.1702) 0.0529 (0.0051 0.0959)
D_takahashii_zetaCOP-PB 0.0134 (0.0038 0.2835) 0.0235 (0.0064 0.2708) 0.0134 (0.0038 0.2836) 0.0400 (0.0089 0.2225) 0.0327 (0.0089 0.2723)
D_biarmipes_zetaCOP-PB -1.0000 (0.0000 0.2639) 0.0106 (0.0025 0.2392)-1.0000 (0.0000 0.2514) 0.0201 (0.0051 0.2529) 0.0191 (0.0051 0.2655) 0.0218 (0.0038 0.1746)
D_eugracilis_zetaCOP-PB 0.0160 (0.0051 0.3172) 0.0275 (0.0076 0.2777) 0.0160 (0.0051 0.3174) 0.0319 (0.0102 0.3193) 0.0333 (0.0102 0.3057) 0.0318 (0.0076 0.2398) 0.0168 (0.0051 0.3034)
D_rhopaloa_zetaCOP-PB 0.0337 (0.0076 0.2268) 0.0224 (0.0051 0.2270) 0.0356 (0.0076 0.2149) 0.0302 (0.0076 0.2528) 0.0590 (0.0128 0.2161) 0.0618 (0.0115 0.1859) 0.0521 (0.0076 0.1468) 0.0289 (0.0076 0.2643)
D_elegans_zetaCOP-PB 0.0087 (0.0025 0.2902) 0.0192 (0.0051 0.2646) 0.0091 (0.0025 0.2773) 0.0287 (0.0076 0.2661) 0.0273 (0.0076 0.2789) 0.0250 (0.0051 0.2036) 0.0141 (0.0025 0.1804) 0.0080 (0.0025 0.3176) 0.0322 (0.0051 0.1580)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
lnL(ntime: 16 np: 18): -1166.087332 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..8 14..7 14..16 16..9 16..10 11..17 17..2 17..3
0.023257 0.035708 0.027868 0.036879 0.036306 0.050800 0.033772 0.054227 0.129359 0.061487 0.021201 0.054336 0.064623 0.012083 0.017833 0.005603 1.403815 0.017223
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.66534
(1: 0.023257, ((4: 0.036879, 5: 0.036306): 0.027868, ((6: 0.054227, 8: 0.129359): 0.033772, 7: 0.061487, (9: 0.054336, 10: 0.064623): 0.021201): 0.050800): 0.035708, (2: 0.017833, 3: 0.005603): 0.012083);
(D_melanogaster_zetaCOP-PB: 0.023257, ((D_yakuba_zetaCOP-PB: 0.036879, D_erecta_zetaCOP-PB: 0.036306): 0.027868, ((D_takahashii_zetaCOP-PB: 0.054227, D_eugracilis_zetaCOP-PB: 0.129359): 0.033772, D_biarmipes_zetaCOP-PB: 0.061487, (D_rhopaloa_zetaCOP-PB: 0.054336, D_elegans_zetaCOP-PB: 0.064623): 0.021201): 0.050800): 0.035708, (D_sechellia_zetaCOP-PB: 0.017833, D_simulans_zetaCOP-PB: 0.005603): 0.012083);
Detailed output identifying parameters
kappa (ts/tv) = 1.40382
omega (dN/dS) = 0.01722
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.023 431.8 75.2 0.0172 0.0008 0.0476 0.4 3.6
11..12 0.036 431.8 75.2 0.0172 0.0013 0.0730 0.5 5.5
12..13 0.028 431.8 75.2 0.0172 0.0010 0.0570 0.4 4.3
13..4 0.037 431.8 75.2 0.0172 0.0013 0.0754 0.6 5.7
13..5 0.036 431.8 75.2 0.0172 0.0013 0.0742 0.6 5.6
12..14 0.051 431.8 75.2 0.0172 0.0018 0.1039 0.8 7.8
14..15 0.034 431.8 75.2 0.0172 0.0012 0.0691 0.5 5.2
15..6 0.054 431.8 75.2 0.0172 0.0019 0.1109 0.8 8.3
15..8 0.129 431.8 75.2 0.0172 0.0046 0.2645 2.0 19.9
14..7 0.061 431.8 75.2 0.0172 0.0022 0.1257 0.9 9.5
14..16 0.021 431.8 75.2 0.0172 0.0007 0.0434 0.3 3.3
16..9 0.054 431.8 75.2 0.0172 0.0019 0.1111 0.8 8.4
16..10 0.065 431.8 75.2 0.0172 0.0023 0.1321 1.0 9.9
11..17 0.012 431.8 75.2 0.0172 0.0004 0.0247 0.2 1.9
17..2 0.018 431.8 75.2 0.0172 0.0006 0.0365 0.3 2.7
17..3 0.006 431.8 75.2 0.0172 0.0002 0.0115 0.1 0.9
tree length for dN: 0.0234
tree length for dS: 1.3605
Time used: 0:10
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
lnL(ntime: 16 np: 19): -1158.894640 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..8 14..7 14..16 16..9 16..10 11..17 17..2 17..3
0.024327 0.037678 0.029390 0.038330 0.037983 0.054231 0.034404 0.057292 0.131004 0.063675 0.018514 0.055838 0.066944 0.012652 0.018629 0.005866 1.415839 0.980982 0.007159
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68676
(1: 0.024327, ((4: 0.038330, 5: 0.037983): 0.029390, ((6: 0.057292, 8: 0.131004): 0.034404, 7: 0.063675, (9: 0.055838, 10: 0.066944): 0.018514): 0.054231): 0.037678, (2: 0.018629, 3: 0.005866): 0.012652);
(D_melanogaster_zetaCOP-PB: 0.024327, ((D_yakuba_zetaCOP-PB: 0.038330, D_erecta_zetaCOP-PB: 0.037983): 0.029390, ((D_takahashii_zetaCOP-PB: 0.057292, D_eugracilis_zetaCOP-PB: 0.131004): 0.034404, D_biarmipes_zetaCOP-PB: 0.063675, (D_rhopaloa_zetaCOP-PB: 0.055838, D_elegans_zetaCOP-PB: 0.066944): 0.018514): 0.054231): 0.037678, (D_sechellia_zetaCOP-PB: 0.018629, D_simulans_zetaCOP-PB: 0.005866): 0.012652);
Detailed output identifying parameters
kappa (ts/tv) = 1.41584
dN/dS (w) for site classes (K=2)
p: 0.98098 0.01902
w: 0.00716 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 431.7 75.3 0.0260 0.0012 0.0475 0.5 3.6
11..12 0.038 431.7 75.3 0.0260 0.0019 0.0735 0.8 5.5
12..13 0.029 431.7 75.3 0.0260 0.0015 0.0574 0.6 4.3
13..4 0.038 431.7 75.3 0.0260 0.0019 0.0748 0.8 5.6
13..5 0.038 431.7 75.3 0.0260 0.0019 0.0741 0.8 5.6
12..14 0.054 431.7 75.3 0.0260 0.0028 0.1059 1.2 8.0
14..15 0.034 431.7 75.3 0.0260 0.0017 0.0672 0.8 5.1
15..6 0.057 431.7 75.3 0.0260 0.0029 0.1118 1.3 8.4
15..8 0.131 431.7 75.3 0.0260 0.0067 0.2557 2.9 19.3
14..7 0.064 431.7 75.3 0.0260 0.0032 0.1243 1.4 9.4
14..16 0.019 431.7 75.3 0.0260 0.0009 0.0361 0.4 2.7
16..9 0.056 431.7 75.3 0.0260 0.0028 0.1090 1.2 8.2
16..10 0.067 431.7 75.3 0.0260 0.0034 0.1307 1.5 9.8
11..17 0.013 431.7 75.3 0.0260 0.0006 0.0247 0.3 1.9
17..2 0.019 431.7 75.3 0.0260 0.0009 0.0364 0.4 2.7
17..3 0.006 431.7 75.3 0.0260 0.0003 0.0115 0.1 0.9
Time used: 0:19
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
lnL(ntime: 16 np: 21): -1158.894641 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..8 14..7 14..16 16..9 16..10 11..17 17..2 17..3
0.024327 0.037678 0.029390 0.038330 0.037983 0.054231 0.034404 0.057292 0.131004 0.063675 0.018514 0.055838 0.066944 0.012652 0.018629 0.005866 1.415839 0.980982 0.019018 0.007159 44.286942
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68676
(1: 0.024327, ((4: 0.038330, 5: 0.037983): 0.029390, ((6: 0.057292, 8: 0.131004): 0.034404, 7: 0.063675, (9: 0.055838, 10: 0.066944): 0.018514): 0.054231): 0.037678, (2: 0.018629, 3: 0.005866): 0.012652);
(D_melanogaster_zetaCOP-PB: 0.024327, ((D_yakuba_zetaCOP-PB: 0.038330, D_erecta_zetaCOP-PB: 0.037983): 0.029390, ((D_takahashii_zetaCOP-PB: 0.057292, D_eugracilis_zetaCOP-PB: 0.131004): 0.034404, D_biarmipes_zetaCOP-PB: 0.063675, (D_rhopaloa_zetaCOP-PB: 0.055838, D_elegans_zetaCOP-PB: 0.066944): 0.018514): 0.054231): 0.037678, (D_sechellia_zetaCOP-PB: 0.018629, D_simulans_zetaCOP-PB: 0.005866): 0.012652);
Detailed output identifying parameters
kappa (ts/tv) = 1.41584
dN/dS (w) for site classes (K=3)
p: 0.98098 0.01902 0.00000
w: 0.00716 1.00000 44.28694
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 431.7 75.3 0.0260 0.0012 0.0475 0.5 3.6
11..12 0.038 431.7 75.3 0.0260 0.0019 0.0735 0.8 5.5
12..13 0.029 431.7 75.3 0.0260 0.0015 0.0574 0.6 4.3
13..4 0.038 431.7 75.3 0.0260 0.0019 0.0748 0.8 5.6
13..5 0.038 431.7 75.3 0.0260 0.0019 0.0741 0.8 5.6
12..14 0.054 431.7 75.3 0.0260 0.0028 0.1059 1.2 8.0
14..15 0.034 431.7 75.3 0.0260 0.0017 0.0672 0.8 5.1
15..6 0.057 431.7 75.3 0.0260 0.0029 0.1118 1.3 8.4
15..8 0.131 431.7 75.3 0.0260 0.0067 0.2557 2.9 19.3
14..7 0.064 431.7 75.3 0.0260 0.0032 0.1243 1.4 9.4
14..16 0.019 431.7 75.3 0.0260 0.0009 0.0361 0.4 2.7
16..9 0.056 431.7 75.3 0.0260 0.0028 0.1090 1.2 8.2
16..10 0.067 431.7 75.3 0.0260 0.0034 0.1307 1.5 9.8
11..17 0.013 431.7 75.3 0.0260 0.0006 0.0247 0.3 1.9
17..2 0.019 431.7 75.3 0.0260 0.0009 0.0364 0.4 2.7
17..3 0.006 431.7 75.3 0.0260 0.0003 0.0115 0.1 0.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaCOP-PB)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.301 0.142 0.094 0.077 0.070 0.066 0.064 0.063 0.062 0.061
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:56
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
check convergence..
lnL(ntime: 16 np: 22): -1158.842604 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..8 14..7 14..16 16..9 16..10 11..17 17..2 17..3
0.024145 0.037291 0.029212 0.038133 0.037726 0.053852 0.034140 0.057123 0.130751 0.063321 0.018859 0.055553 0.066566 0.012553 0.018494 0.005819 1.406532 0.285911 0.693538 0.006866 0.006867 0.822765
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68354
(1: 0.024145, ((4: 0.038133, 5: 0.037726): 0.029212, ((6: 0.057123, 8: 0.130751): 0.034140, 7: 0.063321, (9: 0.055553, 10: 0.066566): 0.018859): 0.053852): 0.037291, (2: 0.018494, 3: 0.005819): 0.012553);
(D_melanogaster_zetaCOP-PB: 0.024145, ((D_yakuba_zetaCOP-PB: 0.038133, D_erecta_zetaCOP-PB: 0.037726): 0.029212, ((D_takahashii_zetaCOP-PB: 0.057123, D_eugracilis_zetaCOP-PB: 0.130751): 0.034140, D_biarmipes_zetaCOP-PB: 0.063321, (D_rhopaloa_zetaCOP-PB: 0.055553, D_elegans_zetaCOP-PB: 0.066566): 0.018859): 0.053852): 0.037291, (D_sechellia_zetaCOP-PB: 0.018494, D_simulans_zetaCOP-PB: 0.005819): 0.012553);
Detailed output identifying parameters
kappa (ts/tv) = 1.40653
dN/dS (w) for site classes (K=3)
p: 0.28591 0.69354 0.02055
w: 0.00687 0.00687 0.82277
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 431.8 75.2 0.0236 0.0011 0.0478 0.5 3.6
11..12 0.037 431.8 75.2 0.0236 0.0017 0.0738 0.8 5.5
12..13 0.029 431.8 75.2 0.0236 0.0014 0.0578 0.6 4.3
13..4 0.038 431.8 75.2 0.0236 0.0018 0.0754 0.8 5.7
13..5 0.038 431.8 75.2 0.0236 0.0018 0.0746 0.8 5.6
12..14 0.054 431.8 75.2 0.0236 0.0025 0.1065 1.1 8.0
14..15 0.034 431.8 75.2 0.0236 0.0016 0.0675 0.7 5.1
15..6 0.057 431.8 75.2 0.0236 0.0027 0.1130 1.2 8.5
15..8 0.131 431.8 75.2 0.0236 0.0061 0.2586 2.6 19.5
14..7 0.063 431.8 75.2 0.0236 0.0030 0.1252 1.3 9.4
14..16 0.019 431.8 75.2 0.0236 0.0009 0.0373 0.4 2.8
16..9 0.056 431.8 75.2 0.0236 0.0026 0.1099 1.1 8.3
16..10 0.067 431.8 75.2 0.0236 0.0031 0.1317 1.3 9.9
11..17 0.013 431.8 75.2 0.0236 0.0006 0.0248 0.3 1.9
17..2 0.018 431.8 75.2 0.0236 0.0009 0.0366 0.4 2.8
17..3 0.006 431.8 75.2 0.0236 0.0003 0.0115 0.1 0.9
Naive Empirical Bayes (NEB) analysis
Time used: 1:18
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
lnL(ntime: 16 np: 19): -1160.150898 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..8 14..7 14..16 16..9 16..10 11..17 17..2 17..3
0.023544 0.036217 0.028407 0.037558 0.037005 0.051998 0.033304 0.055939 0.130680 0.062202 0.020652 0.054756 0.065420 0.012226 0.018053 0.005674 1.408055 0.012278 0.311319
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.67364
(1: 0.023544, ((4: 0.037558, 5: 0.037005): 0.028407, ((6: 0.055939, 8: 0.130680): 0.033304, 7: 0.062202, (9: 0.054756, 10: 0.065420): 0.020652): 0.051998): 0.036217, (2: 0.018053, 3: 0.005674): 0.012226);
(D_melanogaster_zetaCOP-PB: 0.023544, ((D_yakuba_zetaCOP-PB: 0.037558, D_erecta_zetaCOP-PB: 0.037005): 0.028407, ((D_takahashii_zetaCOP-PB: 0.055939, D_eugracilis_zetaCOP-PB: 0.130680): 0.033304, D_biarmipes_zetaCOP-PB: 0.062202, (D_rhopaloa_zetaCOP-PB: 0.054756, D_elegans_zetaCOP-PB: 0.065420): 0.020652): 0.051998): 0.036217, (D_sechellia_zetaCOP-PB: 0.018053, D_simulans_zetaCOP-PB: 0.005674): 0.012226);
Detailed output identifying parameters
kappa (ts/tv) = 1.40805
Parameters in M7 (beta):
p = 0.01228 q = 0.31132
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.20267
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 431.7 75.3 0.0203 0.0010 0.0474 0.4 3.6
11..12 0.036 431.7 75.3 0.0203 0.0015 0.0729 0.6 5.5
12..13 0.028 431.7 75.3 0.0203 0.0012 0.0571 0.5 4.3
13..4 0.038 431.7 75.3 0.0203 0.0015 0.0756 0.7 5.7
13..5 0.037 431.7 75.3 0.0203 0.0015 0.0744 0.7 5.6
12..14 0.052 431.7 75.3 0.0203 0.0021 0.1046 0.9 7.9
14..15 0.033 431.7 75.3 0.0203 0.0014 0.0670 0.6 5.0
15..6 0.056 431.7 75.3 0.0203 0.0023 0.1125 1.0 8.5
15..8 0.131 431.7 75.3 0.0203 0.0053 0.2629 2.3 19.8
14..7 0.062 431.7 75.3 0.0203 0.0025 0.1251 1.1 9.4
14..16 0.021 431.7 75.3 0.0203 0.0008 0.0415 0.4 3.1
16..9 0.055 431.7 75.3 0.0203 0.0022 0.1102 1.0 8.3
16..10 0.065 431.7 75.3 0.0203 0.0027 0.1316 1.2 9.9
11..17 0.012 431.7 75.3 0.0203 0.0005 0.0246 0.2 1.9
17..2 0.018 431.7 75.3 0.0203 0.0007 0.0363 0.3 2.7
17..3 0.006 431.7 75.3 0.0203 0.0002 0.0114 0.1 0.9
Time used: 2:48
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((6, 8), 7, (9, 10))), (2, 3)); MP score: 101
lnL(ntime: 16 np: 21): -1158.932845 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..6 15..8 14..7 14..16 16..9 16..10 11..17 17..2 17..3
0.024310 0.037652 0.029366 0.038315 0.037968 0.054166 0.034354 0.057249 0.130995 0.063626 0.018580 0.055785 0.066891 0.012643 0.018617 0.005862 1.416412 0.981186 0.762135 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68638
(1: 0.024310, ((4: 0.038315, 5: 0.037968): 0.029366, ((6: 0.057249, 8: 0.130995): 0.034354, 7: 0.063626, (9: 0.055785, 10: 0.066891): 0.018580): 0.054166): 0.037652, (2: 0.018617, 3: 0.005862): 0.012643);
(D_melanogaster_zetaCOP-PB: 0.024310, ((D_yakuba_zetaCOP-PB: 0.038315, D_erecta_zetaCOP-PB: 0.037968): 0.029366, ((D_takahashii_zetaCOP-PB: 0.057249, D_eugracilis_zetaCOP-PB: 0.130995): 0.034354, D_biarmipes_zetaCOP-PB: 0.063626, (D_rhopaloa_zetaCOP-PB: 0.055785, D_elegans_zetaCOP-PB: 0.066891): 0.018580): 0.054166): 0.037652, (D_sechellia_zetaCOP-PB: 0.018617, D_simulans_zetaCOP-PB: 0.005862): 0.012643);
Detailed output identifying parameters
kappa (ts/tv) = 1.41641
Parameters in M8 (beta&w>1):
p0 = 0.98119 p = 0.76214 q = 99.00000
(p1 = 0.01881) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09812 0.09812 0.09812 0.09812 0.09812 0.09812 0.09812 0.09812 0.09812 0.09812 0.01881
w: 0.00018 0.00079 0.00161 0.00265 0.00393 0.00556 0.00767 0.01058 0.01512 0.02512 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 431.7 75.3 0.0260 0.0012 0.0475 0.5 3.6
11..12 0.038 431.7 75.3 0.0260 0.0019 0.0735 0.8 5.5
12..13 0.029 431.7 75.3 0.0260 0.0015 0.0573 0.6 4.3
13..4 0.038 431.7 75.3 0.0260 0.0019 0.0748 0.8 5.6
13..5 0.038 431.7 75.3 0.0260 0.0019 0.0741 0.8 5.6
12..14 0.054 431.7 75.3 0.0260 0.0027 0.1057 1.2 8.0
14..15 0.034 431.7 75.3 0.0260 0.0017 0.0671 0.8 5.1
15..6 0.057 431.7 75.3 0.0260 0.0029 0.1118 1.3 8.4
15..8 0.131 431.7 75.3 0.0260 0.0066 0.2557 2.9 19.3
14..7 0.064 431.7 75.3 0.0260 0.0032 0.1242 1.4 9.4
14..16 0.019 431.7 75.3 0.0260 0.0009 0.0363 0.4 2.7
16..9 0.056 431.7 75.3 0.0260 0.0028 0.1089 1.2 8.2
16..10 0.067 431.7 75.3 0.0260 0.0034 0.1306 1.5 9.8
11..17 0.013 431.7 75.3 0.0260 0.0006 0.0247 0.3 1.9
17..2 0.019 431.7 75.3 0.0260 0.0009 0.0363 0.4 2.7
17..3 0.006 431.7 75.3 0.0260 0.0003 0.0114 0.1 0.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaCOP-PB)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.001 0.012 0.065 0.239 0.683
ws: 0.377 0.146 0.087 0.068 0.060 0.056 0.053 0.052 0.051 0.050
Time used: 5:12
Model 1: NearlyNeutral -1158.89464 Model 2: PositiveSelection -1158.894641 Model 0: one-ratio -1166.087332 Model 3: discrete -1158.842604 Model 7: beta -1160.150898 Model 8: beta&w>1 -1158.932845 Model 0 vs 1 14.385384000000158 Model 2 vs 1 2.000000222324161E-6 Model 8 vs 7 2.436106000000109
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
