--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Dec 09 17:06:44 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/443/Zip99C-PC/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2349.51 -2360.38 2 -2349.62 -2360.11 -------------------------------------- TOTAL -2349.56 -2360.25 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.598460 0.009453 0.419233 0.783002 0.589213 1308.81 1336.85 1.000 r(A<->C){all} 0.060198 0.000535 0.017425 0.105924 0.058069 636.63 936.88 1.000 r(A<->G){all} 0.302016 0.002879 0.202935 0.407400 0.299056 671.05 673.71 1.000 r(A<->T){all} 0.095279 0.001031 0.036036 0.159353 0.092172 806.25 859.89 1.000 r(C<->G){all} 0.070218 0.000517 0.028129 0.114298 0.068591 881.69 922.77 1.001 r(C<->T){all} 0.442857 0.003376 0.334826 0.559949 0.442739 643.71 753.74 1.000 r(G<->T){all} 0.029432 0.000349 0.000369 0.065507 0.026363 783.06 888.64 1.000 pi(A){all} 0.232778 0.000154 0.209900 0.257917 0.232473 1247.18 1263.37 1.000 pi(C){all} 0.265570 0.000164 0.239568 0.289702 0.265306 1107.26 1235.94 1.001 pi(G){all} 0.271292 0.000176 0.245437 0.297976 0.271464 1275.61 1307.67 1.002 pi(T){all} 0.230360 0.000160 0.205557 0.254634 0.230313 1217.72 1259.88 1.002 alpha{1,2} 0.034983 0.000500 0.000101 0.074905 0.032654 1333.08 1334.50 1.000 alpha{3} 2.975165 0.830374 1.460144 4.822226 2.854021 1376.44 1421.17 1.000 pinvar{all} 0.552452 0.001549 0.471232 0.625442 0.554531 1390.96 1439.25 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2222.79395 Model 2: PositiveSelection -2222.79395 Model 0: one-ratio -2223.045425 Model 3: discrete -2222.622231 Model 7: beta -2222.629193 Model 8: beta&w>1 -2222.629408 Model 0 vs 1 0.5029499999991458 Model 2 vs 1 0.0 Model 8 vs 7 4.2999999914172804E-4
>C1 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT MLFEH >C2 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C3 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C4 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C5 MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C6 MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=355 C1 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG C2 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG C3 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG C4 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG C5 MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG C6 MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG *:******* *:**** *::***** ************************ C1 IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA C2 IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA C3 IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA C4 IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA C5 IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA C6 IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA ******************:***:*************************** C1 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV C2 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV C3 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV C4 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV C5 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV C6 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV *****************************************:******** C1 EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE C2 EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE C3 EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE C4 EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE C5 EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE C6 EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE ************::*:* **************.*******:* ****:** C1 QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH C2 QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH C3 QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH C4 QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH C5 QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH C6 QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH ************************************************** C1 EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART C2 EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART C3 EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART C4 EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART C5 EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART C6 EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART ************************************************** C1 SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT C2 SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT C3 SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT C4 SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT C5 SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT C6 SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT ***************************************:********** C1 MLFEH C2 MLFEH C3 MLFEH C4 MLFEH C5 MLFEH C6 MLFEH ***** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 355 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 355 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10650] Library Relaxation: Multi_proc [72] Relaxation Summary: [10650]--->[10650] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip99C-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.367 Mb, Max= 30.781 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT MLFEH >C2 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C3 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C4 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C5 MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C6 MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH FORMAT of file /tmp/tmp8891164788968876298aln Not Supported[FATAL:T-COFFEE] >C1 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT MLFEH >C2 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C3 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C4 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C5 MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C6 MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:355 S:100 BS:355 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 98.87 C1 C2 98.87 TOP 1 0 98.87 C2 C1 98.87 BOT 0 2 98.87 C1 C3 98.87 TOP 2 0 98.87 C3 C1 98.87 BOT 0 3 98.31 C1 C4 98.31 TOP 3 0 98.31 C4 C1 98.31 BOT 0 4 97.75 C1 C5 97.75 TOP 4 0 97.75 C5 C1 97.75 BOT 0 5 96.90 C1 C6 96.90 TOP 5 0 96.90 C6 C1 96.90 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 98.31 C2 C4 98.31 TOP 3 1 98.31 C4 C2 98.31 BOT 1 4 97.75 C2 C5 97.75 TOP 4 1 97.75 C5 C2 97.75 BOT 1 5 96.90 C2 C6 96.90 TOP 5 1 96.90 C6 C2 96.90 BOT 2 3 98.31 C3 C4 98.31 TOP 3 2 98.31 C4 C3 98.31 BOT 2 4 97.75 C3 C5 97.75 TOP 4 2 97.75 C5 C3 97.75 BOT 2 5 96.90 C3 C6 96.90 TOP 5 2 96.90 C6 C3 96.90 BOT 3 4 98.31 C4 C5 98.31 TOP 4 3 98.31 C5 C4 98.31 BOT 3 5 96.90 C4 C6 96.90 TOP 5 3 96.90 C6 C4 96.90 BOT 4 5 96.90 C5 C6 96.90 TOP 5 4 96.90 C6 C5 96.90 AVG 0 C1 * 98.14 AVG 1 C2 * 98.37 AVG 2 C3 * 98.37 AVG 3 C4 * 98.03 AVG 4 C5 * 97.69 AVG 5 C6 * 96.90 TOT TOT * 97.92 CLUSTAL W (1.83) multiple sequence alignment C1 ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTC C2 ATGGCCACGAACAGCAGCTTCTTCGATGCACACATCGCCATGATATACTC C3 ATGGCCACGAACAGCAGCTTCTTCGATGCACACATCGCCATGATATACTC C4 ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTC C5 ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTT C6 ATGACCACCAACAGCAGCTTCTTCGATGAACATTTCGCTATGATATACTC ***.**** *******************.*** :**** ********** C1 CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTTGAGTACA C2 CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA C3 CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA C4 CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA C5 CAACCTGGTGGACCAGTACATGCCCGCGTACTTCAAAAGCTTCGAGTACA C6 GAACATAATGGATCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA ***.*..**** *************.*************** ******* C1 CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTAATTGGACTGAGTGGC C2 CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC C3 CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC C4 CACCATGGGTATTCTCTCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC C5 CACCATGGGTTTTCTCTCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC C6 CGCCATGGGTCTTCTCTCTGCTGGGATCGGTGGTCATCGGTCTGAGTGGC *.******** ***** *****************.** **:********* C1 ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG C2 ATATTCCCGCTGATTATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG C3 ATATTCCCGCTGATTATCATTCCCACAGAGGAGAAAATGGCTAAGGAGGG C4 ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG C5 ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG C6 ATATTCCCACTGATCATCATTCCAACGGAGGAAAAAATGGCAAAAGAAGG ********.***** ********.**.*****.********:**.**.** C1 ATACAAAGATCCTGCAGATTCAAAACTCCTGCGAGTGCTTCTGAGTTTCG C2 ATACAAAGATCCTGCAGATTCCAAACTCCTGCGAGTGCTTCTGAGTTTCG C3 ATACAAAGATCCTGCAGATTCAAAACTCCTGCGAGTGCTTCTGAGTTTCG C4 ATACAATGATCCTGCAGAATCAAAACTCCTGCGAGTGCTTCTCAGTTTCG C5 ATACAAAGATCCTGCAGAATCAAAACTCCTGCGAGTGCTTCTCAGTTTTG C6 ATATAAAGATCCTGCGGAATCTAAACTCCTGCGAGTTCTCCTAAGTTTTG *** **:********.**:** ************** ** ** ***** * C1 CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTTCACCTGTTGCCAGAAGCC C2 CAGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC C3 CAGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC C4 CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC C5 CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC C6 CAGTCGGTGGACTCCTGGGTGATGTGTTTCTTCACTTGCTGCCAGAAGCC *.***** **:** ***** ******** ** *** ** *********** C1 TGGGAGGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG C2 TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG C3 TGGGAGGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG C4 TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG C5 TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG C6 TGGGAAGGCGATAATCAAGATCCATCTAGTCACCCATCGCTGCGGTCGGG *****.*****************:************** ***** ***** C1 CCTTTGGGTACTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT C2 CCTTTGGGTCCTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT C3 CCTTTGGGTCCTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT C4 CCTTTGGGTCCTTTCCGGCATACTGATCTTCACAATCGTGGAGAAAATCT C5 CCTTTGGGTCCTTTCCGGCATACTGATTTTCACAATCGTGGAGAAAATCT C6 TCTTTGGGTCCTCTCCGGCATACTCATCTTCACAATAGTGGAGAAAATCT ********.** *********** ** *****.**.************* C1 TTTCCGGATATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG C2 TCTCCGGTTATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG C3 TCTCCGGTTATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG C4 TCTCCGGCTATGCGAGCGCGGACGACGAGAATCCTCAGCCCAAGTGCGTG C5 TTTCCGGCTATGCCAGCGCGGACGACGAGAATCCTCAGCCCAAGTGCGTG C6 TCTCCGGATATGCCAGCGCGGACGAGGAAAATCCTCAGCCCAAGTGCGTC * ***** ***** *********** **.** ***************** C1 GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG C2 GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG C3 GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG C4 GAGATAGCCAACTGCCTGCTGCGTCGACATGGCGGCCAGCTACCAGATGG C5 GAGATAGCCAACTGCCTGTTGCGTCGACATGGAGGCCAACTACCAGAGGG C6 GAGATAGCCAACTGCCTGCTGCGGCGACATGGAGGAAAAATGCCTGAAGG ****************** **** ********.**..*..*.**:** ** C1 CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA C2 CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA C3 CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA C4 CGAAACCTCCGAGAGCTGTGGCGGCGCCTGCGATATCGAAGATGTGGGTA C5 CGAAACGTCCGAGAGTTGTGGCGGCGCCTGCGATATCGAAGATGTGGGTA C6 TGGGACGTCCGAGAGTTGTGGTGGTGCCTGCGATATTGAAGATGTGGACA *..** ** ***** ***** ** ******** ** ********.*. * C1 AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCAAAGGAAAGGAAGGAA C2 AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG C3 AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG C4 AAGTCTGTTTCCTGCGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG C5 AAGTCTGTTTCCTACGCGAGCGGGAACAAAAGTCCAAGGAAAAGAAGGAG C6 AAGTGTGCTTTCTCCGCGAACGGGAACTGAAGTCGAAGGAGAAGAAGGAA **** ** ** ** *****.*.*****:.***** *****.*.******. C1 CAGCCGAAGAAGGTGGCTGGTTATCTGAACCTCTTGGCCAACTCAATTGA C2 CAGCCGAAGAAGGTGGCTGGCTATCTGAACCTTTTGGCCAACTCAATAGA C3 CAGCCGAAGAAGGTGGCTGGCTATCTGAACCTTTTGGCCAACTCAATAGA C4 CAGCCGAAGAAAGTGGCTGGGTATCTGAACCTTTTGGCCAATTCAATTGA C5 CAGCCGAAGAAAGTGGCTGGGTATCTGAACCTCTTGGCCAACTCAATCGA C6 CAGCCTAAGAAAGTGGCTGGCTATCTGAACCTCTTGGCCAACTCAATTGA ***** *****.******** *********** ******** ***** ** C1 CAATTTCACACACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA C2 CAATTTCACACACGGTCTGGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA C3 CAATTTCACACACGGTCTGGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA C4 CAATTTCACCCACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA C5 CAATTTCACACACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA C6 CAATTTCACACATGGTCTAGCTGTAGCTGGATCCTTTTTGGTATCCTTCA *********.** *****.** **.*****************.******* C1 GACACGGCATTCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC C2 GACACGGTATCCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC C3 GACACGGTATCCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC C4 GGCACGGAATCCTAGCGACATTCGCCATATTGCTTCATGAAATTCCGCAC C5 GGCACGGAATCCTAGCGACATTCGCCATATTGCTTCACGAAATTCCACAC C6 GACATGGAATCCTGGCCACATTTGCCATATTGCTGCATGAAATTCCGCAC *.** ** ** **.** **:** *********** ** ********.*** C1 GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA C2 GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA C3 GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA C4 GAGGTGGGGGATTTTGCAATCCTGCTTCGATCTGGATTCAGTCGCTGGGA C5 GAGGTGGGCGATTTCGCAATCCTGCTTAGATCTGGGTTCAGTCGTTGGGA C6 GAGGTAGGCGATTTTGCCATCCTGCTTCGATCCGGATTCAGTCGCTGGGA *****.** ***** **.*********.**** **.******** ***** C1 CGCCGCGCGTGCGCAACTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC C2 CGCCGCGCGTGCGCAGCTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC C3 CGCCGCGCGTGCGCAGCTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC C4 CGCCGCGCGTGCGCAGCTCCTCACGGCGGGAGCTGGCTTGCTCGGTGCTC C5 CGCCGCGCGTGCGCAACTTCTCACGGCTGGAGCTGGCCTGCTCGGTGCTC C6 CGCCGCGCGGGCGCAGCTCCTGACGGCGGGAGCTGGCCTTCTGGGCGCTC ********* *****.** ** ***** ********* * ** ** **** C1 TGGTGGCCATCGGAGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT C2 TGGTGGCCATCGGAGGTTCTGGCGTAACGTCGGCCATGGAGGCACGTACT C3 TGGTGGCCATCGGAGGTTCCGGCGTAACGTCGGCCATGGAGGCACGTACT C4 TGGTAGCCATCGGAGGCTCCGGCGTAACATCGGCCATGGAGGCACGTACT C5 TGGTGGCCATCGGTGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT C6 TGGTGGCCATCGGAGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT ****.********:** ** ********.********************* C1 TCGTGGATTATGCCGTTCACCGCCGGCGGCTTTCTGCACATTGCTCTGGT C2 TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT C3 TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT C4 TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT C5 TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT C6 TCGTGGATCATGCCGTTCACCGCCGGCGGCTTTCTGCACATTGCCCTGGT ******** *********** *********************** ***** C1 CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATTA C2 CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA C3 CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA C4 CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA C5 CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATTA C6 CACAGTATTACCTGATCTCTTAAAGGAAGAGGAGCGGAAGGAGTCTATTA *********************.*****.******** ******** ** * C1 AGCAGCTGCTAGCACTGGTATTTGGCATTGCGTTAATGGCCGTGATGACC C2 AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC C3 AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC C4 AGCAGCTGCTGGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC C5 AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC C6 AGCAGCTGCTAGCACTGATATTTGGGATTGCGTTAATGGCCGTGATGACC **********.******.******* ************************ C1 ATGCTATTCGAACAC C2 ATGCTATTCGAACAC C3 ATGCTATTCGAACAC C4 ATGCTATTCGAACAC C5 ATGCTATTCGAACAC C6 ATGCTATTCGAACAC *************** >C1 ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTTGAGTACA CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTAATTGGACTGAGTGGC ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGATTCAAAACTCCTGCGAGTGCTTCTGAGTTTCG CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTTCACCTGTTGCCAGAAGCC TGGGAGGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTACTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT TTTCCGGATATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCAAAGGAAAGGAAGGAA CAGCCGAAGAAGGTGGCTGGTTATCTGAACCTCTTGGCCAACTCAATTGA CAATTTCACACACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GACACGGCATTCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAACTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGAGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACCGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATTA AGCAGCTGCTAGCACTGGTATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >C2 ATGGCCACGAACAGCAGCTTCTTCGATGCACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATTATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGATTCCAAACTCCTGCGAGTGCTTCTGAGTTTCG CAGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT TCTCCGGTTATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG CAGCCGAAGAAGGTGGCTGGCTATCTGAACCTTTTGGCCAACTCAATAGA CAATTTCACACACGGTCTGGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GACACGGTATCCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAGCTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGAGGTTCTGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >C3 ATGGCCACGAACAGCAGCTTCTTCGATGCACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATTATCATTCCCACAGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGATTCAAAACTCCTGCGAGTGCTTCTGAGTTTCG CAGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAGGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT TCTCCGGTTATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG CAGCCGAAGAAGGTGGCTGGCTATCTGAACCTTTTGGCCAACTCAATAGA CAATTTCACACACGGTCTGGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GACACGGTATCCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAGCTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGAGGTTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >C4 ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CACCATGGGTATTCTCTCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAATGATCCTGCAGAATCAAAACTCCTGCGAGTGCTTCTCAGTTTCG CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATCTTCACAATCGTGGAGAAAATCT TCTCCGGCTATGCGAGCGCGGACGACGAGAATCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGCTGCGTCGACATGGCGGCCAGCTACCAGATGG CGAAACCTCCGAGAGCTGTGGCGGCGCCTGCGATATCGAAGATGTGGGTA AAGTCTGTTTCCTGCGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG CAGCCGAAGAAAGTGGCTGGGTATCTGAACCTTTTGGCCAATTCAATTGA CAATTTCACCCACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GGCACGGAATCCTAGCGACATTCGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTTGCAATCCTGCTTCGATCTGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAGCTCCTCACGGCGGGAGCTGGCTTGCTCGGTGCTC TGGTAGCCATCGGAGGCTCCGGCGTAACATCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA AGCAGCTGCTGGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >C5 ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTT CAACCTGGTGGACCAGTACATGCCCGCGTACTTCAAAAGCTTCGAGTACA CACCATGGGTTTTCTCTCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGAATCAAAACTCCTGCGAGTGCTTCTCAGTTTTG CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATTTTCACAATCGTGGAGAAAATCT TTTCCGGCTATGCCAGCGCGGACGACGAGAATCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGAGGCCAACTACCAGAGGG CGAAACGTCCGAGAGTTGTGGCGGCGCCTGCGATATCGAAGATGTGGGTA AAGTCTGTTTCCTACGCGAGCGGGAACAAAAGTCCAAGGAAAAGAAGGAG CAGCCGAAGAAAGTGGCTGGGTATCTGAACCTCTTGGCCAACTCAATCGA CAATTTCACACACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GGCACGGAATCCTAGCGACATTCGCCATATTGCTTCACGAAATTCCACAC GAGGTGGGCGATTTCGCAATCCTGCTTAGATCTGGGTTCAGTCGTTGGGA CGCCGCGCGTGCGCAACTTCTCACGGCTGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGTGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATTA AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >C6 ATGACCACCAACAGCAGCTTCTTCGATGAACATTTCGCTATGATATACTC GAACATAATGGATCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CGCCATGGGTCTTCTCTCTGCTGGGATCGGTGGTCATCGGTCTGAGTGGC ATATTCCCACTGATCATCATTCCAACGGAGGAAAAAATGGCAAAAGAAGG ATATAAAGATCCTGCGGAATCTAAACTCCTGCGAGTTCTCCTAAGTTTTG CAGTCGGTGGACTCCTGGGTGATGTGTTTCTTCACTTGCTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCATCTAGTCACCCATCGCTGCGGTCGGG TCTTTGGGTCCTCTCCGGCATACTCATCTTCACAATAGTGGAGAAAATCT TCTCCGGATATGCCAGCGCGGACGAGGAAAATCCTCAGCCCAAGTGCGTC GAGATAGCCAACTGCCTGCTGCGGCGACATGGAGGAAAAATGCCTGAAGG TGGGACGTCCGAGAGTTGTGGTGGTGCCTGCGATATTGAAGATGTGGACA AAGTGTGCTTTCTCCGCGAACGGGAACTGAAGTCGAAGGAGAAGAAGGAA CAGCCTAAGAAAGTGGCTGGCTATCTGAACCTCTTGGCCAACTCAATTGA CAATTTCACACATGGTCTAGCTGTAGCTGGATCCTTTTTGGTATCCTTCA GACATGGAATCCTGGCCACATTTGCCATATTGCTGCATGAAATTCCGCAC GAGGTAGGCGATTTTGCCATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGGGCGCAGCTCCTGACGGCGGGAGCTGGCCTTCTGGGCGCTC TGGTGGCCATCGGAGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATCATGCCGTTCACCGCCGGCGGCTTTCTGCACATTGCCCTGGT CACAGTATTACCTGATCTCTTAAAGGAAGAGGAGCGGAAGGAGTCTATTA AGCAGCTGCTAGCACTGATATTTGGGATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >C1 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT MLFEH >C2 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C3 MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C4 MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C5 MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >C6 MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1065 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481302868 Setting output file names to "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 283875820 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 2888769014 Seed = 571690871 Swapseed = 1481302868 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 14 unique site patterns Division 2 has 12 unique site patterns Division 3 has 71 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3078.307625 -- -24.965149 Chain 2 -- -3077.346468 -- -24.965149 Chain 3 -- -3097.578492 -- -24.965149 Chain 4 -- -3052.597495 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3019.281161 -- -24.965149 Chain 2 -- -2997.046419 -- -24.965149 Chain 3 -- -3086.577017 -- -24.965149 Chain 4 -- -3098.556644 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3078.308] (-3077.346) (-3097.578) (-3052.597) * [-3019.281] (-2997.046) (-3086.577) (-3098.557) 500 -- (-2450.920) [-2434.124] (-2453.929) (-2452.513) * (-2450.816) [-2439.625] (-2453.296) (-2458.590) -- 0:00:00 1000 -- [-2439.020] (-2429.888) (-2434.147) (-2451.302) * (-2442.008) (-2423.640) [-2405.195] (-2455.247) -- 0:00:00 1500 -- (-2428.081) (-2410.923) [-2416.567] (-2434.491) * (-2436.379) (-2395.657) [-2394.218] (-2451.597) -- 0:00:00 2000 -- (-2411.106) (-2413.522) [-2398.167] (-2423.406) * (-2412.213) [-2378.955] (-2387.077) (-2434.099) -- 0:08:19 2500 -- (-2377.904) [-2372.813] (-2386.231) (-2409.193) * (-2389.481) [-2359.260] (-2364.833) (-2415.999) -- 0:06:39 3000 -- (-2371.994) [-2357.534] (-2368.377) (-2404.068) * (-2375.663) [-2361.023] (-2367.009) (-2392.893) -- 0:05:32 3500 -- (-2358.613) [-2356.062] (-2367.890) (-2365.447) * (-2358.044) [-2361.723] (-2355.139) (-2379.579) -- 0:04:44 4000 -- (-2360.622) [-2351.769] (-2362.797) (-2364.033) * (-2354.838) (-2360.686) [-2352.939] (-2389.529) -- 0:04:09 4500 -- (-2354.536) (-2353.147) (-2351.591) [-2353.782] * [-2355.705] (-2360.937) (-2350.196) (-2372.566) -- 0:03:41 5000 -- (-2355.082) (-2355.010) (-2363.969) [-2356.896] * (-2355.389) [-2357.122] (-2353.916) (-2373.314) -- 0:03:19 Average standard deviation of split frequencies: 0.031427 5500 -- [-2357.199] (-2351.308) (-2352.061) (-2354.340) * (-2360.920) (-2356.762) [-2355.686] (-2360.375) -- 0:03:00 6000 -- (-2354.197) (-2354.695) [-2353.016] (-2356.964) * [-2350.266] (-2362.200) (-2356.319) (-2354.391) -- 0:02:45 6500 -- (-2354.411) [-2358.397] (-2351.085) (-2359.772) * [-2354.785] (-2360.468) (-2351.822) (-2357.773) -- 0:05:05 7000 -- (-2358.321) (-2353.928) (-2357.682) [-2354.953] * (-2354.374) (-2360.253) (-2359.153) [-2354.977] -- 0:04:43 7500 -- (-2352.702) (-2352.140) [-2352.306] (-2347.982) * (-2359.770) (-2360.820) [-2355.052] (-2357.013) -- 0:04:24 8000 -- [-2355.922] (-2350.601) (-2360.305) (-2352.932) * (-2354.486) [-2351.563] (-2358.617) (-2360.104) -- 0:04:08 8500 -- (-2360.542) (-2351.919) (-2360.252) [-2349.779] * [-2353.875] (-2352.017) (-2353.261) (-2357.209) -- 0:03:53 9000 -- (-2351.986) [-2353.457] (-2361.114) (-2356.225) * (-2352.661) (-2347.698) [-2351.599] (-2364.477) -- 0:03:40 9500 -- (-2359.412) (-2354.270) [-2357.595] (-2356.124) * (-2357.015) [-2351.170] (-2352.786) (-2356.471) -- 0:03:28 10000 -- (-2356.898) (-2357.594) [-2354.923] (-2350.915) * (-2351.402) (-2357.310) (-2355.575) [-2353.861] -- 0:03:18 Average standard deviation of split frequencies: 0.022097 10500 -- (-2362.510) [-2352.199] (-2351.217) (-2352.595) * (-2358.390) (-2360.801) [-2354.676] (-2360.109) -- 0:03:08 11000 -- (-2357.109) (-2346.640) (-2357.123) [-2353.067] * (-2350.101) (-2351.630) (-2348.816) [-2352.394] -- 0:04:29 11500 -- (-2351.932) (-2351.268) [-2351.851] (-2363.870) * (-2351.371) (-2356.527) (-2358.739) [-2354.256] -- 0:04:17 12000 -- [-2354.604] (-2355.631) (-2352.465) (-2356.937) * (-2353.796) (-2357.773) [-2349.939] (-2354.922) -- 0:04:07 12500 -- (-2364.937) (-2352.811) [-2362.879] (-2355.271) * (-2352.306) (-2351.730) [-2350.841] (-2355.895) -- 0:03:57 13000 -- [-2351.388] (-2354.012) (-2358.530) (-2354.621) * (-2353.049) [-2352.424] (-2355.190) (-2363.128) -- 0:03:47 13500 -- (-2349.934) (-2351.736) (-2356.537) [-2355.835] * (-2347.436) (-2351.154) [-2348.764] (-2355.211) -- 0:03:39 14000 -- (-2356.752) (-2351.382) [-2358.660] (-2355.208) * (-2351.169) (-2357.388) (-2350.908) [-2354.497] -- 0:03:31 14500 -- (-2350.269) [-2350.190] (-2351.332) (-2351.575) * (-2357.309) (-2355.548) [-2352.631] (-2361.773) -- 0:03:23 15000 -- [-2347.124] (-2355.512) (-2349.751) (-2361.072) * (-2357.275) [-2351.276] (-2353.835) (-2354.225) -- 0:03:17 Average standard deviation of split frequencies: 0.051560 15500 -- (-2356.416) (-2350.171) [-2355.770] (-2364.273) * (-2354.943) (-2352.227) [-2352.196] (-2353.955) -- 0:04:14 16000 -- (-2354.315) (-2353.143) [-2352.459] (-2355.430) * (-2351.887) (-2348.003) (-2353.816) [-2355.921] -- 0:04:06 16500 -- (-2359.159) [-2348.614] (-2350.332) (-2353.102) * [-2350.671] (-2355.163) (-2356.380) (-2358.920) -- 0:03:58 17000 -- (-2354.551) (-2354.707) [-2354.021] (-2351.894) * (-2357.021) [-2361.270] (-2352.390) (-2363.264) -- 0:03:51 17500 -- (-2357.729) (-2350.247) (-2353.974) [-2350.391] * (-2355.066) (-2356.929) (-2354.651) [-2358.249] -- 0:03:44 18000 -- (-2347.577) (-2356.722) [-2352.199] (-2353.984) * (-2356.680) (-2350.644) (-2349.928) [-2348.603] -- 0:03:38 18500 -- (-2363.365) (-2356.574) (-2352.501) [-2356.177] * [-2352.991] (-2357.171) (-2357.995) (-2356.820) -- 0:03:32 19000 -- [-2352.904] (-2358.897) (-2351.711) (-2360.843) * [-2357.518] (-2351.004) (-2358.608) (-2357.961) -- 0:03:26 19500 -- (-2356.146) (-2352.232) [-2349.909] (-2351.590) * (-2362.055) [-2360.272] (-2364.039) (-2351.514) -- 0:03:21 20000 -- (-2357.916) [-2350.918] (-2348.636) (-2349.985) * (-2357.923) (-2351.426) [-2353.185] (-2357.264) -- 0:04:05 Average standard deviation of split frequencies: 0.102645 20500 -- [-2348.699] (-2350.761) (-2351.953) (-2352.842) * [-2353.121] (-2357.876) (-2353.434) (-2355.268) -- 0:03:58 21000 -- (-2350.320) (-2351.357) (-2351.948) [-2350.630] * (-2358.580) (-2359.863) (-2349.053) [-2359.561] -- 0:03:53 21500 -- [-2351.851] (-2360.430) (-2358.221) (-2353.399) * (-2357.339) (-2359.374) (-2356.074) [-2348.759] -- 0:03:47 22000 -- [-2357.728] (-2360.051) (-2356.657) (-2352.254) * [-2355.712] (-2352.747) (-2351.959) (-2354.965) -- 0:03:42 22500 -- (-2355.201) (-2355.099) (-2360.643) [-2354.137] * (-2353.270) (-2351.649) [-2356.037] (-2361.519) -- 0:03:37 23000 -- (-2358.517) (-2352.760) (-2347.223) [-2352.477] * [-2356.618] (-2352.396) (-2363.551) (-2363.372) -- 0:03:32 23500 -- (-2356.655) (-2366.019) [-2351.452] (-2354.933) * (-2361.459) (-2350.411) (-2354.934) [-2351.774] -- 0:03:27 24000 -- (-2357.380) (-2360.021) [-2350.697] (-2353.612) * [-2362.864] (-2347.926) (-2366.363) (-2352.629) -- 0:03:23 24500 -- (-2355.786) (-2350.974) [-2351.234] (-2355.654) * (-2354.682) (-2353.169) [-2350.526] (-2357.169) -- 0:03:58 25000 -- [-2356.400] (-2359.453) (-2348.763) (-2351.219) * (-2350.181) [-2348.111] (-2350.321) (-2360.041) -- 0:03:54 Average standard deviation of split frequencies: 0.058926 25500 -- (-2357.644) (-2350.073) (-2355.082) [-2355.273] * (-2359.863) [-2352.148] (-2349.062) (-2361.771) -- 0:03:49 26000 -- (-2348.700) (-2351.889) (-2353.239) [-2351.687] * (-2350.353) (-2355.161) (-2360.598) [-2348.133] -- 0:03:44 26500 -- [-2351.416] (-2348.498) (-2352.985) (-2356.062) * (-2348.790) (-2357.645) [-2355.215] (-2354.079) -- 0:03:40 27000 -- [-2350.341] (-2356.007) (-2355.443) (-2354.118) * (-2349.356) (-2359.614) [-2352.978] (-2354.433) -- 0:03:36 27500 -- (-2349.601) (-2357.700) (-2357.107) [-2351.075] * (-2358.113) (-2366.416) [-2350.800] (-2353.056) -- 0:03:32 28000 -- (-2355.464) (-2353.306) (-2358.048) [-2350.160] * (-2354.643) (-2359.444) (-2353.693) [-2354.158] -- 0:03:28 28500 -- (-2357.671) (-2352.245) (-2362.808) [-2355.615] * (-2357.011) (-2364.749) [-2356.508] (-2353.643) -- 0:03:24 29000 -- [-2358.799] (-2368.358) (-2353.249) (-2356.452) * (-2346.728) (-2355.408) [-2349.833] (-2353.543) -- 0:03:54 29500 -- (-2354.250) (-2365.691) [-2360.412] (-2353.699) * (-2358.076) (-2356.684) [-2350.066] (-2357.419) -- 0:03:50 30000 -- (-2349.013) (-2353.352) (-2360.156) [-2351.042] * [-2355.305] (-2357.851) (-2350.445) (-2352.275) -- 0:03:46 Average standard deviation of split frequencies: 0.065331 30500 -- (-2356.592) (-2351.470) (-2360.050) [-2348.467] * (-2356.150) (-2370.251) [-2351.801] (-2350.043) -- 0:03:42 31000 -- (-2355.639) (-2356.546) (-2358.775) [-2351.306] * [-2354.091] (-2365.473) (-2353.041) (-2355.980) -- 0:03:38 31500 -- [-2351.225] (-2352.317) (-2363.534) (-2350.886) * (-2354.755) [-2356.925] (-2355.289) (-2357.933) -- 0:03:35 32000 -- (-2355.007) (-2348.960) (-2359.590) [-2354.216] * [-2349.860] (-2352.595) (-2352.808) (-2353.449) -- 0:03:31 32500 -- [-2349.789] (-2356.006) (-2355.717) (-2358.208) * (-2354.577) [-2355.461] (-2356.465) (-2356.503) -- 0:03:28 33000 -- (-2350.627) (-2354.950) [-2352.190] (-2360.033) * (-2353.653) [-2359.903] (-2353.725) (-2353.513) -- 0:03:25 33500 -- [-2348.093] (-2356.541) (-2356.903) (-2354.007) * (-2360.408) (-2358.684) [-2346.427] (-2350.553) -- 0:03:50 34000 -- [-2353.555] (-2356.011) (-2352.853) (-2358.681) * (-2365.113) (-2349.522) (-2357.926) [-2355.424] -- 0:03:47 34500 -- (-2348.602) (-2352.811) [-2361.893] (-2356.251) * (-2356.705) (-2353.456) [-2346.075] (-2352.880) -- 0:03:43 35000 -- (-2355.868) (-2354.993) [-2351.522] (-2362.659) * (-2359.708) (-2358.876) (-2349.661) [-2349.861] -- 0:03:40 Average standard deviation of split frequencies: 0.042557 35500 -- [-2355.793] (-2358.290) (-2352.658) (-2350.144) * (-2353.279) [-2358.996] (-2352.381) (-2349.476) -- 0:03:37 36000 -- [-2349.960] (-2354.716) (-2351.444) (-2351.043) * (-2361.335) [-2355.751] (-2349.135) (-2362.741) -- 0:03:34 36500 -- (-2359.150) (-2349.635) (-2352.900) [-2352.653] * (-2358.285) (-2363.636) (-2353.877) [-2354.818] -- 0:03:31 37000 -- (-2353.830) (-2355.211) (-2358.056) [-2348.498] * (-2355.877) (-2361.695) [-2351.106] (-2349.698) -- 0:03:28 37500 -- (-2350.671) (-2357.933) (-2355.953) [-2353.666] * (-2359.990) (-2358.868) (-2346.003) [-2357.383] -- 0:03:25 38000 -- (-2353.061) [-2356.113] (-2356.116) (-2350.432) * (-2358.522) (-2357.694) [-2354.703] (-2349.967) -- 0:03:47 38500 -- (-2353.715) (-2359.075) (-2358.817) [-2355.339] * (-2362.502) (-2360.422) [-2357.248] (-2352.994) -- 0:03:44 39000 -- (-2353.158) (-2360.480) (-2353.286) [-2350.160] * (-2356.043) (-2360.409) (-2360.695) [-2349.977] -- 0:03:41 39500 -- [-2348.578] (-2354.073) (-2355.439) (-2356.412) * (-2352.535) [-2357.250] (-2363.889) (-2353.587) -- 0:03:38 40000 -- [-2354.781] (-2363.297) (-2352.728) (-2355.637) * (-2348.166) [-2354.768] (-2354.246) (-2359.011) -- 0:03:36 Average standard deviation of split frequencies: 0.049266 40500 -- [-2351.562] (-2354.474) (-2348.979) (-2351.261) * (-2353.958) (-2356.851) [-2360.379] (-2357.322) -- 0:03:33 41000 -- [-2348.574] (-2360.405) (-2357.140) (-2350.189) * (-2351.241) (-2364.093) (-2357.819) [-2360.594] -- 0:03:30 41500 -- (-2352.824) (-2361.994) (-2356.024) [-2355.627] * (-2357.307) (-2354.710) [-2356.693] (-2352.741) -- 0:03:27 42000 -- (-2352.198) [-2353.620] (-2356.429) (-2355.606) * (-2354.825) (-2353.873) (-2355.058) [-2357.347] -- 0:03:25 42500 -- (-2357.730) (-2354.448) [-2351.553] (-2355.667) * (-2366.750) (-2358.044) (-2353.322) [-2350.087] -- 0:03:45 43000 -- (-2356.011) (-2354.353) [-2353.188] (-2358.704) * (-2347.889) (-2356.941) (-2354.239) [-2353.326] -- 0:03:42 43500 -- (-2353.356) [-2349.726] (-2357.553) (-2353.928) * [-2346.759] (-2358.954) (-2354.800) (-2354.567) -- 0:03:39 44000 -- [-2350.769] (-2352.056) (-2354.558) (-2352.394) * (-2350.410) (-2359.431) (-2352.409) [-2350.757] -- 0:03:37 44500 -- (-2357.934) [-2350.608] (-2351.550) (-2354.946) * (-2356.327) (-2364.724) [-2347.617] (-2352.621) -- 0:03:34 45000 -- (-2357.119) (-2353.367) (-2346.115) [-2355.443] * (-2350.471) (-2357.725) [-2349.646] (-2354.427) -- 0:03:32 Average standard deviation of split frequencies: 0.030744 45500 -- (-2344.223) (-2358.265) (-2348.295) [-2357.239] * (-2359.216) (-2358.280) [-2351.628] (-2351.057) -- 0:03:29 46000 -- [-2354.855] (-2355.403) (-2358.905) (-2357.608) * (-2357.096) [-2356.657] (-2356.298) (-2353.150) -- 0:03:27 46500 -- (-2358.140) [-2360.659] (-2350.402) (-2358.865) * (-2352.007) (-2360.466) [-2352.007] (-2362.723) -- 0:03:25 47000 -- (-2358.266) (-2356.221) (-2351.551) [-2358.832] * (-2352.678) (-2352.031) [-2349.632] (-2357.518) -- 0:03:43 47500 -- [-2357.313] (-2360.700) (-2355.059) (-2357.092) * [-2352.650] (-2352.469) (-2348.131) (-2351.401) -- 0:03:40 48000 -- (-2361.505) (-2354.635) [-2352.568] (-2351.902) * (-2355.046) (-2356.189) [-2348.953] (-2354.379) -- 0:03:38 48500 -- (-2360.078) (-2364.040) (-2352.927) [-2350.516] * (-2355.308) (-2357.365) [-2352.337] (-2354.855) -- 0:03:35 49000 -- [-2356.002] (-2358.108) (-2349.796) (-2351.819) * (-2353.083) [-2358.790] (-2356.490) (-2347.670) -- 0:03:33 49500 -- (-2353.459) [-2357.703] (-2348.732) (-2354.059) * (-2352.327) [-2354.832] (-2352.997) (-2356.990) -- 0:03:31 50000 -- (-2351.155) [-2359.418] (-2354.995) (-2352.482) * (-2358.580) [-2347.346] (-2350.585) (-2359.139) -- 0:03:29 Average standard deviation of split frequencies: 0.020934 50500 -- (-2351.938) (-2358.379) (-2357.472) [-2351.473] * [-2359.883] (-2349.572) (-2350.396) (-2360.927) -- 0:03:26 51000 -- [-2351.587] (-2344.919) (-2350.158) (-2353.547) * (-2359.798) (-2349.597) [-2351.561] (-2358.186) -- 0:03:24 51500 -- (-2351.800) (-2353.462) [-2355.398] (-2354.583) * (-2354.464) [-2350.178] (-2348.201) (-2351.899) -- 0:03:41 52000 -- (-2350.217) (-2350.265) [-2348.662] (-2359.176) * (-2359.619) (-2353.765) (-2355.265) [-2351.633] -- 0:03:38 52500 -- [-2351.251] (-2350.744) (-2351.491) (-2352.472) * (-2359.502) (-2353.066) [-2353.268] (-2355.733) -- 0:03:36 53000 -- (-2350.377) (-2354.469) [-2362.931] (-2355.523) * (-2354.525) [-2354.556] (-2347.382) (-2349.873) -- 0:03:34 53500 -- [-2346.153] (-2363.632) (-2364.595) (-2350.208) * [-2352.315] (-2354.002) (-2351.554) (-2347.738) -- 0:03:32 54000 -- (-2351.766) [-2361.169] (-2351.395) (-2355.380) * [-2349.830] (-2357.154) (-2348.836) (-2354.967) -- 0:03:30 54500 -- (-2350.369) (-2353.285) (-2360.675) [-2350.498] * (-2368.030) (-2356.342) (-2359.490) [-2348.084] -- 0:03:28 55000 -- [-2348.939] (-2364.888) (-2359.098) (-2351.294) * (-2352.955) (-2352.645) (-2355.032) [-2351.941] -- 0:03:26 Average standard deviation of split frequencies: 0.033672 55500 -- [-2347.283] (-2357.152) (-2360.812) (-2356.795) * [-2350.674] (-2353.771) (-2352.753) (-2357.360) -- 0:03:24 56000 -- (-2354.401) [-2354.954] (-2356.457) (-2354.878) * (-2349.537) (-2356.392) [-2361.911] (-2360.945) -- 0:03:39 56500 -- (-2359.387) (-2351.291) (-2355.293) [-2353.910] * (-2355.107) [-2351.853] (-2353.136) (-2354.536) -- 0:03:37 57000 -- (-2358.801) [-2351.269] (-2352.557) (-2352.520) * (-2351.807) (-2354.639) [-2352.326] (-2353.760) -- 0:03:35 57500 -- (-2352.988) (-2353.804) [-2350.560] (-2354.479) * (-2352.318) (-2350.559) [-2346.916] (-2352.400) -- 0:03:33 58000 -- [-2351.270] (-2351.397) (-2354.462) (-2352.100) * (-2353.134) (-2349.029) [-2344.414] (-2355.757) -- 0:03:31 58500 -- (-2356.172) [-2356.639] (-2355.623) (-2349.971) * [-2356.284] (-2351.543) (-2351.396) (-2354.256) -- 0:03:29 59000 -- (-2350.095) (-2351.553) (-2358.728) [-2350.207] * [-2351.191] (-2352.992) (-2351.325) (-2347.172) -- 0:03:27 59500 -- [-2351.536] (-2353.324) (-2358.665) (-2358.173) * (-2350.669) (-2355.555) [-2353.013] (-2356.382) -- 0:03:25 60000 -- [-2358.792] (-2358.543) (-2352.517) (-2353.937) * (-2353.483) (-2355.362) [-2350.298] (-2349.120) -- 0:03:23 Average standard deviation of split frequencies: 0.044680 60500 -- [-2356.045] (-2355.229) (-2348.151) (-2351.302) * (-2352.952) [-2349.719] (-2355.272) (-2347.256) -- 0:03:37 61000 -- (-2361.009) (-2362.660) [-2347.178] (-2354.146) * [-2351.617] (-2354.088) (-2360.520) (-2353.007) -- 0:03:35 61500 -- [-2351.763] (-2354.567) (-2354.925) (-2349.780) * [-2360.432] (-2357.572) (-2358.591) (-2351.561) -- 0:03:33 62000 -- (-2350.283) (-2358.019) (-2353.741) [-2356.362] * (-2353.686) (-2357.442) [-2356.810] (-2348.841) -- 0:03:31 62500 -- (-2349.594) (-2360.499) (-2352.977) [-2350.408] * [-2351.915] (-2350.842) (-2354.837) (-2351.821) -- 0:03:30 63000 -- (-2351.982) (-2357.778) (-2349.992) [-2349.591] * [-2353.967] (-2351.655) (-2350.929) (-2357.236) -- 0:03:28 63500 -- (-2356.735) (-2359.616) (-2346.874) [-2351.472] * [-2355.138] (-2348.690) (-2354.923) (-2358.923) -- 0:03:26 64000 -- (-2356.341) [-2354.917] (-2349.036) (-2362.487) * (-2351.257) (-2352.082) (-2354.047) [-2350.228] -- 0:03:24 64500 -- (-2356.290) [-2351.143] (-2352.811) (-2357.674) * (-2362.101) (-2357.208) [-2351.058] (-2352.643) -- 0:03:23 65000 -- [-2352.596] (-2355.974) (-2355.099) (-2360.398) * (-2358.198) (-2353.751) (-2357.613) [-2348.439] -- 0:03:35 Average standard deviation of split frequencies: 0.047140 65500 -- (-2353.275) (-2358.790) [-2346.987] (-2365.197) * (-2354.385) (-2353.461) [-2356.577] (-2351.804) -- 0:03:34 66000 -- (-2359.011) (-2361.762) [-2354.835] (-2356.672) * (-2352.550) (-2352.012) [-2351.985] (-2354.716) -- 0:03:32 66500 -- (-2364.927) (-2362.180) [-2350.280] (-2356.352) * (-2348.852) (-2354.448) [-2353.702] (-2360.200) -- 0:03:30 67000 -- (-2353.758) (-2354.110) [-2353.226] (-2351.446) * (-2352.231) (-2353.817) [-2352.126] (-2355.605) -- 0:03:28 67500 -- (-2359.004) (-2356.545) [-2346.443] (-2356.060) * (-2355.000) (-2363.927) (-2352.830) [-2349.151] -- 0:03:27 68000 -- (-2355.751) (-2347.458) (-2356.285) [-2350.700] * (-2357.391) (-2356.793) [-2355.926] (-2352.091) -- 0:03:25 68500 -- (-2355.145) (-2355.192) (-2352.952) [-2357.254] * (-2362.310) (-2354.555) [-2351.617] (-2357.074) -- 0:03:23 69000 -- (-2355.425) (-2358.610) [-2353.717] (-2353.986) * (-2357.084) (-2352.609) (-2350.429) [-2357.049] -- 0:03:22 69500 -- (-2363.294) (-2348.097) (-2350.223) [-2350.796] * (-2354.601) (-2350.355) (-2351.534) [-2354.224] -- 0:03:34 70000 -- (-2365.913) (-2351.842) [-2350.878] (-2354.225) * (-2365.436) (-2350.331) [-2354.909] (-2360.860) -- 0:03:32 Average standard deviation of split frequencies: 0.054701 70500 -- (-2352.943) [-2348.639] (-2356.595) (-2358.431) * (-2355.065) (-2357.886) [-2358.101] (-2357.873) -- 0:03:30 71000 -- (-2356.991) [-2350.151] (-2351.379) (-2352.116) * (-2354.988) [-2353.307] (-2350.794) (-2355.503) -- 0:03:29 71500 -- [-2357.162] (-2362.323) (-2351.100) (-2365.130) * (-2360.517) [-2358.098] (-2352.717) (-2355.533) -- 0:03:27 72000 -- (-2359.508) [-2356.436] (-2357.041) (-2353.939) * [-2351.755] (-2351.165) (-2354.622) (-2353.340) -- 0:03:26 72500 -- (-2349.963) (-2354.075) (-2350.114) [-2355.269] * (-2349.259) (-2362.117) [-2351.189] (-2356.392) -- 0:03:24 73000 -- (-2361.529) (-2349.351) [-2349.626] (-2355.765) * [-2352.396] (-2356.652) (-2357.784) (-2353.586) -- 0:03:23 73500 -- [-2355.361] (-2356.187) (-2356.195) (-2357.057) * (-2351.671) [-2360.769] (-2355.961) (-2357.247) -- 0:03:21 74000 -- (-2356.445) [-2353.684] (-2357.281) (-2360.367) * (-2352.343) [-2350.632] (-2357.679) (-2355.960) -- 0:03:32 74500 -- (-2358.134) [-2362.828] (-2359.006) (-2362.344) * [-2352.254] (-2352.287) (-2350.663) (-2358.040) -- 0:03:31 75000 -- [-2352.615] (-2357.512) (-2357.563) (-2353.697) * (-2349.473) (-2348.935) (-2349.774) [-2355.602] -- 0:03:29 Average standard deviation of split frequencies: 0.040317 75500 -- [-2357.276] (-2352.196) (-2360.935) (-2351.269) * (-2351.152) (-2350.760) (-2358.438) [-2358.281] -- 0:03:28 76000 -- [-2353.214] (-2359.946) (-2350.795) (-2357.708) * [-2348.402] (-2352.066) (-2352.136) (-2352.931) -- 0:03:26 76500 -- (-2350.885) [-2350.339] (-2356.890) (-2352.266) * [-2351.959] (-2351.930) (-2360.918) (-2352.500) -- 0:03:25 77000 -- [-2350.988] (-2359.825) (-2352.409) (-2358.123) * [-2354.375] (-2352.731) (-2351.830) (-2353.464) -- 0:03:23 77500 -- (-2350.246) (-2354.387) (-2347.312) [-2345.623] * (-2351.566) (-2354.373) [-2352.441] (-2363.454) -- 0:03:22 78000 -- (-2347.377) [-2354.248] (-2354.252) (-2350.434) * (-2358.894) [-2350.982] (-2346.375) (-2352.250) -- 0:03:20 78500 -- (-2354.851) (-2348.048) (-2352.556) [-2351.403] * [-2351.986] (-2351.043) (-2360.892) (-2360.747) -- 0:03:19 79000 -- (-2353.085) (-2353.560) [-2358.515] (-2354.144) * [-2352.605] (-2351.946) (-2356.778) (-2355.773) -- 0:03:29 79500 -- (-2362.769) (-2361.534) (-2351.512) [-2352.491] * (-2353.173) [-2354.257] (-2352.089) (-2353.200) -- 0:03:28 80000 -- [-2356.002] (-2351.622) (-2355.322) (-2348.949) * (-2355.685) (-2350.731) (-2348.354) [-2353.131] -- 0:03:27 Average standard deviation of split frequencies: 0.046751 80500 -- [-2355.150] (-2353.567) (-2352.582) (-2355.569) * (-2352.571) (-2353.992) [-2352.873] (-2353.355) -- 0:03:25 81000 -- (-2360.831) [-2352.980] (-2355.012) (-2350.703) * (-2354.804) (-2361.381) [-2356.506] (-2352.983) -- 0:03:24 81500 -- (-2351.988) (-2358.291) [-2355.180] (-2354.581) * (-2353.048) (-2359.691) (-2362.461) [-2357.026] -- 0:03:22 82000 -- [-2354.367] (-2364.685) (-2351.191) (-2352.221) * (-2367.813) [-2354.336] (-2360.943) (-2351.787) -- 0:03:21 82500 -- [-2350.624] (-2349.114) (-2357.276) (-2361.258) * (-2364.246) (-2348.588) [-2352.892] (-2363.998) -- 0:03:20 83000 -- (-2354.083) (-2348.639) [-2352.816] (-2354.965) * [-2357.599] (-2354.086) (-2353.420) (-2354.594) -- 0:03:29 83500 -- [-2354.307] (-2354.984) (-2353.737) (-2352.242) * [-2351.782] (-2354.673) (-2352.120) (-2356.302) -- 0:03:28 84000 -- (-2356.541) (-2356.104) (-2356.558) [-2352.967] * (-2351.550) [-2353.917] (-2353.388) (-2356.527) -- 0:03:27 84500 -- [-2354.599] (-2352.754) (-2360.795) (-2351.412) * (-2356.190) (-2361.505) (-2356.943) [-2360.503] -- 0:03:25 85000 -- (-2354.189) (-2358.832) (-2357.669) [-2356.566] * (-2358.566) [-2351.444] (-2357.321) (-2351.699) -- 0:03:24 Average standard deviation of split frequencies: 0.042481 85500 -- [-2349.128] (-2356.305) (-2353.565) (-2355.869) * [-2354.786] (-2361.276) (-2352.784) (-2352.087) -- 0:03:23 86000 -- [-2352.406] (-2352.330) (-2355.193) (-2349.142) * (-2350.014) (-2364.569) [-2351.242] (-2356.309) -- 0:03:21 86500 -- (-2355.953) [-2351.765] (-2349.968) (-2358.060) * [-2354.944] (-2359.618) (-2352.041) (-2355.827) -- 0:03:20 87000 -- (-2355.458) [-2349.561] (-2366.005) (-2352.831) * [-2354.372] (-2362.006) (-2352.561) (-2354.985) -- 0:03:19 87500 -- (-2361.759) (-2350.649) [-2359.288] (-2358.140) * (-2357.141) (-2361.635) (-2355.955) [-2356.146] -- 0:03:18 88000 -- [-2356.523] (-2360.904) (-2352.621) (-2350.581) * (-2350.863) (-2360.978) (-2359.983) [-2354.095] -- 0:03:27 88500 -- (-2350.761) (-2356.017) [-2356.894] (-2355.469) * (-2351.259) (-2360.642) (-2357.042) [-2349.531] -- 0:03:25 89000 -- (-2359.787) (-2356.844) (-2364.625) [-2355.734] * [-2361.411] (-2359.420) (-2356.033) (-2352.374) -- 0:03:24 89500 -- [-2354.615] (-2355.981) (-2356.108) (-2352.633) * [-2354.647] (-2355.516) (-2363.099) (-2353.285) -- 0:03:23 90000 -- (-2355.752) [-2351.155] (-2359.108) (-2352.968) * [-2350.359] (-2364.390) (-2358.783) (-2356.657) -- 0:03:22 Average standard deviation of split frequencies: 0.037695 90500 -- (-2354.965) (-2350.270) [-2351.643] (-2352.749) * (-2353.347) [-2351.867] (-2360.736) (-2356.647) -- 0:03:20 91000 -- (-2360.387) (-2350.622) [-2355.783] (-2354.441) * (-2351.941) (-2369.372) [-2355.459] (-2355.860) -- 0:03:19 91500 -- (-2359.082) (-2355.439) (-2357.962) [-2352.369] * [-2354.014] (-2355.059) (-2361.912) (-2356.298) -- 0:03:18 92000 -- (-2352.322) (-2358.774) [-2353.291] (-2357.064) * (-2355.217) (-2354.141) [-2356.655] (-2353.530) -- 0:03:17 92500 -- (-2361.179) [-2354.973] (-2364.483) (-2359.218) * [-2349.716] (-2349.147) (-2353.592) (-2360.112) -- 0:03:26 93000 -- (-2355.654) [-2351.509] (-2351.758) (-2349.412) * (-2356.381) [-2355.129] (-2357.871) (-2357.922) -- 0:03:24 93500 -- (-2361.561) [-2355.495] (-2359.496) (-2355.668) * [-2355.447] (-2351.838) (-2358.145) (-2355.015) -- 0:03:23 94000 -- (-2358.170) (-2353.399) [-2353.240] (-2353.632) * (-2363.359) (-2355.051) [-2350.849] (-2359.280) -- 0:03:22 94500 -- (-2350.489) (-2352.104) (-2358.167) [-2356.066] * [-2360.354] (-2355.247) (-2353.751) (-2352.042) -- 0:03:21 95000 -- (-2358.300) (-2361.757) (-2364.708) [-2359.254] * (-2360.998) [-2349.779] (-2353.216) (-2353.865) -- 0:03:20 Average standard deviation of split frequencies: 0.028235 95500 -- [-2353.149] (-2357.299) (-2359.856) (-2353.452) * (-2354.330) [-2349.314] (-2359.472) (-2353.362) -- 0:03:18 96000 -- (-2352.434) [-2352.491] (-2353.986) (-2348.001) * (-2353.962) (-2348.938) [-2354.198] (-2349.626) -- 0:03:17 96500 -- (-2348.944) (-2354.931) [-2359.193] (-2359.904) * (-2359.191) [-2348.540] (-2350.665) (-2354.762) -- 0:03:16 97000 -- [-2351.200] (-2357.509) (-2354.182) (-2353.497) * (-2350.808) (-2356.826) (-2361.470) [-2358.677] -- 0:03:24 97500 -- (-2358.465) (-2356.021) (-2356.867) [-2349.676] * (-2357.493) (-2352.947) (-2354.910) [-2354.738] -- 0:03:23 98000 -- (-2358.085) (-2354.208) (-2351.512) [-2351.228] * (-2356.256) (-2354.044) [-2356.599] (-2354.346) -- 0:03:22 98500 -- (-2350.672) (-2358.390) (-2349.539) [-2352.817] * (-2355.763) (-2349.382) (-2352.290) [-2350.000] -- 0:03:21 99000 -- (-2357.540) (-2352.883) (-2355.908) [-2352.864] * (-2354.625) (-2348.724) [-2351.256] (-2356.412) -- 0:03:20 99500 -- [-2350.520] (-2352.213) (-2356.327) (-2357.728) * (-2361.067) (-2354.135) (-2353.489) [-2347.856] -- 0:03:19 100000 -- [-2357.007] (-2353.682) (-2347.162) (-2351.703) * [-2358.496] (-2354.224) (-2352.018) (-2350.817) -- 0:03:18 Average standard deviation of split frequencies: 0.026926 100500 -- (-2363.063) [-2357.377] (-2353.937) (-2357.202) * (-2360.150) [-2355.313] (-2359.564) (-2358.412) -- 0:03:16 101000 -- [-2350.976] (-2358.603) (-2358.947) (-2358.692) * (-2353.336) (-2356.620) (-2355.317) [-2348.909] -- 0:03:15 101500 -- (-2353.405) [-2347.616] (-2348.833) (-2351.198) * (-2351.772) (-2353.777) (-2348.020) [-2349.994] -- 0:03:23 102000 -- (-2349.860) [-2347.918] (-2354.799) (-2350.424) * (-2350.334) (-2354.208) (-2351.455) [-2356.063] -- 0:03:22 102500 -- [-2355.959] (-2350.225) (-2355.147) (-2353.091) * (-2351.605) (-2354.978) (-2355.352) [-2355.248] -- 0:03:21 103000 -- (-2355.500) (-2356.920) [-2350.299] (-2360.755) * (-2350.820) (-2354.869) (-2349.042) [-2356.140] -- 0:03:20 103500 -- [-2358.995] (-2353.468) (-2359.757) (-2356.326) * (-2353.753) (-2352.915) (-2354.551) [-2349.100] -- 0:03:19 104000 -- (-2350.269) (-2367.679) (-2356.981) [-2354.967] * [-2349.973] (-2357.153) (-2349.981) (-2349.828) -- 0:03:18 104500 -- (-2354.802) (-2352.913) [-2351.536] (-2352.966) * [-2355.786] (-2359.707) (-2350.586) (-2355.276) -- 0:03:17 105000 -- [-2349.636] (-2353.135) (-2355.139) (-2355.781) * (-2353.470) [-2356.355] (-2354.646) (-2352.754) -- 0:03:16 Average standard deviation of split frequencies: 0.028907 105500 -- (-2359.171) [-2348.084] (-2360.294) (-2352.637) * (-2358.631) (-2356.685) [-2351.365] (-2348.893) -- 0:03:15 106000 -- (-2350.501) (-2352.040) (-2348.994) [-2351.221] * (-2348.716) (-2359.249) (-2351.265) [-2349.131] -- 0:03:22 106500 -- [-2355.279] (-2356.701) (-2355.662) (-2355.940) * (-2354.148) (-2357.654) [-2354.481] (-2358.456) -- 0:03:21 107000 -- [-2353.824] (-2347.019) (-2366.614) (-2359.640) * (-2352.287) (-2357.334) [-2355.939] (-2355.266) -- 0:03:20 107500 -- (-2349.137) (-2351.803) [-2349.283] (-2351.407) * [-2347.886] (-2349.420) (-2358.515) (-2354.236) -- 0:03:19 108000 -- (-2351.219) [-2350.399] (-2350.722) (-2358.972) * [-2351.702] (-2347.913) (-2355.945) (-2350.565) -- 0:03:18 108500 -- (-2356.294) (-2351.223) (-2351.699) [-2354.864] * (-2352.657) (-2360.740) [-2350.622] (-2358.166) -- 0:03:17 109000 -- [-2350.884] (-2354.764) (-2355.983) (-2348.854) * (-2353.632) (-2353.070) [-2355.329] (-2354.130) -- 0:03:16 109500 -- [-2352.910] (-2352.474) (-2365.263) (-2350.092) * (-2349.719) [-2350.223] (-2348.925) (-2354.760) -- 0:03:15 110000 -- (-2354.220) (-2352.258) [-2361.819] (-2358.632) * (-2354.856) (-2352.823) (-2355.003) [-2349.514] -- 0:03:14 Average standard deviation of split frequencies: 0.029818 110500 -- (-2357.910) (-2351.518) (-2359.050) [-2352.545] * (-2353.120) (-2357.272) (-2358.709) [-2355.006] -- 0:03:21 111000 -- (-2350.913) (-2355.720) (-2359.287) [-2353.018] * [-2356.874] (-2355.678) (-2355.855) (-2353.373) -- 0:03:20 111500 -- (-2353.174) (-2352.274) (-2359.104) [-2357.474] * [-2355.556] (-2361.038) (-2353.192) (-2352.661) -- 0:03:19 112000 -- (-2358.019) [-2353.382] (-2350.696) (-2354.108) * (-2351.743) (-2352.503) (-2353.769) [-2355.636] -- 0:03:18 112500 -- [-2352.689] (-2365.598) (-2360.198) (-2351.339) * [-2350.838] (-2353.224) (-2351.176) (-2358.562) -- 0:03:17 113000 -- (-2354.938) (-2353.791) (-2357.680) [-2351.096] * [-2357.695] (-2354.552) (-2355.867) (-2362.280) -- 0:03:16 113500 -- (-2349.454) (-2358.553) [-2352.339] (-2351.778) * (-2356.315) (-2361.667) [-2347.116] (-2357.738) -- 0:03:15 114000 -- (-2349.486) (-2357.064) [-2352.319] (-2352.625) * (-2355.744) (-2347.849) [-2355.286] (-2353.373) -- 0:03:14 114500 -- (-2351.603) (-2353.296) (-2355.597) [-2348.808] * (-2355.927) (-2364.555) (-2350.590) [-2352.338] -- 0:03:13 115000 -- [-2351.806] (-2359.003) (-2354.144) (-2352.743) * (-2355.769) (-2358.176) [-2350.586] (-2356.137) -- 0:03:20 Average standard deviation of split frequencies: 0.024383 115500 -- (-2354.014) [-2353.539] (-2359.138) (-2353.736) * (-2366.247) (-2352.445) [-2364.333] (-2355.037) -- 0:03:19 116000 -- (-2362.278) [-2353.276] (-2356.579) (-2354.898) * (-2360.455) (-2351.044) [-2354.325] (-2352.477) -- 0:03:18 116500 -- [-2353.289] (-2355.654) (-2353.670) (-2364.536) * (-2355.175) (-2363.502) [-2356.176] (-2349.904) -- 0:03:17 117000 -- (-2358.623) [-2351.881] (-2352.048) (-2352.728) * (-2361.479) (-2356.102) [-2352.454] (-2356.194) -- 0:03:16 117500 -- (-2355.547) [-2349.440] (-2353.897) (-2351.323) * (-2356.577) (-2354.506) (-2347.165) [-2347.036] -- 0:03:15 118000 -- (-2355.589) [-2347.306] (-2351.905) (-2351.593) * (-2352.913) (-2355.500) [-2350.669] (-2355.854) -- 0:03:14 118500 -- (-2365.135) (-2347.262) (-2351.736) [-2351.108] * (-2354.393) (-2352.939) (-2354.543) [-2349.209] -- 0:03:13 119000 -- (-2357.696) [-2353.868] (-2356.339) (-2362.019) * [-2351.715] (-2360.458) (-2355.268) (-2352.219) -- 0:03:12 119500 -- (-2358.606) (-2358.825) (-2351.999) [-2353.493] * (-2352.243) (-2364.281) [-2357.462] (-2350.764) -- 0:03:18 120000 -- (-2352.707) [-2353.352] (-2355.414) (-2350.920) * (-2353.371) (-2357.518) (-2358.981) [-2351.852] -- 0:03:18 Average standard deviation of split frequencies: 0.022463 120500 -- (-2351.060) (-2354.402) [-2356.010] (-2358.115) * (-2351.561) [-2352.196] (-2351.952) (-2356.706) -- 0:03:17 121000 -- (-2355.530) (-2349.170) (-2356.692) [-2348.731] * (-2356.452) (-2349.818) (-2353.606) [-2354.686] -- 0:03:16 121500 -- (-2351.621) (-2354.379) (-2357.812) [-2354.244] * [-2352.202] (-2353.580) (-2353.615) (-2357.562) -- 0:03:15 122000 -- [-2351.183] (-2355.141) (-2352.972) (-2355.522) * (-2359.441) [-2346.718] (-2353.618) (-2357.263) -- 0:03:14 122500 -- (-2351.378) (-2361.028) (-2360.799) [-2353.256] * (-2355.486) (-2356.849) [-2349.073] (-2371.582) -- 0:03:13 123000 -- [-2355.076] (-2352.622) (-2355.761) (-2357.152) * (-2355.852) (-2352.539) (-2350.324) [-2355.241] -- 0:03:12 123500 -- (-2354.913) [-2350.776] (-2357.527) (-2355.643) * (-2356.194) (-2358.512) (-2351.371) [-2352.537] -- 0:03:11 124000 -- [-2352.057] (-2350.316) (-2355.154) (-2355.153) * (-2365.763) (-2353.504) (-2349.400) [-2356.668] -- 0:03:17 124500 -- (-2374.763) [-2349.869] (-2353.648) (-2353.904) * (-2355.038) [-2349.467] (-2350.626) (-2359.148) -- 0:03:16 125000 -- [-2359.139] (-2361.747) (-2355.436) (-2359.260) * [-2357.215] (-2354.966) (-2349.280) (-2353.958) -- 0:03:16 Average standard deviation of split frequencies: 0.023383 125500 -- [-2354.969] (-2358.833) (-2351.785) (-2355.477) * (-2359.895) (-2355.051) [-2348.769] (-2352.083) -- 0:03:15 126000 -- (-2358.607) [-2351.344] (-2358.872) (-2353.821) * (-2352.854) [-2358.248] (-2351.368) (-2351.562) -- 0:03:14 126500 -- [-2350.614] (-2351.444) (-2356.315) (-2361.305) * (-2356.450) (-2353.857) (-2351.922) [-2352.765] -- 0:03:13 127000 -- (-2358.048) (-2352.456) (-2347.143) [-2352.583] * [-2354.359] (-2349.173) (-2353.959) (-2354.039) -- 0:03:12 127500 -- (-2358.397) (-2357.484) [-2349.216] (-2349.422) * (-2354.515) (-2353.622) (-2351.579) [-2359.985] -- 0:03:11 128000 -- (-2351.512) (-2354.850) [-2358.004] (-2349.366) * (-2355.592) [-2349.808] (-2354.161) (-2356.506) -- 0:03:10 128500 -- (-2350.768) (-2353.240) [-2349.403] (-2356.942) * (-2352.275) (-2353.239) [-2351.276] (-2357.102) -- 0:03:16 129000 -- (-2354.952) (-2355.234) (-2351.743) [-2349.879] * (-2347.891) [-2358.352] (-2353.583) (-2351.492) -- 0:03:15 129500 -- [-2352.510] (-2352.010) (-2350.766) (-2354.610) * [-2352.782] (-2360.711) (-2359.482) (-2358.900) -- 0:03:14 130000 -- [-2348.301] (-2363.509) (-2355.652) (-2348.547) * (-2352.075) [-2350.659] (-2358.818) (-2350.537) -- 0:03:14 Average standard deviation of split frequencies: 0.017137 130500 -- (-2355.420) (-2368.102) [-2350.708] (-2351.941) * (-2350.581) (-2353.086) (-2355.335) [-2354.371] -- 0:03:13 131000 -- (-2367.527) (-2364.255) [-2347.396] (-2358.562) * (-2357.255) (-2351.202) [-2350.802] (-2359.586) -- 0:03:12 131500 -- (-2357.798) (-2353.695) (-2353.398) [-2350.628] * [-2350.331] (-2355.674) (-2351.580) (-2351.683) -- 0:03:11 132000 -- (-2360.683) [-2352.053] (-2350.626) (-2354.341) * (-2351.568) [-2355.496] (-2358.481) (-2358.590) -- 0:03:10 132500 -- [-2356.547] (-2358.149) (-2359.647) (-2364.454) * [-2352.337] (-2365.338) (-2353.293) (-2353.769) -- 0:03:09 133000 -- (-2355.053) (-2353.107) [-2353.128] (-2350.971) * (-2360.226) (-2354.859) [-2357.114] (-2355.361) -- 0:03:09 133500 -- (-2361.242) (-2355.436) [-2363.235] (-2351.123) * (-2360.288) (-2357.225) (-2363.392) [-2355.657] -- 0:03:14 134000 -- [-2353.042] (-2354.540) (-2354.276) (-2351.622) * (-2356.170) (-2351.554) (-2353.530) [-2351.493] -- 0:03:13 134500 -- [-2352.577] (-2351.993) (-2356.798) (-2351.972) * (-2352.960) (-2354.600) [-2363.187] (-2352.643) -- 0:03:13 135000 -- (-2350.745) (-2359.847) (-2356.375) [-2351.838] * (-2354.139) (-2354.834) (-2354.833) [-2352.281] -- 0:03:12 Average standard deviation of split frequencies: 0.021664 135500 -- [-2354.800] (-2350.389) (-2352.950) (-2354.490) * (-2356.251) (-2355.072) (-2355.094) [-2352.261] -- 0:03:11 136000 -- [-2348.931] (-2348.335) (-2353.992) (-2353.028) * (-2353.745) (-2353.110) (-2357.354) [-2353.955] -- 0:03:10 136500 -- (-2352.536) (-2360.414) (-2356.644) [-2352.822] * [-2352.185] (-2359.333) (-2360.425) (-2355.419) -- 0:03:09 137000 -- (-2354.383) (-2351.871) [-2353.008] (-2360.297) * [-2353.328] (-2361.185) (-2357.101) (-2357.283) -- 0:03:08 137500 -- [-2355.625] (-2351.587) (-2351.246) (-2354.573) * (-2355.162) (-2358.345) (-2355.632) [-2353.299] -- 0:03:08 138000 -- (-2354.839) (-2353.384) (-2353.926) [-2350.206] * [-2350.214] (-2364.963) (-2356.599) (-2356.399) -- 0:03:13 138500 -- [-2354.667] (-2358.158) (-2351.453) (-2356.254) * [-2352.391] (-2360.978) (-2359.912) (-2358.431) -- 0:03:12 139000 -- (-2357.427) [-2348.150] (-2350.233) (-2354.900) * [-2351.637] (-2364.336) (-2349.149) (-2359.990) -- 0:03:12 139500 -- (-2355.366) (-2361.466) (-2356.825) [-2352.467] * [-2354.299] (-2358.650) (-2354.152) (-2354.581) -- 0:03:11 140000 -- (-2371.861) [-2358.503] (-2356.021) (-2354.149) * (-2356.732) (-2356.781) [-2348.570] (-2347.996) -- 0:03:10 Average standard deviation of split frequencies: 0.020945 140500 -- (-2360.661) [-2352.400] (-2353.525) (-2358.001) * (-2358.285) [-2347.249] (-2352.432) (-2352.612) -- 0:03:09 141000 -- (-2357.947) [-2351.774] (-2355.421) (-2356.126) * [-2349.500] (-2347.852) (-2356.280) (-2357.925) -- 0:03:08 141500 -- (-2354.670) (-2351.056) [-2352.858] (-2354.041) * (-2353.816) [-2350.072] (-2356.960) (-2356.796) -- 0:03:08 142000 -- [-2358.321] (-2360.629) (-2362.329) (-2351.648) * (-2350.178) (-2360.247) [-2352.950] (-2351.536) -- 0:03:07 142500 -- (-2360.975) (-2355.708) [-2355.369] (-2353.266) * (-2351.825) (-2359.622) [-2352.886] (-2354.312) -- 0:03:12 143000 -- [-2353.106] (-2359.741) (-2355.901) (-2345.613) * (-2353.668) (-2364.184) (-2353.861) [-2352.516] -- 0:03:11 143500 -- [-2351.464] (-2355.948) (-2356.339) (-2358.368) * (-2350.112) [-2347.660] (-2353.795) (-2359.626) -- 0:03:10 144000 -- (-2356.454) (-2364.088) (-2355.127) [-2358.478] * [-2356.886] (-2357.270) (-2354.500) (-2361.286) -- 0:03:10 144500 -- [-2354.128] (-2353.901) (-2351.897) (-2360.932) * (-2359.967) [-2355.747] (-2359.980) (-2361.997) -- 0:03:09 145000 -- (-2351.336) (-2354.998) (-2358.098) [-2356.118] * (-2352.524) [-2354.559] (-2358.830) (-2354.724) -- 0:03:08 Average standard deviation of split frequencies: 0.023409 145500 -- (-2354.616) [-2355.658] (-2361.679) (-2353.211) * [-2350.981] (-2355.549) (-2355.221) (-2368.009) -- 0:03:07 146000 -- (-2354.352) (-2354.659) (-2357.668) [-2354.849] * (-2356.682) [-2349.899] (-2355.589) (-2364.319) -- 0:03:07 146500 -- [-2347.882] (-2351.721) (-2356.491) (-2355.541) * (-2364.350) (-2350.311) [-2353.948] (-2352.720) -- 0:03:06 147000 -- (-2363.411) (-2360.871) [-2349.172] (-2356.931) * [-2349.018] (-2370.104) (-2355.254) (-2350.378) -- 0:03:11 147500 -- (-2349.379) [-2351.840] (-2353.284) (-2346.609) * (-2352.914) (-2361.589) [-2350.507] (-2352.727) -- 0:03:10 148000 -- (-2357.311) (-2358.853) (-2352.956) [-2350.591] * (-2353.472) [-2354.357] (-2350.366) (-2355.551) -- 0:03:09 148500 -- (-2354.325) (-2348.577) [-2354.244] (-2355.016) * (-2357.595) (-2358.749) [-2349.707] (-2353.328) -- 0:03:09 149000 -- (-2363.848) (-2355.078) (-2357.401) [-2351.167] * (-2355.293) (-2360.633) [-2352.848] (-2352.110) -- 0:03:08 149500 -- [-2353.100] (-2347.931) (-2354.923) (-2356.974) * [-2358.269] (-2355.464) (-2349.588) (-2354.190) -- 0:03:07 150000 -- (-2348.810) (-2352.777) (-2352.556) [-2352.362] * [-2349.749] (-2358.826) (-2361.442) (-2352.230) -- 0:03:07 Average standard deviation of split frequencies: 0.023466 150500 -- (-2354.384) (-2353.257) (-2349.137) [-2355.701] * [-2352.780] (-2358.372) (-2353.294) (-2350.642) -- 0:03:06 151000 -- (-2356.504) (-2356.017) [-2352.885] (-2355.454) * [-2349.556] (-2352.615) (-2357.296) (-2355.624) -- 0:03:05 151500 -- (-2362.152) [-2346.786] (-2349.543) (-2355.685) * (-2353.642) (-2360.050) [-2356.338] (-2352.876) -- 0:03:10 152000 -- (-2359.431) (-2355.118) [-2351.352] (-2351.279) * (-2358.543) (-2356.397) [-2348.864] (-2353.436) -- 0:03:09 152500 -- [-2357.370] (-2353.428) (-2353.666) (-2354.637) * (-2350.793) [-2352.190] (-2354.400) (-2350.620) -- 0:03:08 153000 -- [-2353.314] (-2352.507) (-2354.745) (-2350.271) * (-2357.959) [-2353.479] (-2359.903) (-2355.488) -- 0:03:08 153500 -- (-2362.965) [-2355.701] (-2358.386) (-2357.983) * [-2355.389] (-2351.248) (-2360.173) (-2352.903) -- 0:03:07 154000 -- (-2349.044) (-2353.073) (-2352.825) [-2360.344] * (-2354.861) [-2347.675] (-2355.392) (-2353.550) -- 0:03:06 154500 -- [-2360.838] (-2355.737) (-2355.327) (-2352.394) * (-2360.185) [-2349.793] (-2350.809) (-2358.040) -- 0:03:06 155000 -- [-2349.775] (-2357.356) (-2351.013) (-2355.334) * (-2352.186) [-2352.910] (-2355.418) (-2355.050) -- 0:03:05 Average standard deviation of split frequencies: 0.021153 155500 -- (-2346.998) (-2350.072) (-2349.978) [-2354.876] * (-2347.976) (-2355.316) (-2355.821) [-2351.628] -- 0:03:04 156000 -- (-2351.819) [-2356.715] (-2360.463) (-2362.896) * (-2353.665) (-2352.911) [-2348.220] (-2355.492) -- 0:03:09 156500 -- (-2361.637) (-2354.469) [-2351.526] (-2356.045) * [-2349.909] (-2350.664) (-2349.132) (-2354.825) -- 0:03:08 157000 -- (-2350.903) (-2354.036) [-2353.857] (-2358.545) * (-2361.465) (-2354.147) [-2359.210] (-2360.166) -- 0:03:07 157500 -- (-2350.359) (-2351.354) (-2359.448) [-2355.430] * (-2358.967) (-2352.603) (-2354.329) [-2347.839] -- 0:03:07 158000 -- (-2353.342) [-2352.402] (-2348.627) (-2351.965) * [-2356.624] (-2362.836) (-2352.316) (-2350.743) -- 0:03:06 158500 -- (-2354.153) (-2353.508) [-2348.901] (-2355.711) * (-2355.089) (-2360.574) (-2358.815) [-2356.568] -- 0:03:05 159000 -- (-2357.116) [-2356.825] (-2354.514) (-2351.688) * (-2361.114) [-2357.619] (-2349.948) (-2354.980) -- 0:03:05 159500 -- [-2349.234] (-2358.897) (-2357.194) (-2356.137) * [-2352.875] (-2357.281) (-2356.017) (-2350.006) -- 0:03:04 160000 -- (-2357.048) (-2363.939) [-2354.335] (-2360.407) * (-2354.592) (-2354.284) (-2353.600) [-2354.159] -- 0:03:03 Average standard deviation of split frequencies: 0.028607 160500 -- [-2352.279] (-2359.480) (-2362.258) (-2355.190) * [-2360.137] (-2351.424) (-2350.320) (-2354.031) -- 0:03:08 161000 -- (-2361.361) (-2364.686) (-2356.942) [-2350.775] * (-2352.195) (-2355.502) [-2350.741] (-2359.493) -- 0:03:07 161500 -- (-2354.468) (-2356.189) (-2357.068) [-2358.993] * (-2350.442) [-2355.526] (-2356.887) (-2349.634) -- 0:03:06 162000 -- (-2350.126) (-2351.305) (-2357.696) [-2352.292] * (-2350.142) (-2361.427) (-2352.864) [-2357.098] -- 0:03:06 162500 -- (-2356.528) [-2354.050] (-2357.009) (-2353.801) * (-2356.707) (-2352.000) [-2349.621] (-2358.374) -- 0:03:05 163000 -- (-2359.713) (-2359.635) [-2357.380] (-2357.502) * (-2357.803) (-2357.965) (-2356.655) [-2352.723] -- 0:03:04 163500 -- [-2355.797] (-2355.375) (-2358.263) (-2350.055) * (-2355.317) [-2349.944] (-2357.223) (-2353.111) -- 0:03:04 164000 -- (-2352.024) (-2353.544) (-2353.585) [-2356.176] * (-2356.723) [-2356.020] (-2354.247) (-2352.633) -- 0:03:03 164500 -- (-2358.705) (-2359.635) [-2352.473] (-2350.801) * (-2357.118) [-2357.469] (-2354.137) (-2359.521) -- 0:03:02 165000 -- (-2351.959) [-2356.075] (-2359.011) (-2356.445) * (-2353.067) (-2347.965) (-2359.921) [-2355.202] -- 0:03:02 Average standard deviation of split frequencies: 0.022008 165500 -- [-2354.877] (-2363.562) (-2357.328) (-2353.126) * (-2351.012) [-2354.386] (-2357.068) (-2351.922) -- 0:03:06 166000 -- (-2350.126) [-2360.338] (-2361.515) (-2351.370) * (-2357.256) [-2352.836] (-2358.708) (-2355.971) -- 0:03:05 166500 -- (-2356.028) (-2359.349) (-2361.977) [-2355.230] * [-2352.497] (-2352.700) (-2355.938) (-2354.360) -- 0:03:05 167000 -- (-2352.097) [-2354.349] (-2351.800) (-2355.665) * (-2351.877) (-2353.401) (-2359.960) [-2357.121] -- 0:03:04 167500 -- (-2353.145) [-2353.262] (-2354.345) (-2351.530) * (-2363.248) (-2350.700) (-2356.283) [-2349.410] -- 0:03:03 168000 -- [-2352.276] (-2349.666) (-2356.669) (-2348.746) * [-2354.783] (-2352.935) (-2350.206) (-2360.708) -- 0:03:03 168500 -- (-2355.371) (-2356.580) (-2352.784) [-2347.466] * (-2352.877) (-2358.299) (-2352.899) [-2354.241] -- 0:03:02 169000 -- (-2351.603) [-2358.324] (-2356.368) (-2352.276) * (-2348.885) (-2362.331) [-2355.066] (-2354.685) -- 0:03:01 169500 -- [-2355.994] (-2352.209) (-2353.423) (-2364.641) * [-2347.258] (-2357.789) (-2352.295) (-2354.235) -- 0:03:01 170000 -- [-2353.282] (-2354.287) (-2352.623) (-2356.568) * [-2352.040] (-2355.319) (-2354.355) (-2354.553) -- 0:03:05 Average standard deviation of split frequencies: 0.022788 170500 -- [-2355.755] (-2355.030) (-2351.002) (-2354.904) * (-2353.939) (-2351.995) [-2351.351] (-2360.021) -- 0:03:04 171000 -- (-2354.314) (-2352.295) (-2359.294) [-2358.926] * [-2349.616] (-2357.578) (-2349.310) (-2361.922) -- 0:03:04 171500 -- (-2348.440) [-2350.228] (-2351.972) (-2351.331) * (-2354.494) (-2357.921) (-2354.283) [-2350.923] -- 0:03:03 172000 -- (-2350.887) (-2350.463) (-2354.056) [-2355.343] * (-2354.145) [-2349.918] (-2355.212) (-2349.946) -- 0:03:02 172500 -- [-2354.242] (-2357.423) (-2349.003) (-2359.333) * [-2352.184] (-2357.050) (-2350.170) (-2354.161) -- 0:03:02 173000 -- (-2350.829) (-2358.535) [-2350.096] (-2352.594) * (-2360.984) (-2352.599) [-2351.770] (-2356.314) -- 0:03:01 173500 -- [-2351.852] (-2354.679) (-2358.195) (-2366.651) * (-2357.632) (-2355.455) [-2353.256] (-2358.498) -- 0:03:01 174000 -- (-2353.529) (-2356.642) [-2357.691] (-2358.726) * (-2348.679) (-2353.623) [-2356.958] (-2354.688) -- 0:03:00 174500 -- (-2353.985) (-2348.379) [-2349.310] (-2356.348) * (-2355.790) (-2349.725) (-2357.217) [-2352.215] -- 0:03:04 175000 -- (-2358.399) (-2349.297) [-2349.213] (-2360.105) * (-2354.595) [-2351.995] (-2356.550) (-2352.786) -- 0:03:03 Average standard deviation of split frequencies: 0.020758 175500 -- (-2360.137) [-2348.326] (-2354.589) (-2355.353) * (-2352.577) (-2353.073) (-2353.078) [-2352.846] -- 0:03:03 176000 -- [-2358.782] (-2360.030) (-2353.997) (-2360.205) * (-2349.077) (-2350.113) (-2354.484) [-2350.288] -- 0:03:02 176500 -- (-2360.977) (-2354.097) [-2360.748] (-2351.530) * (-2350.254) [-2347.520] (-2357.845) (-2355.084) -- 0:03:01 177000 -- (-2355.296) (-2350.123) (-2361.308) [-2352.316] * (-2353.336) (-2351.904) [-2348.241] (-2355.767) -- 0:03:01 177500 -- (-2352.140) (-2357.114) (-2350.362) [-2350.781] * (-2353.120) (-2358.262) (-2357.203) [-2346.559] -- 0:03:00 178000 -- (-2352.076) (-2353.745) (-2351.091) [-2351.810] * [-2350.153] (-2351.565) (-2351.759) (-2356.996) -- 0:03:00 178500 -- [-2354.389] (-2351.278) (-2351.341) (-2353.465) * (-2352.663) (-2358.728) [-2347.914] (-2351.082) -- 0:02:59 179000 -- (-2361.500) [-2346.207] (-2352.405) (-2350.638) * (-2350.859) [-2351.074] (-2350.690) (-2353.413) -- 0:03:03 179500 -- (-2357.879) [-2351.670] (-2354.177) (-2349.268) * (-2351.149) (-2361.262) [-2351.721] (-2355.865) -- 0:03:02 180000 -- (-2361.325) (-2351.272) (-2355.055) [-2351.801] * [-2352.358] (-2356.559) (-2349.611) (-2349.666) -- 0:03:02 Average standard deviation of split frequencies: 0.021526 180500 -- (-2361.408) (-2351.770) [-2354.862] (-2352.038) * (-2357.235) (-2359.172) [-2356.039] (-2355.641) -- 0:03:01 181000 -- [-2357.616] (-2353.805) (-2350.013) (-2352.092) * (-2350.125) (-2352.906) [-2365.329] (-2348.917) -- 0:03:00 181500 -- [-2348.387] (-2352.498) (-2352.362) (-2357.766) * (-2353.717) [-2354.386] (-2351.086) (-2354.781) -- 0:03:00 182000 -- (-2350.319) [-2353.106] (-2361.763) (-2356.836) * (-2352.184) (-2353.852) [-2354.093] (-2355.226) -- 0:02:59 182500 -- (-2350.722) (-2350.049) [-2353.721] (-2356.882) * (-2352.462) (-2349.817) [-2347.746] (-2351.623) -- 0:02:59 183000 -- (-2354.189) (-2355.153) (-2354.452) [-2353.887] * (-2353.290) (-2355.128) (-2355.055) [-2351.668] -- 0:02:58 183500 -- (-2352.691) (-2353.602) [-2347.611] (-2353.122) * [-2356.065] (-2355.729) (-2349.134) (-2357.667) -- 0:03:02 184000 -- (-2354.738) [-2352.267] (-2355.895) (-2354.101) * [-2350.101] (-2352.519) (-2350.623) (-2355.038) -- 0:03:01 184500 -- (-2350.771) (-2350.210) (-2355.377) [-2352.780] * (-2349.600) [-2353.810] (-2356.507) (-2357.524) -- 0:03:01 185000 -- (-2353.867) (-2364.909) [-2352.782] (-2357.587) * (-2353.440) (-2353.315) (-2353.881) [-2353.494] -- 0:03:00 Average standard deviation of split frequencies: 0.024077 185500 -- (-2353.973) (-2347.715) (-2351.700) [-2349.172] * [-2351.457] (-2355.073) (-2348.321) (-2351.129) -- 0:03:00 186000 -- (-2349.048) (-2352.332) [-2354.722] (-2355.948) * (-2355.879) (-2355.845) [-2351.506] (-2359.034) -- 0:02:59 186500 -- (-2351.018) [-2354.467] (-2352.726) (-2356.960) * (-2356.039) [-2352.493] (-2352.485) (-2352.152) -- 0:02:58 187000 -- (-2349.486) (-2358.915) [-2353.063] (-2346.240) * [-2349.322] (-2349.399) (-2354.146) (-2362.938) -- 0:02:58 187500 -- (-2350.565) (-2353.279) (-2355.530) [-2354.511] * (-2351.630) [-2349.027] (-2363.087) (-2364.726) -- 0:02:57 188000 -- (-2349.342) (-2349.394) (-2360.953) [-2355.172] * (-2360.950) (-2358.758) (-2361.049) [-2362.151] -- 0:03:01 188500 -- (-2351.595) [-2350.134] (-2358.554) (-2365.212) * [-2351.536] (-2349.391) (-2366.170) (-2358.167) -- 0:03:00 189000 -- (-2350.130) (-2352.649) (-2353.027) [-2356.587] * [-2352.022] (-2353.616) (-2356.268) (-2358.073) -- 0:03:00 189500 -- (-2356.813) [-2349.374] (-2359.648) (-2352.517) * (-2350.863) (-2355.625) [-2356.522] (-2360.809) -- 0:02:59 190000 -- (-2361.050) (-2354.336) (-2359.424) [-2354.887] * (-2364.430) (-2353.084) (-2356.259) [-2353.337] -- 0:02:59 Average standard deviation of split frequencies: 0.024106 190500 -- (-2353.705) (-2353.590) (-2356.168) [-2355.122] * (-2352.520) (-2355.491) [-2354.256] (-2354.080) -- 0:02:58 191000 -- [-2355.647] (-2353.111) (-2359.301) (-2358.048) * (-2349.839) [-2352.809] (-2352.261) (-2355.529) -- 0:02:57 191500 -- (-2356.446) [-2362.114] (-2353.172) (-2359.673) * (-2350.441) [-2356.948] (-2362.876) (-2357.151) -- 0:02:57 192000 -- (-2353.297) (-2362.784) [-2347.090] (-2353.858) * (-2360.475) (-2347.832) (-2351.420) [-2351.938] -- 0:02:56 192500 -- [-2350.981] (-2361.823) (-2348.862) (-2350.897) * (-2358.073) (-2352.519) (-2357.477) [-2356.097] -- 0:02:56 193000 -- [-2352.811] (-2359.080) (-2354.296) (-2349.688) * (-2354.873) (-2351.841) [-2355.971] (-2350.101) -- 0:02:59 193500 -- (-2354.458) (-2359.958) (-2355.151) [-2350.903] * [-2352.351] (-2357.084) (-2356.104) (-2354.015) -- 0:02:59 194000 -- [-2355.406] (-2355.999) (-2352.892) (-2356.592) * (-2364.149) (-2359.920) (-2367.514) [-2353.566] -- 0:02:58 194500 -- (-2357.485) (-2356.151) [-2352.842] (-2363.569) * (-2367.087) (-2356.656) [-2352.633] (-2346.862) -- 0:02:58 195000 -- (-2354.286) (-2353.714) [-2353.889] (-2354.238) * (-2354.197) (-2354.964) (-2354.148) [-2350.077] -- 0:02:57 Average standard deviation of split frequencies: 0.024051 195500 -- [-2361.099] (-2354.436) (-2348.717) (-2358.072) * (-2356.969) [-2357.507] (-2358.042) (-2351.104) -- 0:02:56 196000 -- [-2347.639] (-2350.581) (-2350.353) (-2356.179) * (-2357.563) (-2353.880) [-2350.230] (-2348.648) -- 0:02:56 196500 -- (-2354.397) (-2350.719) (-2353.358) [-2355.028] * [-2351.751] (-2350.746) (-2351.546) (-2348.627) -- 0:02:55 197000 -- [-2355.255] (-2350.632) (-2361.117) (-2359.264) * [-2354.934] (-2352.601) (-2355.918) (-2360.522) -- 0:02:55 197500 -- (-2350.931) [-2350.565] (-2367.085) (-2351.180) * [-2348.909] (-2353.486) (-2354.145) (-2357.451) -- 0:02:58 198000 -- (-2355.755) [-2349.642] (-2356.723) (-2357.255) * (-2354.746) (-2357.987) (-2348.343) [-2350.023] -- 0:02:58 198500 -- (-2357.109) (-2350.741) (-2361.748) [-2352.851] * (-2352.858) (-2356.403) (-2352.167) [-2355.114] -- 0:02:57 199000 -- [-2348.454] (-2355.204) (-2352.961) (-2361.365) * (-2351.587) (-2354.927) [-2354.095] (-2352.135) -- 0:02:57 199500 -- [-2355.499] (-2353.724) (-2349.332) (-2362.502) * (-2349.959) (-2355.216) [-2355.004] (-2352.805) -- 0:02:56 200000 -- (-2353.688) (-2360.789) [-2350.864] (-2351.649) * (-2357.517) (-2358.951) (-2351.234) [-2353.808] -- 0:02:56 Average standard deviation of split frequencies: 0.018206 200500 -- (-2349.312) [-2352.259] (-2351.258) (-2349.854) * [-2349.640] (-2353.458) (-2362.105) (-2347.938) -- 0:02:55 201000 -- (-2350.677) [-2354.060] (-2350.985) (-2357.001) * (-2348.473) [-2346.583] (-2354.766) (-2352.815) -- 0:02:54 201500 -- [-2355.032] (-2352.948) (-2357.717) (-2355.744) * (-2351.855) [-2348.748] (-2367.763) (-2353.451) -- 0:02:54 202000 -- [-2349.547] (-2355.349) (-2353.754) (-2351.998) * (-2360.372) [-2355.428] (-2355.311) (-2356.838) -- 0:02:57 202500 -- [-2356.624] (-2358.551) (-2354.138) (-2353.894) * (-2348.518) [-2357.920] (-2357.765) (-2356.522) -- 0:02:57 203000 -- [-2350.593] (-2347.590) (-2361.899) (-2352.573) * (-2354.130) (-2366.920) (-2354.513) [-2349.208] -- 0:02:56 203500 -- (-2355.957) (-2348.224) [-2354.729] (-2351.272) * (-2358.210) (-2360.261) (-2356.029) [-2357.221] -- 0:02:56 204000 -- (-2354.619) [-2352.020] (-2354.426) (-2355.789) * (-2354.943) (-2360.837) (-2354.281) [-2357.527] -- 0:02:55 204500 -- (-2355.736) (-2355.564) (-2353.882) [-2353.087] * (-2369.046) (-2358.389) [-2347.374] (-2354.061) -- 0:02:55 205000 -- (-2356.050) (-2352.211) (-2360.560) [-2351.969] * (-2351.017) (-2363.221) (-2350.402) [-2355.300] -- 0:02:54 Average standard deviation of split frequencies: 0.020595 205500 -- [-2353.279] (-2356.693) (-2354.171) (-2353.798) * (-2357.724) (-2358.471) (-2356.824) [-2351.878] -- 0:02:53 206000 -- (-2354.399) (-2358.367) (-2353.907) [-2350.251] * [-2353.888] (-2353.683) (-2352.074) (-2349.670) -- 0:02:53 206500 -- (-2352.814) [-2355.145] (-2358.301) (-2354.267) * (-2355.579) (-2353.731) [-2356.733] (-2352.483) -- 0:02:56 207000 -- (-2351.108) (-2352.615) [-2356.085] (-2353.559) * (-2355.896) (-2360.069) (-2354.025) [-2356.175] -- 0:02:56 207500 -- (-2351.314) (-2360.786) [-2353.755] (-2353.739) * (-2348.570) (-2351.468) (-2364.443) [-2347.547] -- 0:02:55 208000 -- (-2353.450) [-2353.350] (-2354.410) (-2354.828) * [-2355.418] (-2361.017) (-2355.128) (-2353.764) -- 0:02:55 208500 -- (-2356.064) (-2358.350) [-2355.412] (-2354.530) * (-2349.138) [-2358.763] (-2349.300) (-2353.490) -- 0:02:54 209000 -- (-2353.584) [-2352.806] (-2347.059) (-2349.883) * (-2354.075) [-2350.319] (-2350.891) (-2355.019) -- 0:02:54 209500 -- (-2356.914) [-2355.654] (-2354.826) (-2351.852) * (-2352.145) (-2354.620) (-2349.858) [-2354.707] -- 0:02:53 210000 -- (-2359.301) (-2352.530) [-2354.998] (-2353.645) * (-2350.876) (-2361.760) (-2364.860) [-2354.647] -- 0:02:53 Average standard deviation of split frequencies: 0.022377 210500 -- (-2359.519) (-2348.442) (-2358.900) [-2355.804] * [-2351.708] (-2360.924) (-2351.031) (-2354.739) -- 0:02:52 211000 -- (-2356.966) (-2354.114) [-2351.244] (-2350.931) * (-2356.666) (-2355.614) [-2348.102] (-2356.447) -- 0:02:55 211500 -- [-2355.775] (-2359.820) (-2349.339) (-2361.488) * (-2357.472) (-2353.625) [-2353.945] (-2356.448) -- 0:02:55 212000 -- (-2350.136) [-2352.920] (-2347.898) (-2352.225) * [-2355.897] (-2359.323) (-2360.343) (-2353.676) -- 0:02:54 212500 -- (-2361.320) (-2358.048) [-2350.569] (-2351.969) * (-2353.233) (-2355.214) (-2364.255) [-2356.435] -- 0:02:54 213000 -- (-2358.896) [-2354.893] (-2359.115) (-2354.587) * [-2352.952] (-2349.760) (-2357.819) (-2354.118) -- 0:02:53 213500 -- (-2354.898) (-2353.022) [-2351.226] (-2356.463) * [-2352.990] (-2351.871) (-2351.483) (-2348.000) -- 0:02:53 214000 -- (-2363.262) [-2350.608] (-2354.431) (-2358.139) * [-2354.203] (-2356.776) (-2348.763) (-2354.959) -- 0:02:52 214500 -- (-2357.032) (-2352.619) [-2352.407] (-2356.207) * (-2362.685) [-2349.271] (-2352.679) (-2356.014) -- 0:02:52 215000 -- (-2355.493) (-2350.906) (-2354.349) [-2349.148] * (-2354.476) (-2358.395) [-2356.889] (-2352.643) -- 0:02:51 Average standard deviation of split frequencies: 0.019642 215500 -- (-2353.891) (-2357.572) (-2351.788) [-2352.498] * (-2359.445) [-2353.395] (-2347.663) (-2361.856) -- 0:02:54 216000 -- (-2353.840) [-2356.357] (-2369.661) (-2349.037) * (-2357.090) [-2353.780] (-2356.496) (-2359.811) -- 0:02:54 216500 -- (-2363.894) (-2355.924) (-2357.463) [-2351.407] * (-2361.532) (-2351.380) [-2349.445] (-2352.840) -- 0:02:53 217000 -- (-2366.727) (-2354.322) (-2360.258) [-2353.312] * (-2356.436) [-2359.332] (-2355.015) (-2353.159) -- 0:02:53 217500 -- (-2359.420) (-2359.879) (-2356.453) [-2352.521] * (-2353.897) (-2349.765) (-2351.483) [-2355.823] -- 0:02:52 218000 -- (-2354.041) (-2354.253) (-2354.208) [-2358.590] * (-2349.028) (-2358.573) [-2356.956] (-2354.364) -- 0:02:52 218500 -- [-2353.779] (-2355.778) (-2357.982) (-2355.064) * (-2353.779) (-2357.485) [-2348.391] (-2359.266) -- 0:02:51 219000 -- (-2351.301) (-2352.505) [-2355.551] (-2352.743) * (-2359.620) (-2357.335) [-2351.664] (-2354.947) -- 0:02:51 219500 -- [-2350.370] (-2352.770) (-2359.931) (-2353.117) * [-2358.420] (-2359.887) (-2351.430) (-2351.285) -- 0:02:50 220000 -- (-2360.606) [-2353.209] (-2353.678) (-2351.172) * (-2351.351) [-2352.080] (-2358.587) (-2357.182) -- 0:02:53 Average standard deviation of split frequencies: 0.017090 220500 -- [-2357.917] (-2353.454) (-2367.689) (-2353.899) * (-2355.934) (-2354.129) (-2356.997) [-2355.134] -- 0:02:53 221000 -- (-2353.000) (-2354.497) [-2353.434] (-2353.578) * (-2360.336) (-2353.156) (-2360.204) [-2351.024] -- 0:02:52 221500 -- (-2354.551) (-2352.643) (-2356.512) [-2347.902] * (-2357.604) [-2356.624] (-2361.159) (-2352.764) -- 0:02:52 222000 -- [-2360.156] (-2353.594) (-2350.447) (-2351.395) * (-2351.598) (-2361.780) (-2351.953) [-2358.582] -- 0:02:51 222500 -- (-2352.810) (-2352.471) [-2353.463] (-2349.645) * [-2355.447] (-2360.134) (-2356.555) (-2351.073) -- 0:02:51 223000 -- (-2358.755) [-2347.978] (-2356.284) (-2356.517) * (-2353.022) (-2358.748) (-2354.962) [-2353.486] -- 0:02:50 223500 -- (-2349.098) (-2352.280) [-2360.448] (-2354.209) * (-2353.803) (-2354.819) (-2355.457) [-2356.205] -- 0:02:50 224000 -- (-2351.646) (-2348.171) [-2346.554] (-2359.824) * (-2362.262) (-2356.841) [-2355.073] (-2362.417) -- 0:02:49 224500 -- [-2353.550] (-2354.315) (-2351.087) (-2354.880) * [-2359.181] (-2360.809) (-2359.329) (-2359.347) -- 0:02:52 225000 -- [-2355.475] (-2361.641) (-2353.730) (-2353.376) * (-2356.510) (-2356.561) (-2363.065) [-2360.101] -- 0:02:52 Average standard deviation of split frequencies: 0.014601 225500 -- [-2354.186] (-2355.461) (-2352.893) (-2349.358) * (-2351.603) (-2353.324) [-2351.970] (-2373.186) -- 0:02:51 226000 -- (-2356.196) (-2352.738) [-2354.710] (-2355.680) * [-2357.082] (-2357.071) (-2352.401) (-2356.145) -- 0:02:51 226500 -- (-2355.396) [-2352.831] (-2347.216) (-2353.975) * (-2362.292) (-2352.274) [-2354.872] (-2356.788) -- 0:02:50 227000 -- (-2350.905) (-2349.457) (-2352.279) [-2353.926] * (-2354.144) (-2358.341) [-2353.010] (-2362.198) -- 0:02:50 227500 -- (-2355.196) (-2354.046) [-2348.803] (-2354.880) * (-2356.256) [-2349.860] (-2359.876) (-2359.011) -- 0:02:49 228000 -- (-2359.451) (-2351.899) [-2354.486] (-2360.649) * [-2351.014] (-2350.767) (-2350.015) (-2364.022) -- 0:02:49 228500 -- (-2355.576) [-2349.494] (-2354.218) (-2367.999) * (-2351.004) [-2352.633] (-2360.241) (-2353.358) -- 0:02:48 229000 -- [-2360.800] (-2354.033) (-2358.161) (-2351.683) * (-2355.215) [-2354.969] (-2358.875) (-2353.791) -- 0:02:51 229500 -- (-2354.403) (-2358.299) (-2352.279) [-2356.631] * (-2355.263) (-2350.732) [-2350.163] (-2348.432) -- 0:02:51 230000 -- [-2354.234] (-2355.764) (-2351.396) (-2355.311) * (-2355.811) (-2354.917) (-2354.478) [-2352.801] -- 0:02:50 Average standard deviation of split frequencies: 0.014306 230500 -- [-2348.553] (-2361.850) (-2350.894) (-2359.922) * (-2354.434) (-2353.477) [-2350.800] (-2348.681) -- 0:02:50 231000 -- (-2352.280) (-2351.817) [-2350.784] (-2360.142) * (-2350.806) [-2351.068] (-2353.024) (-2355.094) -- 0:02:49 231500 -- (-2354.124) (-2357.666) [-2355.681] (-2360.795) * [-2349.710] (-2355.366) (-2352.559) (-2354.902) -- 0:02:49 232000 -- [-2351.592] (-2353.407) (-2354.732) (-2368.869) * [-2344.852] (-2362.023) (-2347.977) (-2356.567) -- 0:02:48 232500 -- [-2349.717] (-2360.537) (-2356.462) (-2358.104) * (-2351.184) (-2351.870) (-2355.451) [-2358.571] -- 0:02:48 233000 -- [-2350.200] (-2358.528) (-2355.560) (-2360.887) * (-2353.385) (-2351.771) [-2354.697] (-2355.986) -- 0:02:47 233500 -- (-2351.621) (-2357.505) [-2351.059] (-2354.738) * (-2353.796) (-2353.236) (-2350.042) [-2347.849] -- 0:02:47 234000 -- (-2349.254) (-2361.003) (-2353.466) [-2349.756] * [-2352.983] (-2360.740) (-2359.399) (-2353.419) -- 0:02:50 234500 -- (-2345.660) (-2348.613) [-2351.179] (-2362.155) * [-2352.826] (-2347.570) (-2355.080) (-2355.083) -- 0:02:49 235000 -- (-2349.926) [-2351.126] (-2363.228) (-2348.282) * (-2358.158) (-2353.525) [-2358.309] (-2356.006) -- 0:02:49 Average standard deviation of split frequencies: 0.015480 235500 -- [-2361.483] (-2357.614) (-2358.424) (-2351.843) * (-2357.538) [-2353.475] (-2355.834) (-2357.609) -- 0:02:48 236000 -- (-2381.615) [-2354.717] (-2350.627) (-2353.384) * (-2355.073) (-2350.199) (-2355.816) [-2353.506] -- 0:02:48 236500 -- [-2353.046] (-2352.698) (-2356.637) (-2354.194) * [-2354.742] (-2354.772) (-2349.103) (-2359.325) -- 0:02:47 237000 -- [-2351.547] (-2358.309) (-2346.926) (-2360.368) * [-2360.584] (-2355.746) (-2356.140) (-2352.061) -- 0:02:47 237500 -- (-2351.949) (-2352.610) (-2357.516) [-2354.396] * (-2353.225) (-2360.822) (-2352.985) [-2347.905] -- 0:02:46 238000 -- (-2358.447) (-2352.932) [-2356.739] (-2355.556) * (-2353.090) (-2352.010) (-2353.167) [-2351.757] -- 0:02:46 238500 -- [-2349.152] (-2349.447) (-2350.333) (-2360.365) * (-2358.464) [-2351.481] (-2350.303) (-2354.953) -- 0:02:49 239000 -- (-2353.039) (-2352.534) [-2350.693] (-2355.972) * (-2355.111) (-2357.765) [-2355.068] (-2354.643) -- 0:02:48 239500 -- (-2356.712) [-2350.793] (-2354.421) (-2357.011) * (-2352.325) (-2353.248) (-2357.036) [-2357.586] -- 0:02:48 240000 -- (-2355.153) (-2355.776) (-2348.961) [-2354.448] * (-2354.315) (-2352.688) [-2357.240] (-2352.613) -- 0:02:47 Average standard deviation of split frequencies: 0.013222 240500 -- (-2358.125) (-2353.850) (-2348.285) [-2355.288] * (-2350.681) (-2351.278) (-2359.667) [-2351.694] -- 0:02:47 241000 -- [-2346.954] (-2349.079) (-2351.382) (-2354.765) * [-2353.009] (-2355.314) (-2351.067) (-2358.787) -- 0:02:46 241500 -- (-2357.130) (-2358.536) [-2354.396] (-2355.598) * (-2352.960) (-2356.541) (-2356.236) [-2357.894] -- 0:02:46 242000 -- (-2349.916) (-2359.138) (-2350.862) [-2357.926] * (-2359.376) (-2355.887) (-2356.991) [-2346.617] -- 0:02:46 242500 -- (-2356.368) [-2353.488] (-2353.331) (-2361.453) * [-2348.005] (-2355.571) (-2353.994) (-2352.293) -- 0:02:45 243000 -- (-2357.447) (-2351.242) (-2354.518) [-2353.989] * [-2356.852] (-2355.769) (-2355.772) (-2347.421) -- 0:02:48 243500 -- (-2352.535) (-2354.541) (-2354.808) [-2346.848] * (-2351.979) (-2353.576) [-2354.922] (-2352.574) -- 0:02:47 244000 -- (-2355.616) [-2360.039] (-2354.504) (-2351.694) * (-2356.505) [-2354.167] (-2348.265) (-2354.516) -- 0:02:47 244500 -- (-2353.623) (-2358.864) (-2353.439) [-2350.712] * (-2352.467) (-2347.253) (-2363.567) [-2350.777] -- 0:02:46 245000 -- (-2356.611) (-2358.095) (-2355.392) [-2351.470] * [-2350.540] (-2361.424) (-2353.339) (-2351.785) -- 0:02:46 Average standard deviation of split frequencies: 0.017247 245500 -- (-2357.233) [-2359.682] (-2350.977) (-2358.906) * (-2355.786) (-2353.181) [-2354.542] (-2356.048) -- 0:02:45 246000 -- (-2355.212) (-2359.459) (-2355.499) [-2352.874] * [-2355.989] (-2352.989) (-2352.886) (-2350.286) -- 0:02:45 246500 -- [-2352.915] (-2357.796) (-2356.889) (-2350.612) * [-2352.566] (-2349.822) (-2351.806) (-2346.538) -- 0:02:45 247000 -- (-2350.645) (-2360.455) (-2348.846) [-2348.040] * (-2354.805) (-2356.167) [-2351.284] (-2353.057) -- 0:02:44 247500 -- (-2352.899) (-2368.563) [-2354.499] (-2347.347) * (-2363.041) [-2352.009] (-2357.241) (-2354.512) -- 0:02:47 248000 -- (-2352.533) [-2355.815] (-2359.233) (-2350.970) * (-2350.512) [-2351.482] (-2360.916) (-2358.904) -- 0:02:46 248500 -- (-2350.416) [-2354.778] (-2356.650) (-2352.316) * (-2352.935) (-2356.618) [-2358.448] (-2349.125) -- 0:02:46 249000 -- (-2351.884) [-2348.754] (-2355.457) (-2351.355) * (-2355.431) [-2353.863] (-2357.597) (-2357.459) -- 0:02:45 249500 -- [-2353.889] (-2353.301) (-2355.824) (-2351.456) * [-2354.204] (-2356.282) (-2359.653) (-2358.701) -- 0:02:45 250000 -- (-2346.737) (-2357.206) [-2352.807] (-2359.461) * [-2355.411] (-2351.033) (-2355.155) (-2352.568) -- 0:02:45 Average standard deviation of split frequencies: 0.016455 250500 -- (-2349.430) [-2354.017] (-2355.455) (-2355.915) * (-2353.874) (-2358.202) (-2360.305) [-2357.066] -- 0:02:44 251000 -- (-2353.069) (-2350.832) [-2357.271] (-2348.281) * [-2350.483] (-2353.457) (-2352.190) (-2355.867) -- 0:02:44 251500 -- (-2362.070) (-2352.231) [-2355.233] (-2356.418) * [-2352.725] (-2355.071) (-2354.211) (-2354.212) -- 0:02:43 252000 -- (-2355.368) [-2350.467] (-2362.387) (-2347.813) * [-2350.851] (-2351.230) (-2352.140) (-2359.751) -- 0:02:46 252500 -- (-2352.976) (-2350.142) (-2357.610) [-2353.824] * (-2351.731) (-2355.135) (-2364.675) [-2353.857] -- 0:02:45 253000 -- (-2355.500) (-2348.067) [-2358.209] (-2361.215) * [-2352.727] (-2359.787) (-2356.479) (-2354.299) -- 0:02:45 253500 -- (-2350.410) (-2357.537) (-2357.276) [-2353.988] * [-2354.214] (-2349.220) (-2357.083) (-2349.833) -- 0:02:44 254000 -- (-2360.755) [-2359.188] (-2358.578) (-2353.490) * (-2350.271) (-2351.854) [-2355.099] (-2355.589) -- 0:02:44 254500 -- (-2353.025) (-2353.285) [-2351.270] (-2352.001) * (-2350.910) [-2355.330] (-2357.615) (-2351.888) -- 0:02:44 255000 -- [-2352.756] (-2351.404) (-2352.367) (-2356.555) * (-2351.717) (-2348.246) (-2360.278) [-2353.569] -- 0:02:43 Average standard deviation of split frequencies: 0.011509 255500 -- (-2354.366) (-2349.042) (-2353.363) [-2351.305] * [-2352.107] (-2353.282) (-2364.023) (-2356.959) -- 0:02:43 256000 -- (-2359.172) (-2355.251) (-2352.669) [-2358.104] * (-2351.355) [-2349.759] (-2353.767) (-2362.164) -- 0:02:42 256500 -- [-2351.237] (-2354.894) (-2350.157) (-2358.101) * (-2349.904) [-2356.678] (-2361.333) (-2357.122) -- 0:02:45 257000 -- (-2348.663) (-2354.756) (-2358.648) [-2358.276] * (-2353.670) [-2354.698] (-2356.123) (-2355.998) -- 0:02:44 257500 -- (-2362.967) [-2355.656] (-2352.793) (-2358.447) * (-2350.592) (-2353.152) [-2351.731] (-2358.779) -- 0:02:44 258000 -- (-2354.336) [-2349.613] (-2354.676) (-2358.472) * (-2353.816) (-2354.654) [-2355.572] (-2352.582) -- 0:02:43 258500 -- (-2357.649) (-2351.193) [-2354.385] (-2361.025) * [-2352.761] (-2354.681) (-2358.085) (-2349.052) -- 0:02:43 259000 -- [-2356.243] (-2356.359) (-2360.197) (-2364.710) * (-2355.178) (-2354.538) (-2352.844) [-2350.226] -- 0:02:43 259500 -- [-2355.355] (-2348.237) (-2356.985) (-2354.784) * (-2357.953) (-2355.596) (-2354.094) [-2357.070] -- 0:02:42 260000 -- (-2350.915) (-2353.680) [-2351.071] (-2353.146) * (-2354.234) (-2352.816) (-2345.913) [-2354.088] -- 0:02:42 Average standard deviation of split frequencies: 0.012659 260500 -- (-2358.990) (-2351.592) (-2356.763) [-2352.340] * (-2354.909) [-2348.369] (-2351.311) (-2360.554) -- 0:02:41 261000 -- (-2357.263) (-2356.570) [-2350.075] (-2361.268) * (-2356.747) (-2361.532) (-2348.602) [-2351.544] -- 0:02:44 261500 -- (-2349.626) (-2355.948) (-2362.676) [-2353.168] * (-2356.027) (-2358.227) [-2354.910] (-2352.290) -- 0:02:43 262000 -- (-2355.146) (-2356.958) (-2359.566) [-2352.425] * (-2351.599) [-2351.610] (-2349.562) (-2349.064) -- 0:02:43 262500 -- [-2349.848] (-2352.071) (-2355.167) (-2351.220) * [-2362.028] (-2359.267) (-2351.500) (-2350.152) -- 0:02:42 263000 -- (-2355.913) (-2352.148) (-2348.354) [-2356.328] * (-2356.231) (-2356.754) [-2357.803] (-2352.727) -- 0:02:42 263500 -- (-2356.668) (-2363.017) (-2356.506) [-2347.135] * (-2357.066) (-2355.907) (-2350.859) [-2350.753] -- 0:02:42 264000 -- (-2356.686) [-2351.830] (-2350.508) (-2349.665) * (-2359.310) (-2358.655) (-2361.844) [-2351.254] -- 0:02:41 264500 -- (-2355.027) (-2356.166) [-2354.847] (-2355.007) * (-2353.697) [-2349.628] (-2350.165) (-2354.054) -- 0:02:41 265000 -- (-2355.813) (-2354.125) [-2350.930] (-2368.156) * (-2359.812) (-2350.594) [-2348.899] (-2351.692) -- 0:02:40 Average standard deviation of split frequencies: 0.014621 265500 -- (-2352.188) (-2353.696) (-2352.541) [-2353.304] * (-2365.490) (-2352.148) [-2349.805] (-2351.332) -- 0:02:43 266000 -- (-2349.806) [-2356.560] (-2353.051) (-2350.690) * (-2357.315) (-2348.745) (-2355.307) [-2350.244] -- 0:02:42 266500 -- (-2351.719) [-2359.226] (-2358.219) (-2359.514) * (-2362.864) (-2352.040) [-2354.621] (-2351.295) -- 0:02:42 267000 -- (-2357.685) (-2359.883) [-2352.433] (-2351.187) * (-2357.858) [-2348.955] (-2350.344) (-2355.132) -- 0:02:41 267500 -- (-2356.540) [-2360.179] (-2355.006) (-2356.583) * (-2356.448) (-2353.058) (-2354.429) [-2354.999] -- 0:02:41 268000 -- [-2355.923] (-2365.796) (-2351.208) (-2352.250) * (-2352.278) (-2356.835) (-2355.981) [-2363.057] -- 0:02:41 268500 -- (-2353.686) (-2357.539) [-2349.051] (-2358.206) * (-2359.149) (-2351.815) [-2355.696] (-2360.764) -- 0:02:40 269000 -- (-2354.899) (-2352.243) [-2356.279] (-2362.701) * (-2362.719) (-2352.261) [-2352.707] (-2352.387) -- 0:02:40 269500 -- (-2364.060) (-2351.873) (-2354.298) [-2350.528] * [-2354.809] (-2356.981) (-2354.286) (-2348.369) -- 0:02:39 270000 -- (-2359.259) [-2355.003] (-2355.390) (-2362.632) * (-2358.237) (-2357.084) [-2352.280] (-2355.043) -- 0:02:42 Average standard deviation of split frequencies: 0.016110 270500 -- [-2350.918] (-2355.738) (-2348.952) (-2355.363) * (-2353.822) (-2353.181) [-2354.819] (-2354.526) -- 0:02:41 271000 -- [-2353.054] (-2357.521) (-2358.351) (-2354.055) * [-2353.477] (-2351.492) (-2354.545) (-2349.908) -- 0:02:41 271500 -- (-2352.699) (-2355.160) [-2359.992] (-2362.126) * (-2353.834) [-2354.266] (-2356.338) (-2358.629) -- 0:02:40 272000 -- [-2356.656] (-2357.125) (-2358.518) (-2354.119) * [-2352.135] (-2364.100) (-2358.603) (-2353.543) -- 0:02:40 272500 -- (-2356.066) (-2353.088) [-2361.878] (-2355.533) * (-2352.825) [-2355.456] (-2355.056) (-2353.278) -- 0:02:40 273000 -- (-2357.337) (-2354.026) [-2354.855] (-2358.945) * (-2354.842) (-2366.411) (-2352.105) [-2355.309] -- 0:02:39 273500 -- (-2348.789) (-2361.165) (-2353.016) [-2348.783] * (-2352.026) (-2363.164) [-2354.129] (-2356.079) -- 0:02:39 274000 -- [-2354.596] (-2359.017) (-2353.480) (-2351.273) * [-2348.724] (-2351.963) (-2350.673) (-2348.718) -- 0:02:38 274500 -- (-2357.775) (-2360.967) (-2350.403) [-2350.049] * (-2350.412) (-2352.459) (-2359.418) [-2353.248] -- 0:02:41 275000 -- (-2351.960) [-2350.970] (-2357.205) (-2354.006) * [-2360.777] (-2352.305) (-2367.564) (-2356.165) -- 0:02:40 Average standard deviation of split frequencies: 0.015799 275500 -- [-2349.382] (-2357.079) (-2349.291) (-2353.076) * (-2364.282) (-2358.046) [-2355.951] (-2360.332) -- 0:02:40 276000 -- (-2353.728) (-2351.228) (-2353.108) [-2352.468] * (-2351.211) (-2363.335) (-2360.160) [-2355.526] -- 0:02:40 276500 -- (-2349.596) (-2348.120) (-2359.155) [-2357.943] * (-2355.747) [-2361.885] (-2358.385) (-2351.952) -- 0:02:39 277000 -- (-2350.993) (-2363.480) [-2351.799] (-2358.519) * (-2352.393) [-2356.261] (-2346.206) (-2357.492) -- 0:02:39 277500 -- [-2350.700] (-2357.306) (-2348.961) (-2355.976) * [-2349.680] (-2356.642) (-2350.439) (-2350.430) -- 0:02:38 278000 -- (-2355.228) (-2358.066) [-2352.574] (-2351.711) * (-2352.382) [-2354.230] (-2351.202) (-2353.121) -- 0:02:38 278500 -- (-2352.879) (-2356.346) (-2360.991) [-2352.941] * (-2354.669) (-2350.589) (-2352.891) [-2354.528] -- 0:02:38 279000 -- (-2360.823) (-2351.276) (-2353.737) [-2350.815] * [-2348.271] (-2354.186) (-2352.583) (-2361.565) -- 0:02:40 279500 -- [-2359.415] (-2350.180) (-2351.568) (-2350.986) * [-2355.805] (-2353.300) (-2357.840) (-2353.906) -- 0:02:39 280000 -- [-2362.061] (-2349.707) (-2353.191) (-2360.813) * [-2353.237] (-2361.547) (-2359.216) (-2355.583) -- 0:02:39 Average standard deviation of split frequencies: 0.017216 280500 -- (-2353.426) (-2361.472) [-2358.645] (-2352.893) * [-2354.806] (-2361.345) (-2356.308) (-2354.465) -- 0:02:39 281000 -- (-2355.526) [-2354.243] (-2357.072) (-2352.729) * (-2354.462) (-2351.863) [-2353.429] (-2358.867) -- 0:02:38 281500 -- (-2354.296) [-2353.336] (-2355.517) (-2353.101) * (-2351.683) (-2354.467) [-2350.648] (-2352.295) -- 0:02:38 282000 -- (-2351.883) [-2355.998] (-2361.133) (-2354.846) * (-2350.686) (-2355.223) (-2349.813) [-2356.937] -- 0:02:37 282500 -- (-2354.018) (-2355.913) [-2357.503] (-2349.853) * (-2355.468) (-2355.819) [-2348.567] (-2353.707) -- 0:02:37 283000 -- (-2356.726) (-2357.210) (-2358.424) [-2346.824] * (-2355.511) [-2363.233] (-2351.593) (-2353.931) -- 0:02:39 283500 -- (-2356.601) [-2353.290] (-2348.299) (-2354.131) * [-2351.689] (-2368.007) (-2352.299) (-2361.089) -- 0:02:39 284000 -- (-2352.790) (-2348.629) [-2349.090] (-2346.979) * (-2355.147) (-2364.070) (-2366.276) [-2357.149] -- 0:02:38 284500 -- (-2356.850) (-2352.680) [-2351.634] (-2353.427) * (-2365.421) (-2364.103) (-2350.487) [-2355.131] -- 0:02:38 285000 -- (-2354.989) (-2352.150) (-2351.077) [-2351.588] * (-2352.672) (-2362.068) (-2354.346) [-2350.375] -- 0:02:38 Average standard deviation of split frequencies: 0.016895 285500 -- (-2349.356) (-2357.898) [-2350.864] (-2352.394) * (-2360.112) (-2367.048) [-2358.122] (-2349.464) -- 0:02:37 286000 -- (-2356.068) (-2353.575) [-2348.240] (-2359.818) * (-2348.991) [-2350.764] (-2351.397) (-2350.046) -- 0:02:37 286500 -- (-2349.174) (-2354.359) [-2351.567] (-2361.789) * [-2354.774] (-2354.252) (-2351.485) (-2351.796) -- 0:02:36 287000 -- [-2350.706] (-2353.851) (-2359.184) (-2356.587) * (-2361.484) [-2357.979] (-2353.547) (-2354.300) -- 0:02:36 287500 -- (-2350.338) [-2351.033] (-2352.591) (-2357.633) * (-2359.704) (-2356.688) [-2349.303] (-2352.198) -- 0:02:38 288000 -- (-2356.813) [-2348.525] (-2352.113) (-2356.327) * (-2364.893) (-2352.752) [-2353.722] (-2349.540) -- 0:02:38 288500 -- (-2354.256) [-2347.259] (-2349.158) (-2353.644) * [-2353.552] (-2361.675) (-2350.459) (-2356.898) -- 0:02:37 289000 -- (-2359.030) (-2352.471) (-2354.217) [-2357.011] * (-2348.934) [-2354.302] (-2347.531) (-2358.524) -- 0:02:37 289500 -- (-2353.675) (-2352.494) (-2356.505) [-2349.196] * [-2349.875] (-2357.571) (-2358.341) (-2360.916) -- 0:02:37 290000 -- (-2357.683) [-2350.494] (-2350.748) (-2347.705) * (-2352.328) (-2359.895) [-2355.578] (-2348.588) -- 0:02:36 Average standard deviation of split frequencies: 0.015813 290500 -- [-2349.002] (-2358.046) (-2351.753) (-2360.548) * (-2352.774) [-2353.309] (-2363.508) (-2353.130) -- 0:02:36 291000 -- (-2355.064) (-2359.507) (-2351.433) [-2351.839] * [-2352.160] (-2351.599) (-2348.467) (-2352.615) -- 0:02:35 291500 -- (-2354.153) [-2352.491] (-2360.175) (-2348.881) * [-2352.073] (-2354.066) (-2352.187) (-2350.230) -- 0:02:35 292000 -- (-2364.399) (-2352.200) (-2353.869) [-2353.848] * (-2358.079) (-2352.791) (-2352.910) [-2355.657] -- 0:02:37 292500 -- (-2364.327) (-2361.555) (-2354.856) [-2352.331] * (-2350.376) (-2358.477) [-2356.052] (-2358.042) -- 0:02:37 293000 -- (-2363.600) (-2360.901) (-2357.742) [-2348.770] * (-2352.822) [-2354.773] (-2353.981) (-2357.772) -- 0:02:36 293500 -- (-2356.395) [-2358.215] (-2357.254) (-2362.284) * [-2348.579] (-2352.666) (-2353.577) (-2351.546) -- 0:02:36 294000 -- (-2354.110) (-2352.188) (-2353.866) [-2352.388] * [-2351.039] (-2360.693) (-2352.906) (-2354.636) -- 0:02:36 294500 -- (-2348.977) [-2352.669] (-2353.788) (-2355.677) * (-2352.071) (-2356.019) (-2353.273) [-2358.880] -- 0:02:35 295000 -- [-2347.967] (-2354.234) (-2357.155) (-2356.121) * (-2357.140) (-2351.946) [-2349.947] (-2364.139) -- 0:02:35 Average standard deviation of split frequencies: 0.017518 295500 -- [-2352.771] (-2356.374) (-2354.435) (-2358.843) * (-2354.480) (-2353.301) (-2354.322) [-2352.789] -- 0:02:34 296000 -- (-2352.584) (-2352.852) (-2357.656) [-2353.557] * (-2353.448) [-2354.541] (-2353.941) (-2356.145) -- 0:02:34 296500 -- [-2350.906] (-2355.931) (-2355.009) (-2358.967) * (-2355.340) (-2358.754) [-2354.435] (-2352.636) -- 0:02:36 297000 -- (-2353.121) (-2351.371) (-2359.935) [-2351.064] * (-2347.181) (-2356.428) (-2352.781) [-2349.800] -- 0:02:36 297500 -- (-2357.165) (-2353.962) (-2359.463) [-2347.965] * (-2356.244) (-2362.680) (-2367.730) [-2358.113] -- 0:02:35 298000 -- [-2353.663] (-2358.340) (-2353.994) (-2352.400) * (-2355.501) [-2352.378] (-2350.854) (-2353.556) -- 0:02:35 298500 -- (-2359.194) [-2347.322] (-2354.444) (-2351.493) * (-2361.078) (-2354.115) [-2351.995] (-2360.134) -- 0:02:35 299000 -- (-2362.843) (-2356.792) (-2351.193) [-2351.344] * (-2361.150) (-2357.877) [-2350.335] (-2365.572) -- 0:02:34 299500 -- (-2351.378) [-2350.627] (-2358.725) (-2350.239) * (-2350.003) [-2352.689] (-2351.234) (-2366.138) -- 0:02:34 300000 -- (-2351.309) (-2351.907) (-2352.279) [-2353.795] * (-2353.364) (-2356.211) (-2349.867) [-2349.609] -- 0:02:34 Average standard deviation of split frequencies: 0.018814 300500 -- (-2349.810) (-2351.748) (-2352.635) [-2348.256] * [-2353.549] (-2360.617) (-2357.729) (-2353.703) -- 0:02:33 301000 -- (-2353.269) (-2359.210) (-2356.278) [-2354.374] * (-2355.824) [-2355.610] (-2359.672) (-2353.468) -- 0:02:35 301500 -- (-2350.013) [-2350.987] (-2356.464) (-2352.270) * (-2355.280) (-2356.754) [-2349.993] (-2356.598) -- 0:02:35 302000 -- (-2357.118) (-2355.053) (-2361.108) [-2353.998] * (-2355.850) (-2356.146) [-2354.915] (-2351.494) -- 0:02:34 302500 -- (-2359.597) (-2359.614) [-2355.980] (-2353.577) * [-2354.614] (-2350.569) (-2356.384) (-2355.497) -- 0:02:34 303000 -- (-2352.692) [-2353.420] (-2356.478) (-2354.741) * (-2364.780) (-2350.888) [-2351.939] (-2352.660) -- 0:02:34 303500 -- (-2350.017) (-2354.875) [-2355.370] (-2352.619) * (-2356.656) (-2357.307) [-2352.393] (-2364.676) -- 0:02:33 304000 -- (-2352.832) (-2354.648) [-2351.279] (-2354.256) * [-2354.589] (-2353.080) (-2350.908) (-2357.229) -- 0:02:33 304500 -- (-2356.612) [-2349.791] (-2354.973) (-2352.830) * (-2354.868) (-2356.226) [-2353.116] (-2351.619) -- 0:02:33 305000 -- [-2354.032] (-2354.485) (-2363.298) (-2372.269) * (-2352.540) (-2360.857) [-2349.854] (-2354.585) -- 0:02:32 Average standard deviation of split frequencies: 0.015020 305500 -- (-2366.176) (-2350.147) [-2355.331] (-2355.743) * (-2354.970) (-2357.504) [-2352.049] (-2358.714) -- 0:02:34 306000 -- (-2357.852) (-2358.558) [-2347.164] (-2358.331) * (-2348.913) (-2368.676) (-2355.854) [-2351.256] -- 0:02:34 306500 -- (-2350.676) (-2349.412) [-2352.204] (-2359.634) * [-2357.409] (-2358.265) (-2347.911) (-2359.061) -- 0:02:33 307000 -- [-2351.412] (-2359.772) (-2352.976) (-2360.049) * [-2353.153] (-2357.012) (-2359.276) (-2351.921) -- 0:02:33 307500 -- (-2357.000) (-2356.292) [-2348.011] (-2352.198) * [-2353.255] (-2363.158) (-2349.999) (-2348.565) -- 0:02:33 308000 -- (-2356.085) [-2358.906] (-2351.330) (-2358.065) * (-2358.118) (-2362.529) [-2359.323] (-2357.179) -- 0:02:32 308500 -- [-2352.059] (-2367.070) (-2356.891) (-2354.144) * (-2358.533) (-2363.051) [-2345.129] (-2356.631) -- 0:02:32 309000 -- (-2351.475) (-2358.771) [-2356.427] (-2347.832) * [-2355.854] (-2353.960) (-2357.622) (-2355.943) -- 0:02:32 309500 -- (-2354.917) (-2356.778) (-2355.097) [-2352.545] * (-2363.056) [-2353.555] (-2356.358) (-2356.493) -- 0:02:31 310000 -- (-2353.882) (-2352.653) (-2351.626) [-2353.847] * (-2358.512) [-2348.335] (-2356.271) (-2362.119) -- 0:02:33 Average standard deviation of split frequencies: 0.017071 310500 -- [-2355.575] (-2355.932) (-2358.209) (-2359.028) * (-2353.478) [-2350.420] (-2353.035) (-2353.585) -- 0:02:33 311000 -- (-2351.765) (-2357.451) (-2363.141) [-2351.292] * (-2354.393) [-2352.813] (-2362.090) (-2363.893) -- 0:02:32 311500 -- (-2356.088) (-2354.799) (-2356.402) [-2353.082] * (-2354.730) (-2346.643) [-2355.745] (-2347.893) -- 0:02:32 312000 -- (-2353.162) (-2359.519) (-2352.360) [-2355.260] * [-2348.564] (-2346.030) (-2355.081) (-2356.775) -- 0:02:32 312500 -- (-2362.246) [-2350.047] (-2350.289) (-2354.530) * (-2353.412) [-2356.334] (-2354.917) (-2354.734) -- 0:02:31 313000 -- [-2354.204] (-2354.192) (-2355.913) (-2360.814) * (-2351.677) [-2349.777] (-2353.518) (-2357.721) -- 0:02:31 313500 -- (-2348.748) (-2356.154) [-2351.446] (-2357.689) * (-2355.995) (-2352.726) (-2351.383) [-2351.287] -- 0:02:31 314000 -- (-2359.492) [-2353.289] (-2350.191) (-2353.288) * (-2359.086) (-2352.985) [-2346.076] (-2349.102) -- 0:02:30 314500 -- (-2360.408) (-2353.225) (-2351.153) [-2356.930] * (-2364.590) [-2353.754] (-2353.369) (-2360.679) -- 0:02:32 315000 -- (-2351.485) (-2360.746) [-2353.344] (-2355.129) * (-2349.612) (-2349.802) (-2361.587) [-2354.140] -- 0:02:32 Average standard deviation of split frequencies: 0.017528 315500 -- [-2352.886] (-2362.975) (-2350.441) (-2351.940) * (-2353.996) [-2348.907] (-2347.573) (-2355.599) -- 0:02:31 316000 -- (-2355.437) (-2355.338) (-2352.332) [-2350.730] * (-2358.104) (-2348.228) (-2355.479) [-2351.386] -- 0:02:31 316500 -- (-2354.242) (-2355.954) (-2349.017) [-2350.442] * (-2353.583) (-2352.264) [-2352.844] (-2359.564) -- 0:02:31 317000 -- (-2350.678) [-2355.220] (-2353.858) (-2363.413) * (-2356.189) [-2350.992] (-2354.197) (-2350.149) -- 0:02:30 317500 -- (-2351.287) (-2354.398) (-2362.287) [-2350.417] * (-2354.781) [-2353.186] (-2359.719) (-2353.177) -- 0:02:30 318000 -- (-2353.882) (-2350.294) (-2354.237) [-2351.027] * [-2350.089] (-2352.592) (-2360.972) (-2351.855) -- 0:02:30 318500 -- [-2348.859] (-2357.121) (-2360.748) (-2359.877) * [-2349.285] (-2355.229) (-2352.760) (-2352.483) -- 0:02:29 319000 -- (-2357.556) (-2356.041) (-2351.158) [-2355.032] * (-2364.650) (-2356.611) [-2357.717] (-2354.743) -- 0:02:29 319500 -- (-2359.722) [-2353.081] (-2356.149) (-2351.030) * (-2357.062) [-2354.943] (-2357.522) (-2355.922) -- 0:02:31 320000 -- (-2355.940) (-2351.735) (-2355.180) [-2350.764] * (-2351.884) (-2360.028) [-2357.226] (-2350.954) -- 0:02:30 Average standard deviation of split frequencies: 0.017273 320500 -- (-2358.775) (-2348.772) [-2350.467] (-2353.155) * (-2351.214) [-2350.898] (-2356.033) (-2347.975) -- 0:02:30 321000 -- (-2361.559) (-2354.720) [-2350.390] (-2355.118) * (-2359.328) (-2352.514) [-2356.494] (-2358.592) -- 0:02:30 321500 -- [-2352.466] (-2349.813) (-2351.273) (-2351.252) * (-2355.488) [-2353.635] (-2358.526) (-2353.946) -- 0:02:29 322000 -- (-2355.849) (-2354.684) [-2345.256] (-2356.176) * (-2356.672) (-2347.420) (-2354.051) [-2350.053] -- 0:02:29 322500 -- (-2351.494) (-2348.321) (-2353.977) [-2353.811] * (-2355.034) (-2353.193) [-2356.162] (-2354.214) -- 0:02:29 323000 -- (-2353.540) (-2356.534) (-2350.125) [-2350.218] * (-2350.731) (-2349.944) [-2350.144] (-2354.640) -- 0:02:28 323500 -- [-2356.190] (-2354.844) (-2354.510) (-2350.961) * (-2352.594) (-2353.859) (-2352.684) [-2355.292] -- 0:02:28 324000 -- (-2356.038) (-2351.543) [-2348.006] (-2346.588) * (-2352.001) (-2350.531) (-2354.999) [-2355.046] -- 0:02:30 324500 -- [-2351.916] (-2355.050) (-2356.373) (-2360.805) * (-2350.311) (-2354.032) (-2355.757) [-2354.482] -- 0:02:29 325000 -- [-2353.886] (-2353.593) (-2355.999) (-2359.134) * (-2351.895) (-2346.880) (-2364.088) [-2349.984] -- 0:02:29 Average standard deviation of split frequencies: 0.013014 325500 -- (-2347.537) (-2349.939) [-2355.594] (-2359.182) * (-2351.897) (-2351.561) [-2359.209] (-2348.488) -- 0:02:29 326000 -- (-2352.141) (-2361.376) [-2350.849] (-2365.346) * (-2352.346) [-2350.249] (-2352.678) (-2358.740) -- 0:02:28 326500 -- [-2357.810] (-2352.842) (-2355.038) (-2358.395) * (-2350.397) (-2364.795) (-2356.815) [-2356.746] -- 0:02:28 327000 -- (-2355.296) (-2355.696) [-2355.625] (-2355.866) * (-2354.850) (-2352.753) (-2350.478) [-2356.075] -- 0:02:28 327500 -- (-2356.065) (-2350.522) [-2354.814] (-2352.075) * [-2353.717] (-2347.761) (-2355.382) (-2358.833) -- 0:02:27 328000 -- (-2350.668) (-2356.256) [-2355.958] (-2353.260) * [-2359.672] (-2355.970) (-2361.684) (-2357.700) -- 0:02:27 328500 -- (-2353.259) [-2351.307] (-2362.778) (-2352.908) * (-2354.440) [-2354.510] (-2350.096) (-2359.690) -- 0:02:29 329000 -- (-2361.967) [-2348.787] (-2355.251) (-2357.937) * (-2353.014) [-2355.351] (-2352.260) (-2355.751) -- 0:02:28 329500 -- [-2354.403] (-2352.249) (-2355.826) (-2350.834) * [-2351.166] (-2360.700) (-2357.008) (-2353.744) -- 0:02:28 330000 -- (-2360.125) [-2353.851] (-2351.558) (-2350.607) * (-2353.513) (-2357.392) [-2349.809] (-2354.263) -- 0:02:28 Average standard deviation of split frequencies: 0.013187 330500 -- (-2357.147) [-2348.658] (-2352.665) (-2347.923) * [-2349.151] (-2352.910) (-2355.179) (-2347.830) -- 0:02:27 331000 -- [-2356.346] (-2348.457) (-2356.342) (-2360.434) * (-2350.899) [-2349.644] (-2359.609) (-2346.660) -- 0:02:27 331500 -- (-2360.564) [-2353.216] (-2354.459) (-2357.471) * [-2351.065] (-2347.650) (-2357.852) (-2355.527) -- 0:02:27 332000 -- (-2366.103) (-2355.433) (-2352.460) [-2352.889] * [-2350.565] (-2356.394) (-2349.692) (-2355.629) -- 0:02:26 332500 -- (-2360.583) (-2357.235) (-2353.922) [-2355.269] * (-2358.319) (-2352.969) [-2353.436] (-2356.400) -- 0:02:26 333000 -- (-2355.962) (-2358.144) [-2348.254] (-2350.967) * (-2354.297) (-2354.757) (-2355.826) [-2355.632] -- 0:02:28 333500 -- (-2347.748) [-2356.695] (-2356.765) (-2350.002) * (-2353.270) (-2353.170) [-2350.366] (-2362.914) -- 0:02:27 334000 -- (-2353.570) (-2351.547) (-2357.039) [-2362.826] * (-2357.395) (-2356.481) [-2354.330] (-2355.579) -- 0:02:27 334500 -- (-2351.309) (-2364.539) (-2359.300) [-2351.457] * (-2352.788) (-2361.486) (-2358.689) [-2353.947] -- 0:02:27 335000 -- [-2348.256] (-2356.603) (-2361.377) (-2352.713) * [-2354.456] (-2351.624) (-2355.117) (-2359.127) -- 0:02:26 Average standard deviation of split frequencies: 0.010873 335500 -- [-2356.060] (-2357.841) (-2354.736) (-2355.348) * (-2354.764) [-2354.530] (-2354.585) (-2352.082) -- 0:02:26 336000 -- (-2356.721) (-2363.673) (-2347.374) [-2353.188] * (-2351.502) (-2361.465) (-2351.583) [-2353.542] -- 0:02:26 336500 -- [-2352.400] (-2358.971) (-2354.259) (-2359.054) * (-2350.738) [-2351.046] (-2358.593) (-2357.152) -- 0:02:25 337000 -- (-2353.897) (-2355.012) [-2355.040] (-2363.731) * (-2351.027) (-2352.585) (-2353.891) [-2356.380] -- 0:02:25 337500 -- (-2357.334) (-2357.925) [-2354.159] (-2360.131) * (-2358.986) [-2353.242] (-2354.387) (-2364.174) -- 0:02:27 338000 -- [-2350.135] (-2358.424) (-2361.219) (-2354.321) * (-2351.461) (-2349.704) (-2359.591) [-2354.798] -- 0:02:26 338500 -- (-2361.915) (-2354.038) (-2362.021) [-2350.224] * (-2352.411) [-2351.958] (-2356.040) (-2357.022) -- 0:02:26 339000 -- (-2354.996) [-2348.872] (-2353.024) (-2353.219) * (-2353.374) [-2349.434] (-2360.972) (-2355.126) -- 0:02:26 339500 -- (-2353.922) [-2358.724] (-2357.542) (-2357.546) * (-2359.772) [-2358.238] (-2353.567) (-2354.942) -- 0:02:25 340000 -- (-2358.875) (-2352.793) [-2354.161] (-2354.382) * (-2355.444) (-2348.489) [-2351.588] (-2354.674) -- 0:02:25 Average standard deviation of split frequencies: 0.010724 340500 -- [-2355.378] (-2347.987) (-2361.252) (-2357.906) * (-2356.705) (-2354.380) [-2349.455] (-2355.462) -- 0:02:25 341000 -- (-2360.796) [-2349.862] (-2357.714) (-2355.672) * [-2353.317] (-2364.498) (-2350.662) (-2359.283) -- 0:02:24 341500 -- [-2356.703] (-2352.767) (-2354.650) (-2353.738) * (-2351.169) (-2360.668) [-2350.598] (-2358.471) -- 0:02:24 342000 -- (-2364.885) (-2360.599) (-2356.640) [-2348.842] * (-2357.015) (-2360.168) [-2350.121] (-2350.097) -- 0:02:26 342500 -- [-2354.836] (-2353.320) (-2355.975) (-2353.865) * (-2355.699) (-2363.664) (-2353.615) [-2351.973] -- 0:02:25 343000 -- [-2355.847] (-2350.418) (-2361.030) (-2357.169) * (-2361.347) (-2355.121) (-2349.697) [-2349.359] -- 0:02:25 343500 -- [-2351.782] (-2354.134) (-2358.849) (-2353.468) * [-2360.720] (-2357.343) (-2349.562) (-2360.407) -- 0:02:25 344000 -- (-2352.104) [-2354.593] (-2353.309) (-2350.944) * [-2353.947] (-2353.845) (-2352.163) (-2351.376) -- 0:02:24 344500 -- (-2354.788) (-2352.261) [-2353.613] (-2354.024) * (-2350.202) (-2355.516) [-2353.561] (-2356.172) -- 0:02:24 345000 -- (-2345.310) (-2350.859) (-2351.925) [-2350.809] * (-2360.272) (-2353.372) [-2353.072] (-2349.825) -- 0:02:24 Average standard deviation of split frequencies: 0.011240 345500 -- (-2352.929) (-2354.679) [-2353.178] (-2357.669) * (-2355.892) [-2357.069] (-2356.985) (-2362.562) -- 0:02:23 346000 -- (-2350.404) (-2356.424) (-2354.377) [-2350.367] * (-2360.288) [-2353.356] (-2354.918) (-2356.263) -- 0:02:23 346500 -- (-2362.506) (-2359.790) (-2360.826) [-2354.149] * (-2353.736) [-2349.496] (-2354.328) (-2359.246) -- 0:02:25 347000 -- (-2360.302) [-2351.570] (-2362.967) (-2350.755) * (-2356.300) (-2356.482) [-2350.487] (-2355.567) -- 0:02:24 347500 -- (-2354.502) (-2348.388) [-2352.985] (-2349.226) * [-2354.907] (-2357.892) (-2350.662) (-2353.971) -- 0:02:24 348000 -- (-2357.108) [-2356.263] (-2350.932) (-2350.794) * (-2358.669) (-2360.088) [-2357.987] (-2359.386) -- 0:02:24 348500 -- (-2352.817) (-2355.106) [-2360.449] (-2351.370) * (-2355.025) (-2352.089) (-2353.305) [-2354.485] -- 0:02:23 349000 -- (-2353.831) (-2357.664) (-2363.371) [-2354.820] * (-2353.311) (-2353.725) (-2354.406) [-2351.075] -- 0:02:23 349500 -- (-2352.934) [-2355.603] (-2350.313) (-2354.729) * (-2362.859) [-2350.917] (-2352.278) (-2351.647) -- 0:02:23 350000 -- (-2358.293) (-2356.851) [-2356.444] (-2356.807) * (-2353.677) [-2348.358] (-2359.673) (-2351.274) -- 0:02:23 Average standard deviation of split frequencies: 0.008066 350500 -- [-2351.969] (-2354.260) (-2347.351) (-2350.089) * [-2351.337] (-2354.847) (-2360.002) (-2354.219) -- 0:02:22 351000 -- (-2355.529) (-2357.765) [-2355.300] (-2356.815) * (-2354.094) [-2356.893] (-2356.205) (-2357.110) -- 0:02:24 351500 -- (-2353.280) [-2355.110] (-2358.037) (-2357.408) * (-2355.994) (-2347.736) [-2349.256] (-2355.275) -- 0:02:23 352000 -- (-2352.926) (-2354.445) (-2353.544) [-2353.144] * (-2360.948) (-2357.903) (-2355.504) [-2361.281] -- 0:02:23 352500 -- [-2351.771] (-2356.247) (-2358.839) (-2357.167) * (-2353.224) (-2356.988) [-2351.121] (-2352.505) -- 0:02:23 353000 -- (-2350.716) [-2359.197] (-2354.781) (-2355.295) * (-2352.475) (-2355.528) (-2358.246) [-2356.016] -- 0:02:22 353500 -- (-2354.824) (-2358.853) (-2352.266) [-2346.738] * (-2353.681) [-2355.528] (-2354.932) (-2347.527) -- 0:02:22 354000 -- [-2354.781] (-2357.660) (-2354.315) (-2359.066) * [-2351.900] (-2353.860) (-2355.557) (-2351.772) -- 0:02:22 354500 -- (-2360.162) [-2358.876] (-2358.000) (-2353.447) * (-2353.119) (-2351.369) [-2348.943] (-2353.301) -- 0:02:22 355000 -- [-2355.373] (-2360.420) (-2360.229) (-2350.579) * (-2358.485) [-2351.983] (-2353.027) (-2349.723) -- 0:02:21 Average standard deviation of split frequencies: 0.007614 355500 -- (-2356.879) (-2362.334) (-2360.482) [-2356.291] * (-2347.427) (-2351.787) (-2352.509) [-2350.275] -- 0:02:23 356000 -- [-2351.478] (-2359.160) (-2360.382) (-2355.488) * (-2356.409) (-2360.095) [-2353.518] (-2355.695) -- 0:02:22 356500 -- (-2354.235) (-2357.102) [-2362.561] (-2353.639) * (-2355.079) [-2355.723] (-2360.537) (-2361.336) -- 0:02:22 357000 -- [-2352.228] (-2355.041) (-2355.349) (-2347.733) * (-2352.146) [-2357.537] (-2364.976) (-2358.079) -- 0:02:22 357500 -- (-2353.533) [-2353.157] (-2353.829) (-2355.640) * (-2356.965) (-2353.516) (-2354.227) [-2357.412] -- 0:02:21 358000 -- (-2356.162) [-2353.956] (-2354.186) (-2358.118) * (-2349.715) (-2359.977) [-2359.952] (-2356.754) -- 0:02:21 358500 -- [-2358.535] (-2357.397) (-2356.539) (-2352.838) * (-2356.130) [-2348.827] (-2353.496) (-2351.218) -- 0:02:21 359000 -- [-2352.709] (-2350.679) (-2350.631) (-2354.242) * (-2358.712) (-2351.110) (-2353.546) [-2351.455] -- 0:02:21 359500 -- (-2354.480) (-2354.612) [-2355.986] (-2350.202) * [-2349.343] (-2357.730) (-2354.215) (-2359.633) -- 0:02:20 360000 -- [-2352.318] (-2366.425) (-2357.247) (-2349.926) * (-2349.363) (-2349.881) [-2353.659] (-2354.412) -- 0:02:22 Average standard deviation of split frequencies: 0.005555 360500 -- (-2354.738) [-2361.697] (-2354.652) (-2358.661) * (-2359.699) (-2351.902) [-2351.355] (-2365.745) -- 0:02:21 361000 -- (-2354.747) (-2352.653) (-2362.302) [-2351.492] * [-2353.275] (-2359.502) (-2356.006) (-2350.535) -- 0:02:21 361500 -- (-2352.345) (-2354.763) (-2362.994) [-2359.740] * [-2356.006] (-2361.388) (-2355.815) (-2359.140) -- 0:02:21 362000 -- (-2362.395) (-2357.852) (-2359.599) [-2351.225] * [-2352.304] (-2364.598) (-2350.975) (-2362.055) -- 0:02:20 362500 -- (-2356.632) (-2366.569) (-2364.389) [-2350.927] * (-2359.405) (-2360.523) [-2348.430] (-2353.412) -- 0:02:20 363000 -- (-2362.289) (-2359.615) (-2361.346) [-2350.905] * [-2353.994] (-2353.132) (-2359.153) (-2351.407) -- 0:02:20 363500 -- (-2357.562) (-2355.096) [-2356.382] (-2350.756) * (-2360.046) [-2354.775] (-2351.828) (-2362.565) -- 0:02:20 364000 -- (-2354.928) [-2353.184] (-2355.068) (-2351.956) * [-2354.406] (-2352.789) (-2354.124) (-2355.253) -- 0:02:19 364500 -- [-2352.084] (-2353.446) (-2348.891) (-2359.009) * (-2351.337) (-2353.521) [-2355.901] (-2357.640) -- 0:02:21 365000 -- [-2352.863] (-2350.445) (-2353.324) (-2354.677) * (-2352.645) (-2351.626) [-2349.119] (-2346.906) -- 0:02:20 Average standard deviation of split frequencies: 0.007406 365500 -- (-2350.721) [-2350.998] (-2350.356) (-2353.576) * [-2349.444] (-2355.670) (-2351.657) (-2348.990) -- 0:02:20 366000 -- (-2356.350) [-2355.002] (-2349.688) (-2352.746) * (-2361.759) (-2355.369) (-2361.792) [-2354.761] -- 0:02:20 366500 -- (-2359.223) (-2357.894) [-2353.537] (-2361.292) * (-2358.401) (-2348.152) (-2357.242) [-2354.463] -- 0:02:20 367000 -- [-2351.576] (-2357.953) (-2364.169) (-2356.248) * [-2363.196] (-2348.426) (-2352.280) (-2350.622) -- 0:02:19 367500 -- (-2355.557) (-2352.854) [-2351.107] (-2351.201) * [-2357.778] (-2351.158) (-2353.006) (-2366.030) -- 0:02:19 368000 -- (-2353.603) [-2349.161] (-2356.825) (-2366.451) * (-2365.160) [-2351.670] (-2355.694) (-2353.930) -- 0:02:19 368500 -- [-2353.412] (-2348.697) (-2353.234) (-2353.272) * (-2355.856) (-2356.046) (-2348.676) [-2359.683] -- 0:02:18 369000 -- (-2369.220) (-2357.204) [-2356.941] (-2361.474) * (-2351.898) (-2361.906) [-2352.232] (-2359.432) -- 0:02:20 369500 -- (-2352.397) [-2353.693] (-2356.184) (-2352.549) * (-2360.971) [-2352.173] (-2351.645) (-2363.949) -- 0:02:19 370000 -- [-2352.094] (-2356.541) (-2358.565) (-2350.276) * (-2349.129) [-2358.576] (-2350.627) (-2357.761) -- 0:02:19 Average standard deviation of split frequencies: 0.006359 370500 -- (-2359.175) (-2355.993) [-2353.750] (-2349.074) * (-2357.197) [-2348.807] (-2362.134) (-2362.211) -- 0:02:19 371000 -- (-2353.296) (-2357.474) (-2355.371) [-2349.373] * (-2347.703) [-2353.543] (-2354.289) (-2348.033) -- 0:02:19 371500 -- (-2355.608) [-2350.079] (-2349.034) (-2354.716) * (-2348.102) (-2351.401) (-2354.977) [-2357.717] -- 0:02:18 372000 -- (-2356.619) (-2350.021) [-2355.395] (-2352.372) * (-2353.350) [-2354.066] (-2357.874) (-2355.953) -- 0:02:18 372500 -- (-2351.722) (-2347.153) (-2355.215) [-2350.472] * (-2359.575) [-2350.467] (-2356.908) (-2362.488) -- 0:02:18 373000 -- (-2348.982) [-2351.044] (-2358.672) (-2356.782) * [-2352.951] (-2353.249) (-2353.396) (-2350.390) -- 0:02:17 373500 -- (-2356.448) [-2348.972] (-2353.614) (-2353.231) * (-2349.414) [-2356.057] (-2354.195) (-2356.483) -- 0:02:19 374000 -- (-2355.697) (-2355.801) [-2347.376] (-2355.453) * (-2356.381) (-2354.798) [-2352.319] (-2356.762) -- 0:02:18 374500 -- (-2352.834) (-2356.315) [-2351.694] (-2353.336) * (-2359.202) [-2353.558] (-2361.039) (-2349.315) -- 0:02:18 375000 -- [-2350.430] (-2362.617) (-2349.615) (-2355.622) * (-2353.857) (-2363.028) (-2358.541) [-2352.988] -- 0:02:18 Average standard deviation of split frequencies: 0.007836 375500 -- (-2358.692) (-2351.655) [-2347.117] (-2359.545) * (-2352.507) (-2358.762) (-2360.117) [-2358.965] -- 0:02:18 376000 -- (-2350.467) (-2353.300) [-2353.617] (-2352.785) * (-2353.893) (-2355.485) (-2354.787) [-2349.745] -- 0:02:17 376500 -- (-2351.704) (-2354.451) (-2355.649) [-2357.014] * (-2352.504) (-2352.842) (-2358.427) [-2352.771] -- 0:02:17 377000 -- [-2356.394] (-2358.242) (-2356.259) (-2357.416) * (-2354.792) (-2353.568) (-2353.041) [-2345.704] -- 0:02:17 377500 -- [-2352.696] (-2357.629) (-2355.096) (-2351.438) * (-2355.277) [-2349.542] (-2356.114) (-2350.047) -- 0:02:16 378000 -- (-2352.360) [-2360.182] (-2356.890) (-2361.196) * (-2360.029) (-2352.832) [-2352.557] (-2354.215) -- 0:02:18 378500 -- [-2350.451] (-2361.279) (-2359.113) (-2353.145) * (-2355.724) (-2357.429) (-2352.741) [-2353.805] -- 0:02:17 379000 -- [-2354.757] (-2366.133) (-2352.379) (-2354.401) * (-2349.630) (-2351.285) [-2352.717] (-2364.898) -- 0:02:17 379500 -- [-2348.229] (-2361.555) (-2352.663) (-2350.398) * (-2353.765) (-2354.723) [-2352.643] (-2365.119) -- 0:02:17 380000 -- (-2353.909) (-2365.422) (-2353.482) [-2350.639] * (-2349.728) [-2354.415] (-2360.016) (-2353.236) -- 0:02:17 Average standard deviation of split frequencies: 0.008669 380500 -- (-2355.134) (-2357.407) (-2357.176) [-2353.574] * (-2355.879) [-2349.738] (-2351.719) (-2356.727) -- 0:02:16 381000 -- (-2358.962) [-2364.212] (-2362.188) (-2354.499) * (-2360.838) [-2352.636] (-2354.655) (-2357.701) -- 0:02:16 381500 -- [-2355.397] (-2361.658) (-2357.641) (-2354.654) * [-2353.596] (-2354.685) (-2359.374) (-2351.293) -- 0:02:17 382000 -- (-2353.877) (-2356.522) (-2350.848) [-2345.568] * [-2351.229] (-2353.246) (-2356.822) (-2351.554) -- 0:02:17 382500 -- (-2355.118) (-2358.450) [-2349.775] (-2350.897) * (-2351.083) [-2355.928] (-2351.145) (-2353.831) -- 0:02:17 383000 -- [-2354.923] (-2351.533) (-2351.836) (-2361.966) * (-2349.578) [-2350.299] (-2356.709) (-2355.680) -- 0:02:16 383500 -- (-2348.864) [-2349.066] (-2352.341) (-2355.786) * (-2350.919) (-2353.698) (-2347.856) [-2349.291] -- 0:02:16 384000 -- (-2352.856) (-2357.031) [-2359.473] (-2353.135) * (-2356.784) (-2353.934) [-2354.878] (-2350.922) -- 0:02:16 384500 -- [-2354.840] (-2354.362) (-2364.198) (-2355.682) * (-2355.479) (-2351.231) [-2347.521] (-2357.700) -- 0:02:16 385000 -- (-2355.767) (-2355.668) (-2356.782) [-2356.388] * (-2356.848) [-2353.683] (-2354.967) (-2346.011) -- 0:02:17 Average standard deviation of split frequencies: 0.007022 385500 -- (-2355.446) (-2363.643) (-2359.252) [-2350.326] * (-2349.940) (-2351.374) [-2358.822] (-2353.712) -- 0:02:17 386000 -- (-2351.978) [-2351.007] (-2354.167) (-2355.727) * [-2350.060] (-2355.793) (-2355.749) (-2352.620) -- 0:02:16 386500 -- [-2352.409] (-2356.755) (-2350.759) (-2351.988) * (-2354.307) (-2355.215) (-2365.431) [-2353.760] -- 0:02:16 387000 -- (-2355.026) (-2367.165) [-2355.778] (-2351.063) * (-2353.939) [-2350.914] (-2349.624) (-2358.397) -- 0:02:16 387500 -- (-2357.757) [-2353.410] (-2357.905) (-2351.231) * (-2350.976) (-2354.126) (-2355.886) [-2354.104] -- 0:02:15 388000 -- [-2350.796] (-2353.410) (-2352.239) (-2356.087) * (-2350.593) (-2351.871) (-2356.175) [-2351.457] -- 0:02:15 388500 -- (-2356.633) (-2351.349) (-2358.625) [-2349.952] * (-2350.719) [-2353.991] (-2364.898) (-2356.470) -- 0:02:15 389000 -- (-2351.084) (-2356.858) [-2349.016] (-2363.676) * (-2355.886) (-2356.450) (-2358.311) [-2355.788] -- 0:02:15 389500 -- (-2350.305) [-2349.205] (-2352.770) (-2350.075) * (-2349.359) (-2354.576) (-2361.101) [-2351.046] -- 0:02:16 390000 -- (-2349.808) (-2352.113) (-2353.525) [-2352.526] * (-2347.400) (-2353.463) [-2350.528] (-2354.701) -- 0:02:16 Average standard deviation of split frequencies: 0.006938 390500 -- [-2353.596] (-2352.372) (-2352.370) (-2355.406) * (-2347.187) (-2353.060) (-2346.887) [-2350.190] -- 0:02:15 391000 -- (-2356.386) [-2351.359] (-2351.443) (-2359.662) * (-2356.636) (-2368.667) [-2356.409] (-2362.428) -- 0:02:15 391500 -- (-2360.497) (-2349.240) (-2355.465) [-2349.545] * (-2353.980) (-2354.710) (-2361.244) [-2355.728] -- 0:02:15 392000 -- [-2355.639] (-2350.628) (-2349.932) (-2353.491) * (-2352.711) [-2349.613] (-2355.215) (-2355.883) -- 0:02:14 392500 -- (-2352.405) (-2355.670) (-2359.816) [-2361.264] * (-2354.114) [-2355.590] (-2357.609) (-2348.818) -- 0:02:14 393000 -- (-2350.246) [-2351.205] (-2349.468) (-2353.392) * (-2354.894) (-2355.463) (-2352.096) [-2356.743] -- 0:02:14 393500 -- (-2354.284) [-2351.038] (-2355.886) (-2349.980) * (-2360.698) [-2349.983] (-2359.848) (-2359.732) -- 0:02:14 394000 -- (-2350.167) [-2350.925] (-2351.551) (-2353.245) * (-2358.017) (-2354.994) (-2349.197) [-2354.648] -- 0:02:15 394500 -- [-2350.410] (-2350.866) (-2352.809) (-2353.225) * (-2365.139) (-2357.273) [-2355.038] (-2350.840) -- 0:02:15 395000 -- [-2347.117] (-2352.881) (-2358.591) (-2357.852) * (-2358.047) (-2351.754) [-2352.163] (-2354.898) -- 0:02:14 Average standard deviation of split frequencies: 0.006547 395500 -- (-2345.262) [-2360.872] (-2357.761) (-2348.985) * (-2354.364) (-2356.565) [-2356.343] (-2355.514) -- 0:02:14 396000 -- [-2354.598] (-2357.000) (-2358.119) (-2361.402) * (-2359.986) [-2354.106] (-2349.582) (-2352.991) -- 0:02:14 396500 -- (-2352.747) (-2356.776) [-2353.959] (-2354.286) * [-2352.412] (-2352.354) (-2358.623) (-2355.739) -- 0:02:13 397000 -- [-2355.795] (-2356.052) (-2355.649) (-2355.228) * [-2354.464] (-2356.161) (-2355.520) (-2361.334) -- 0:02:13 397500 -- (-2365.088) (-2354.418) [-2354.679] (-2351.759) * (-2357.375) (-2360.267) [-2354.132] (-2352.418) -- 0:02:13 398000 -- (-2356.712) [-2356.394] (-2350.702) (-2349.896) * (-2352.553) (-2355.380) (-2351.923) [-2352.353] -- 0:02:14 398500 -- (-2356.382) (-2356.217) [-2353.311] (-2350.153) * (-2352.039) (-2355.960) [-2351.281] (-2353.034) -- 0:02:14 399000 -- (-2351.726) (-2354.438) (-2354.539) [-2349.621] * (-2355.157) [-2356.627] (-2364.725) (-2349.193) -- 0:02:14 399500 -- [-2350.715] (-2355.359) (-2356.620) (-2355.143) * (-2359.295) (-2353.978) [-2358.326] (-2352.571) -- 0:02:13 400000 -- (-2353.633) (-2351.899) (-2354.270) [-2353.387] * [-2349.380] (-2358.453) (-2352.516) (-2361.579) -- 0:02:13 Average standard deviation of split frequencies: 0.006471 400500 -- [-2354.390] (-2352.848) (-2348.711) (-2356.420) * (-2351.647) [-2352.113] (-2358.016) (-2355.554) -- 0:02:13 401000 -- (-2360.964) (-2355.053) (-2353.222) [-2350.214] * (-2360.928) (-2360.681) (-2355.339) [-2356.929] -- 0:02:12 401500 -- [-2350.004] (-2351.658) (-2352.714) (-2348.811) * [-2351.045] (-2351.465) (-2362.701) (-2350.189) -- 0:02:12 402000 -- (-2359.119) (-2355.424) (-2352.602) [-2349.176] * [-2347.326] (-2353.161) (-2350.196) (-2353.488) -- 0:02:13 402500 -- [-2352.537] (-2348.261) (-2354.937) (-2352.745) * [-2356.917] (-2352.024) (-2358.190) (-2358.388) -- 0:02:13 403000 -- (-2356.734) (-2356.680) (-2358.729) [-2353.932] * (-2351.052) (-2356.778) [-2352.332] (-2352.197) -- 0:02:13 403500 -- (-2361.494) (-2349.728) (-2351.295) [-2350.235] * (-2353.521) (-2352.384) (-2357.658) [-2351.053] -- 0:02:13 404000 -- (-2360.691) (-2357.870) [-2352.184] (-2352.262) * (-2369.698) (-2357.311) (-2354.122) [-2357.312] -- 0:02:12 404500 -- (-2350.264) [-2357.538] (-2355.771) (-2351.033) * [-2352.754] (-2353.300) (-2352.388) (-2345.770) -- 0:02:12 405000 -- (-2355.423) (-2359.527) [-2354.657] (-2369.871) * [-2354.683] (-2357.836) (-2356.431) (-2352.811) -- 0:02:12 Average standard deviation of split frequencies: 0.006676 405500 -- (-2353.021) [-2351.933] (-2367.089) (-2364.500) * (-2352.678) (-2351.949) (-2362.939) [-2348.174] -- 0:02:13 406000 -- (-2350.643) [-2350.908] (-2360.025) (-2356.544) * [-2349.709] (-2355.506) (-2353.362) (-2359.980) -- 0:02:13 406500 -- (-2349.199) (-2352.190) (-2359.964) [-2356.064] * (-2353.155) [-2351.896] (-2353.666) (-2355.716) -- 0:02:12 407000 -- (-2354.482) (-2354.612) [-2354.498] (-2352.723) * [-2356.523] (-2352.710) (-2361.629) (-2358.889) -- 0:02:12 407500 -- (-2352.257) [-2365.345] (-2353.434) (-2355.428) * [-2349.837] (-2356.795) (-2355.477) (-2353.227) -- 0:02:12 408000 -- (-2360.175) (-2351.820) [-2349.707] (-2359.192) * (-2350.897) (-2354.704) [-2355.590] (-2365.545) -- 0:02:12 408500 -- (-2365.066) (-2349.948) [-2354.994] (-2353.756) * [-2351.509] (-2362.855) (-2352.150) (-2351.628) -- 0:02:11 409000 -- (-2354.919) [-2348.805] (-2350.756) (-2349.863) * (-2350.207) (-2355.354) [-2349.807] (-2354.562) -- 0:02:11 409500 -- (-2357.656) [-2352.437] (-2352.471) (-2346.691) * (-2354.861) [-2356.965] (-2352.128) (-2355.370) -- 0:02:11 410000 -- (-2357.746) [-2354.243] (-2354.066) (-2350.829) * (-2358.211) [-2349.638] (-2354.036) (-2348.050) -- 0:02:12 Average standard deviation of split frequencies: 0.004305 410500 -- (-2362.492) (-2358.903) (-2355.813) [-2349.372] * [-2352.526] (-2352.472) (-2358.340) (-2350.850) -- 0:02:12 411000 -- (-2352.442) (-2353.465) (-2356.372) [-2356.611] * [-2357.672] (-2354.244) (-2354.579) (-2350.897) -- 0:02:11 411500 -- (-2358.702) [-2348.136] (-2362.798) (-2358.383) * (-2350.924) (-2351.240) [-2353.616] (-2365.717) -- 0:02:11 412000 -- (-2350.555) (-2350.284) (-2355.669) [-2352.281] * (-2354.874) (-2352.655) [-2353.497] (-2354.744) -- 0:02:11 412500 -- (-2355.148) [-2347.411] (-2366.282) (-2356.115) * (-2352.812) (-2353.415) [-2354.904] (-2354.769) -- 0:02:11 413000 -- [-2348.886] (-2351.290) (-2361.403) (-2351.661) * [-2348.640] (-2359.381) (-2355.637) (-2365.350) -- 0:02:10 413500 -- (-2355.703) (-2354.520) (-2356.949) [-2351.766] * (-2354.244) [-2352.530] (-2350.447) (-2352.682) -- 0:02:10 414000 -- (-2359.780) (-2353.830) (-2353.748) [-2360.912] * (-2353.311) (-2353.440) (-2350.982) [-2353.971] -- 0:02:10 414500 -- (-2353.257) (-2356.224) [-2349.609] (-2358.047) * [-2360.031] (-2349.233) (-2346.836) (-2362.492) -- 0:02:11 415000 -- (-2348.577) (-2354.887) (-2349.193) [-2355.754] * (-2358.828) (-2354.030) [-2349.338] (-2357.333) -- 0:02:11 Average standard deviation of split frequencies: 0.004533 415500 -- (-2353.087) (-2358.796) (-2355.550) [-2358.930] * (-2355.173) (-2352.125) (-2351.341) [-2347.649] -- 0:02:10 416000 -- (-2360.547) (-2355.212) (-2355.390) [-2349.357] * (-2355.471) [-2353.212] (-2363.123) (-2354.745) -- 0:02:10 416500 -- (-2353.706) [-2352.964] (-2350.599) (-2351.437) * (-2355.828) (-2355.248) [-2356.884] (-2351.229) -- 0:02:10 417000 -- (-2353.105) [-2349.435] (-2353.431) (-2349.875) * (-2348.782) (-2356.766) (-2350.325) [-2357.058] -- 0:02:10 417500 -- (-2355.181) [-2354.675] (-2360.736) (-2356.136) * [-2359.872] (-2351.496) (-2355.176) (-2357.159) -- 0:02:09 418000 -- (-2350.002) (-2353.196) (-2353.353) [-2352.848] * (-2356.086) (-2356.375) [-2354.627] (-2351.232) -- 0:02:09 418500 -- (-2354.273) (-2355.807) (-2356.862) [-2347.623] * (-2356.524) [-2347.935] (-2350.860) (-2351.443) -- 0:02:10 419000 -- (-2346.351) [-2357.265] (-2361.710) (-2354.780) * [-2355.412] (-2349.674) (-2350.580) (-2349.214) -- 0:02:10 419500 -- (-2350.130) (-2355.447) (-2354.870) [-2351.775] * (-2358.726) (-2359.697) (-2350.836) [-2350.902] -- 0:02:10 420000 -- (-2349.633) (-2367.218) [-2361.482] (-2351.656) * [-2354.502] (-2355.100) (-2346.028) (-2349.262) -- 0:02:09 Average standard deviation of split frequencies: 0.004202 420500 -- (-2366.472) [-2354.907] (-2355.916) (-2352.921) * (-2352.435) (-2355.835) [-2353.570] (-2351.057) -- 0:02:09 421000 -- [-2352.961] (-2353.709) (-2353.010) (-2349.043) * (-2354.295) (-2351.214) (-2356.079) [-2351.938] -- 0:02:09 421500 -- [-2353.568] (-2355.306) (-2361.869) (-2350.356) * (-2349.746) (-2353.924) (-2354.341) [-2352.783] -- 0:02:09 422000 -- (-2360.842) [-2354.006] (-2353.777) (-2353.140) * [-2351.151] (-2354.273) (-2354.966) (-2355.778) -- 0:02:08 422500 -- (-2357.266) [-2351.478] (-2352.069) (-2357.041) * (-2354.445) (-2356.874) (-2352.142) [-2353.636] -- 0:02:08 423000 -- [-2353.521] (-2354.480) (-2349.750) (-2356.981) * (-2358.811) (-2357.433) [-2348.436] (-2358.322) -- 0:02:09 423500 -- (-2355.112) [-2353.883] (-2351.747) (-2357.586) * (-2354.874) (-2348.734) [-2354.920] (-2350.132) -- 0:02:09 424000 -- (-2350.506) (-2353.589) [-2354.171] (-2351.749) * (-2351.280) (-2352.561) [-2356.425] (-2350.278) -- 0:02:09 424500 -- (-2352.063) (-2349.949) (-2353.072) [-2353.683] * [-2350.350] (-2353.588) (-2362.960) (-2353.469) -- 0:02:08 425000 -- [-2350.137] (-2354.985) (-2348.891) (-2358.086) * [-2356.750] (-2351.529) (-2372.896) (-2351.896) -- 0:02:08 Average standard deviation of split frequencies: 0.003596 425500 -- (-2352.944) (-2351.951) (-2349.636) [-2356.642] * (-2354.851) [-2350.716] (-2350.992) (-2354.672) -- 0:02:08 426000 -- (-2350.191) [-2356.375] (-2352.695) (-2360.920) * (-2348.618) (-2359.268) (-2355.262) [-2350.521] -- 0:02:08 426500 -- (-2350.058) (-2352.380) (-2360.162) [-2351.027] * (-2354.461) [-2351.704] (-2362.004) (-2355.482) -- 0:02:07 427000 -- [-2348.845] (-2357.176) (-2359.086) (-2357.449) * (-2350.960) [-2350.544] (-2361.926) (-2353.470) -- 0:02:07 427500 -- [-2350.949] (-2355.449) (-2364.314) (-2351.764) * (-2354.663) (-2356.708) (-2358.509) [-2357.807] -- 0:02:08 428000 -- (-2349.775) [-2351.013] (-2353.685) (-2350.925) * [-2348.476] (-2356.389) (-2359.648) (-2354.278) -- 0:02:08 428500 -- (-2352.815) (-2354.988) [-2352.606] (-2356.496) * [-2352.825] (-2355.531) (-2353.834) (-2356.108) -- 0:02:08 429000 -- (-2350.662) [-2362.900] (-2353.126) (-2357.519) * [-2354.944] (-2356.746) (-2358.195) (-2365.260) -- 0:02:07 429500 -- (-2361.276) (-2361.455) (-2351.079) [-2353.894] * (-2358.516) (-2351.547) [-2353.239] (-2348.140) -- 0:02:07 430000 -- (-2350.094) (-2352.304) (-2355.113) [-2356.862] * (-2353.762) [-2351.721] (-2361.464) (-2346.121) -- 0:02:07 Average standard deviation of split frequencies: 0.004105 430500 -- (-2348.931) [-2360.108] (-2352.143) (-2350.851) * (-2363.642) (-2351.163) (-2355.617) [-2347.956] -- 0:02:06 431000 -- (-2353.499) (-2361.593) (-2352.918) [-2354.094] * (-2355.414) (-2358.812) (-2351.598) [-2353.647] -- 0:02:06 431500 -- (-2355.731) (-2358.298) (-2354.683) [-2353.779] * [-2357.854] (-2359.161) (-2353.316) (-2356.202) -- 0:02:06 432000 -- [-2352.084] (-2351.112) (-2362.615) (-2356.162) * (-2350.819) (-2356.403) (-2353.370) [-2350.881] -- 0:02:07 432500 -- (-2359.346) [-2349.254] (-2357.812) (-2350.935) * (-2366.219) [-2355.872] (-2355.145) (-2350.799) -- 0:02:07 433000 -- (-2359.503) (-2352.896) [-2353.563] (-2355.126) * (-2353.771) [-2351.912] (-2353.116) (-2350.206) -- 0:02:07 433500 -- (-2360.439) [-2355.775] (-2353.350) (-2360.869) * (-2357.166) [-2354.310] (-2353.769) (-2353.395) -- 0:02:06 434000 -- (-2350.643) [-2357.937] (-2345.676) (-2357.339) * [-2356.155] (-2353.901) (-2362.303) (-2359.865) -- 0:02:06 434500 -- [-2352.056] (-2354.384) (-2355.401) (-2350.914) * (-2360.951) [-2361.763] (-2366.536) (-2349.133) -- 0:02:06 435000 -- [-2351.623] (-2353.822) (-2352.608) (-2365.046) * (-2350.580) (-2355.164) (-2357.551) [-2350.695] -- 0:02:05 Average standard deviation of split frequencies: 0.005406 435500 -- (-2352.492) [-2349.984] (-2351.433) (-2355.335) * (-2354.652) (-2357.070) [-2358.720] (-2353.403) -- 0:02:05 436000 -- [-2347.659] (-2349.394) (-2354.127) (-2356.306) * (-2352.284) (-2361.400) [-2353.846] (-2354.504) -- 0:02:05 436500 -- [-2355.615] (-2353.404) (-2349.113) (-2355.929) * [-2361.393] (-2351.580) (-2353.515) (-2350.690) -- 0:02:06 437000 -- [-2351.840] (-2354.723) (-2353.038) (-2353.864) * (-2355.107) (-2350.090) [-2352.222] (-2357.277) -- 0:02:06 437500 -- [-2353.150] (-2356.519) (-2352.023) (-2354.210) * (-2353.833) (-2357.486) (-2347.386) [-2352.880] -- 0:02:06 438000 -- (-2354.845) [-2356.973] (-2349.399) (-2353.985) * (-2352.149) (-2360.215) (-2357.930) [-2351.273] -- 0:02:05 438500 -- (-2355.935) [-2351.615] (-2350.864) (-2357.057) * [-2354.536] (-2361.278) (-2364.030) (-2356.328) -- 0:02:05 439000 -- [-2352.319] (-2356.914) (-2351.309) (-2355.908) * (-2354.996) [-2353.133] (-2358.970) (-2351.550) -- 0:02:05 439500 -- (-2358.071) (-2361.899) (-2350.076) [-2352.528] * [-2352.426] (-2354.483) (-2356.227) (-2354.937) -- 0:02:04 440000 -- [-2352.681] (-2353.255) (-2358.516) (-2353.855) * [-2354.460] (-2358.435) (-2363.163) (-2356.818) -- 0:02:04 Average standard deviation of split frequencies: 0.005349 440500 -- [-2350.410] (-2355.398) (-2353.170) (-2356.207) * (-2355.330) (-2350.891) (-2356.357) [-2349.917] -- 0:02:04 441000 -- [-2354.660] (-2350.691) (-2360.420) (-2353.019) * [-2352.941] (-2358.317) (-2358.123) (-2359.231) -- 0:02:05 441500 -- (-2351.354) (-2348.587) (-2361.871) [-2347.690] * [-2353.784] (-2349.996) (-2356.651) (-2353.543) -- 0:02:05 442000 -- [-2353.205] (-2355.049) (-2358.645) (-2350.487) * (-2355.557) [-2358.596] (-2350.456) (-2364.755) -- 0:02:04 442500 -- (-2348.436) (-2357.965) [-2348.899] (-2355.718) * (-2354.846) (-2357.490) (-2350.355) [-2353.793] -- 0:02:04 443000 -- (-2353.629) (-2360.476) [-2353.614] (-2360.631) * (-2358.130) [-2357.693] (-2355.821) (-2361.358) -- 0:02:04 443500 -- (-2359.755) (-2356.044) [-2355.604] (-2355.957) * [-2354.205] (-2356.475) (-2355.881) (-2355.775) -- 0:02:04 444000 -- (-2358.086) (-2352.416) [-2348.941] (-2353.910) * [-2350.804] (-2354.798) (-2353.179) (-2361.126) -- 0:02:03 444500 -- [-2349.966] (-2364.972) (-2351.081) (-2367.953) * (-2355.889) [-2357.839] (-2350.705) (-2359.651) -- 0:02:03 445000 -- (-2350.399) (-2351.393) (-2352.156) [-2353.763] * (-2362.573) (-2356.073) (-2351.164) [-2353.535] -- 0:02:04 Average standard deviation of split frequencies: 0.005813 445500 -- (-2354.809) (-2350.731) (-2350.154) [-2355.360] * (-2355.706) (-2355.281) [-2355.978] (-2351.971) -- 0:02:04 446000 -- [-2348.383] (-2355.187) (-2353.232) (-2353.449) * (-2351.428) (-2355.758) [-2353.359] (-2348.819) -- 0:02:04 446500 -- (-2354.306) (-2356.296) [-2352.923] (-2365.812) * [-2347.976] (-2352.561) (-2358.157) (-2350.019) -- 0:02:03 447000 -- (-2355.916) [-2349.824] (-2351.869) (-2349.123) * (-2352.164) (-2359.822) (-2359.652) [-2353.732] -- 0:02:03 447500 -- (-2360.797) [-2353.686] (-2364.360) (-2350.767) * (-2351.896) (-2351.730) (-2366.813) [-2353.106] -- 0:02:03 448000 -- [-2353.903] (-2352.758) (-2362.422) (-2359.367) * (-2359.017) (-2359.161) (-2363.944) [-2354.641] -- 0:02:03 448500 -- [-2355.076] (-2350.719) (-2356.395) (-2354.150) * [-2352.093] (-2360.297) (-2366.043) (-2356.531) -- 0:02:04 449000 -- (-2355.424) (-2355.003) (-2350.760) [-2355.783] * (-2355.723) [-2353.601] (-2360.293) (-2358.374) -- 0:02:03 449500 -- [-2356.885] (-2364.658) (-2356.392) (-2351.386) * (-2348.896) (-2366.572) [-2358.592] (-2359.966) -- 0:02:03 450000 -- (-2350.041) (-2362.170) [-2351.122] (-2353.028) * (-2352.700) (-2356.367) (-2352.588) [-2349.911] -- 0:02:03 Average standard deviation of split frequencies: 0.005230 450500 -- (-2352.948) (-2351.622) (-2353.409) [-2352.473] * (-2353.434) [-2352.461] (-2355.415) (-2348.327) -- 0:02:03 451000 -- [-2351.080] (-2349.969) (-2356.894) (-2354.969) * (-2358.290) [-2354.760] (-2348.158) (-2361.317) -- 0:02:02 451500 -- (-2352.873) (-2350.220) (-2360.291) [-2361.462] * (-2355.695) (-2353.413) [-2348.318] (-2354.897) -- 0:02:02 452000 -- [-2350.342] (-2357.015) (-2350.909) (-2354.641) * (-2359.388) (-2354.496) (-2356.170) [-2354.674] -- 0:02:02 452500 -- (-2356.991) (-2355.122) (-2359.043) [-2353.077] * (-2357.035) (-2354.932) [-2352.387] (-2351.782) -- 0:02:03 453000 -- (-2354.366) (-2357.386) [-2350.116] (-2350.161) * (-2359.136) (-2362.098) [-2351.955] (-2352.959) -- 0:02:03 453500 -- (-2354.117) [-2350.964] (-2358.985) (-2348.664) * [-2352.082] (-2356.433) (-2346.930) (-2350.937) -- 0:02:02 454000 -- (-2354.931) (-2351.265) [-2350.735] (-2356.762) * (-2351.103) (-2364.549) [-2351.722] (-2355.101) -- 0:02:02 454500 -- (-2355.414) (-2347.157) (-2361.442) [-2353.666] * (-2356.416) (-2355.383) (-2350.061) [-2346.109] -- 0:02:02 455000 -- (-2357.771) (-2353.582) [-2347.719] (-2357.898) * (-2354.355) (-2358.688) (-2355.119) [-2355.695] -- 0:02:02 Average standard deviation of split frequencies: 0.004910 455500 -- [-2357.566] (-2356.324) (-2353.499) (-2354.659) * [-2356.610] (-2356.012) (-2354.683) (-2358.916) -- 0:02:01 456000 -- (-2356.396) (-2359.392) (-2353.682) [-2347.186] * (-2354.602) [-2353.651] (-2360.656) (-2354.150) -- 0:02:01 456500 -- (-2357.481) (-2351.934) [-2348.806] (-2352.165) * (-2355.061) [-2355.524] (-2353.170) (-2350.801) -- 0:02:02 457000 -- [-2348.935] (-2352.820) (-2353.471) (-2346.428) * (-2360.311) (-2350.512) [-2363.102] (-2349.791) -- 0:02:02 457500 -- [-2352.109] (-2354.913) (-2359.093) (-2345.445) * (-2346.297) (-2353.316) (-2357.649) [-2353.490] -- 0:02:02 458000 -- [-2351.950] (-2358.501) (-2353.849) (-2350.741) * (-2354.733) (-2352.106) [-2356.805] (-2356.069) -- 0:02:01 458500 -- [-2356.513] (-2356.248) (-2349.915) (-2354.499) * (-2361.015) [-2361.831] (-2362.415) (-2351.674) -- 0:02:01 459000 -- [-2352.602] (-2361.851) (-2356.909) (-2351.434) * (-2353.805) (-2354.029) (-2359.932) [-2353.563] -- 0:02:01 459500 -- (-2357.109) [-2351.074] (-2357.349) (-2356.054) * (-2358.100) [-2351.088] (-2355.939) (-2349.147) -- 0:02:01 460000 -- (-2356.380) [-2352.000] (-2356.443) (-2356.777) * (-2360.150) [-2356.050] (-2358.525) (-2366.560) -- 0:02:00 Average standard deviation of split frequencies: 0.004605 460500 -- [-2354.551] (-2349.570) (-2349.719) (-2353.418) * (-2360.520) (-2357.516) (-2356.166) [-2349.192] -- 0:02:00 461000 -- (-2348.775) (-2350.742) (-2362.693) [-2350.140] * (-2361.100) [-2354.007] (-2352.791) (-2360.446) -- 0:02:01 461500 -- (-2356.166) [-2347.910] (-2357.149) (-2349.091) * (-2357.906) [-2351.329] (-2357.130) (-2359.042) -- 0:02:01 462000 -- (-2346.809) (-2347.902) [-2359.966] (-2348.806) * (-2353.596) (-2352.378) (-2352.014) [-2352.985] -- 0:02:01 462500 -- (-2352.649) [-2344.771] (-2355.129) (-2354.592) * (-2356.560) [-2355.058] (-2365.767) (-2351.004) -- 0:02:00 463000 -- (-2356.552) [-2357.964] (-2354.262) (-2354.830) * (-2354.923) [-2357.596] (-2352.100) (-2362.645) -- 0:02:00 463500 -- (-2356.816) (-2354.334) [-2348.083] (-2356.155) * (-2351.842) (-2360.955) [-2357.571] (-2352.146) -- 0:02:00 464000 -- (-2356.192) [-2352.260] (-2347.017) (-2355.752) * (-2348.633) (-2361.534) [-2350.568] (-2352.145) -- 0:02:00 464500 -- [-2356.215] (-2354.398) (-2354.521) (-2353.647) * [-2357.303] (-2351.840) (-2361.957) (-2358.570) -- 0:01:59 465000 -- (-2349.789) (-2360.987) (-2352.374) [-2351.673] * (-2352.976) (-2359.016) [-2356.245] (-2353.402) -- 0:01:59 Average standard deviation of split frequencies: 0.002529 465500 -- [-2352.781] (-2352.582) (-2351.806) (-2350.600) * (-2357.813) (-2354.148) (-2358.514) [-2359.751] -- 0:02:00 466000 -- [-2352.977] (-2347.404) (-2355.744) (-2354.057) * (-2358.364) (-2349.501) [-2349.709] (-2354.494) -- 0:02:00 466500 -- [-2352.276] (-2354.623) (-2349.226) (-2354.158) * (-2352.476) [-2354.335] (-2356.603) (-2353.253) -- 0:02:00 467000 -- (-2360.443) [-2361.960] (-2354.480) (-2354.367) * [-2358.296] (-2360.474) (-2356.731) (-2363.981) -- 0:01:59 467500 -- (-2360.624) [-2352.526] (-2353.018) (-2357.869) * (-2351.282) [-2352.942] (-2354.295) (-2353.319) -- 0:01:59 468000 -- (-2352.274) (-2355.038) [-2357.446] (-2350.413) * [-2355.492] (-2354.077) (-2357.690) (-2355.413) -- 0:01:59 468500 -- (-2359.843) (-2359.791) [-2359.707] (-2350.099) * [-2358.703] (-2354.227) (-2357.153) (-2358.635) -- 0:01:59 469000 -- (-2358.365) [-2351.128] (-2355.812) (-2359.070) * (-2353.295) (-2352.565) (-2355.354) [-2358.879] -- 0:01:58 469500 -- (-2357.557) (-2354.067) [-2357.186] (-2356.178) * (-2348.489) (-2357.231) (-2351.232) [-2353.391] -- 0:01:58 470000 -- (-2352.709) (-2351.024) (-2351.953) [-2351.548] * (-2354.819) [-2357.350] (-2358.863) (-2360.259) -- 0:01:59 Average standard deviation of split frequencies: 0.002504 470500 -- (-2362.590) (-2353.414) [-2355.464] (-2356.676) * (-2355.042) (-2352.984) (-2355.483) [-2356.344] -- 0:01:59 471000 -- (-2356.892) (-2352.578) (-2349.942) [-2352.347] * (-2360.044) [-2350.643] (-2355.162) (-2365.193) -- 0:01:59 471500 -- (-2353.860) (-2353.659) [-2352.645] (-2355.646) * (-2365.553) (-2356.086) [-2353.548] (-2356.047) -- 0:01:58 472000 -- [-2351.580] (-2351.585) (-2356.311) (-2354.152) * (-2360.495) (-2351.650) (-2355.648) [-2358.669] -- 0:01:58 472500 -- (-2358.510) (-2357.384) [-2353.723] (-2355.737) * [-2351.602] (-2351.940) (-2352.698) (-2358.938) -- 0:01:58 473000 -- [-2356.809] (-2358.793) (-2353.972) (-2355.711) * (-2361.358) [-2355.927] (-2355.057) (-2354.290) -- 0:01:58 473500 -- [-2360.468] (-2362.143) (-2348.308) (-2360.571) * (-2367.923) (-2353.481) [-2357.089] (-2362.119) -- 0:01:57 474000 -- (-2354.823) (-2358.209) [-2346.267] (-2357.226) * (-2355.459) [-2352.301] (-2351.066) (-2349.949) -- 0:01:57 474500 -- (-2350.759) (-2352.562) (-2362.325) [-2361.000] * (-2358.295) [-2348.291] (-2353.089) (-2352.893) -- 0:01:58 475000 -- (-2362.663) (-2352.233) [-2356.694] (-2355.721) * (-2355.056) (-2352.520) (-2350.599) [-2353.426] -- 0:01:58 Average standard deviation of split frequencies: 0.001981 475500 -- (-2353.089) (-2357.831) (-2351.830) [-2350.272] * (-2361.784) [-2347.815] (-2357.163) (-2359.655) -- 0:01:58 476000 -- (-2351.940) (-2357.999) (-2363.565) [-2352.013] * (-2353.360) (-2348.060) (-2359.459) [-2351.155] -- 0:01:57 476500 -- (-2354.849) (-2363.522) [-2356.682] (-2348.267) * (-2362.090) (-2363.422) (-2357.361) [-2362.207] -- 0:01:57 477000 -- (-2352.806) (-2362.118) (-2358.894) [-2352.228] * [-2356.424] (-2357.453) (-2361.560) (-2357.740) -- 0:01:57 477500 -- [-2356.761] (-2354.518) (-2360.225) (-2355.352) * (-2354.866) (-2353.199) (-2357.424) [-2351.366] -- 0:01:57 478000 -- (-2351.565) (-2349.746) (-2357.240) [-2364.800] * (-2353.820) (-2354.680) (-2361.651) [-2348.788] -- 0:01:56 478500 -- (-2351.622) [-2356.070] (-2353.585) (-2356.188) * (-2358.910) (-2356.109) [-2354.477] (-2350.472) -- 0:01:56 479000 -- [-2354.689] (-2356.127) (-2353.890) (-2355.712) * (-2354.286) [-2346.047] (-2352.494) (-2357.517) -- 0:01:57 479500 -- [-2354.708] (-2357.504) (-2353.181) (-2366.203) * [-2348.107] (-2356.027) (-2352.212) (-2349.727) -- 0:01:57 480000 -- (-2359.838) (-2355.798) (-2358.387) [-2356.907] * (-2361.346) (-2350.898) (-2352.102) [-2357.815] -- 0:01:57 Average standard deviation of split frequencies: 0.001961 480500 -- (-2361.058) (-2354.622) [-2356.990] (-2362.887) * (-2360.846) (-2354.695) [-2350.832] (-2366.904) -- 0:01:56 481000 -- [-2359.180] (-2352.728) (-2349.627) (-2353.677) * (-2350.869) (-2353.106) [-2350.799] (-2351.667) -- 0:01:56 481500 -- [-2361.226] (-2352.720) (-2351.911) (-2355.116) * (-2351.685) (-2355.608) (-2350.247) [-2353.283] -- 0:01:56 482000 -- (-2363.571) (-2355.814) [-2359.988] (-2354.775) * (-2357.432) [-2353.902] (-2356.226) (-2351.906) -- 0:01:56 482500 -- (-2358.711) (-2359.369) (-2358.054) [-2352.141] * (-2357.797) [-2353.868] (-2357.190) (-2351.146) -- 0:01:55 483000 -- (-2352.753) [-2355.365] (-2358.167) (-2352.727) * (-2360.592) (-2358.261) (-2360.631) [-2356.941] -- 0:01:55 483500 -- (-2349.273) [-2352.010] (-2355.613) (-2353.618) * [-2356.480] (-2349.847) (-2352.910) (-2357.551) -- 0:01:56 484000 -- (-2361.586) (-2352.020) (-2353.717) [-2351.638] * (-2355.314) (-2357.848) [-2360.262] (-2352.742) -- 0:01:56 484500 -- (-2352.204) (-2365.014) (-2348.849) [-2349.616] * (-2356.466) (-2348.352) (-2356.866) [-2349.444] -- 0:01:55 485000 -- (-2353.769) [-2348.879] (-2347.682) (-2350.687) * (-2352.262) [-2349.227] (-2356.476) (-2353.935) -- 0:01:55 Average standard deviation of split frequencies: 0.001697 485500 -- [-2351.500] (-2356.277) (-2354.561) (-2351.730) * [-2353.152] (-2352.201) (-2357.293) (-2360.812) -- 0:01:55 486000 -- [-2349.546] (-2361.607) (-2361.997) (-2349.025) * (-2353.837) [-2352.325] (-2361.158) (-2356.007) -- 0:01:55 486500 -- [-2352.099] (-2355.041) (-2354.875) (-2353.053) * (-2351.251) (-2354.288) (-2353.099) [-2358.888] -- 0:01:55 487000 -- (-2349.617) (-2349.593) [-2351.246] (-2360.036) * [-2350.679] (-2352.152) (-2356.153) (-2355.597) -- 0:01:54 487500 -- (-2354.648) [-2356.878] (-2353.879) (-2366.223) * (-2352.132) (-2351.464) [-2355.574] (-2364.335) -- 0:01:54 488000 -- [-2354.672] (-2360.060) (-2350.778) (-2350.942) * [-2353.274] (-2349.126) (-2351.785) (-2361.138) -- 0:01:55 488500 -- (-2356.487) [-2361.903] (-2354.006) (-2365.679) * (-2354.807) (-2351.427) [-2353.753] (-2353.887) -- 0:01:55 489000 -- [-2355.677] (-2361.018) (-2351.748) (-2358.619) * [-2362.938] (-2351.272) (-2363.292) (-2353.296) -- 0:01:54 489500 -- (-2357.864) (-2353.546) (-2354.123) [-2355.214] * (-2350.070) (-2351.943) (-2356.093) [-2354.267] -- 0:01:54 490000 -- (-2351.758) (-2362.185) [-2345.553] (-2347.995) * (-2358.249) [-2354.922] (-2359.401) (-2351.577) -- 0:01:54 Average standard deviation of split frequencies: 0.001441 490500 -- [-2354.054] (-2353.407) (-2351.545) (-2355.231) * [-2353.814] (-2356.870) (-2352.061) (-2352.623) -- 0:01:54 491000 -- (-2352.155) [-2351.119] (-2357.426) (-2351.588) * (-2360.638) (-2351.849) [-2354.515] (-2353.521) -- 0:01:54 491500 -- (-2347.863) (-2354.769) (-2351.551) [-2353.425] * (-2357.569) (-2353.740) (-2349.848) [-2353.319] -- 0:01:53 492000 -- [-2353.250] (-2354.865) (-2358.441) (-2359.127) * (-2355.433) (-2354.697) [-2352.516] (-2357.834) -- 0:01:53 492500 -- [-2349.248] (-2354.862) (-2356.591) (-2360.260) * [-2356.350] (-2352.064) (-2357.387) (-2355.871) -- 0:01:54 493000 -- (-2347.488) [-2360.145] (-2357.853) (-2352.899) * (-2359.526) (-2352.053) [-2350.607] (-2360.327) -- 0:01:54 493500 -- (-2355.028) (-2349.797) [-2350.382] (-2356.079) * [-2359.444] (-2349.534) (-2354.886) (-2358.699) -- 0:01:53 494000 -- (-2358.968) (-2352.764) (-2350.660) [-2347.869] * (-2355.470) (-2355.277) [-2351.985] (-2351.871) -- 0:01:53 494500 -- [-2355.395] (-2362.108) (-2345.273) (-2352.121) * (-2359.766) (-2363.614) (-2350.094) [-2351.799] -- 0:01:53 495000 -- [-2351.847] (-2359.655) (-2352.597) (-2352.321) * (-2350.895) [-2356.422] (-2356.918) (-2358.804) -- 0:01:53 Average standard deviation of split frequencies: 0.001426 495500 -- (-2352.510) (-2353.943) (-2352.123) [-2353.032] * (-2364.163) (-2356.549) (-2353.762) [-2355.182] -- 0:01:53 496000 -- (-2350.236) [-2346.445] (-2359.279) (-2349.166) * (-2353.447) (-2357.356) (-2358.969) [-2352.274] -- 0:01:52 496500 -- (-2354.023) (-2352.479) [-2348.597] (-2354.450) * [-2355.092] (-2353.510) (-2360.339) (-2357.911) -- 0:01:52 497000 -- (-2353.764) (-2357.458) [-2352.231] (-2359.948) * (-2366.845) (-2351.393) (-2359.586) [-2351.634] -- 0:01:53 497500 -- (-2355.625) [-2350.295] (-2362.838) (-2359.631) * [-2352.938] (-2352.940) (-2360.451) (-2352.766) -- 0:01:53 498000 -- (-2358.889) (-2351.302) [-2352.855] (-2356.415) * [-2346.556] (-2365.307) (-2358.790) (-2349.015) -- 0:01:52 498500 -- (-2358.177) (-2353.130) [-2351.119] (-2356.983) * [-2358.614] (-2355.983) (-2352.549) (-2355.914) -- 0:01:52 499000 -- [-2365.578] (-2350.718) (-2353.016) (-2351.654) * [-2349.306] (-2357.222) (-2351.890) (-2350.044) -- 0:01:52 499500 -- (-2356.931) (-2352.063) (-2354.027) [-2357.563] * (-2358.327) (-2357.019) [-2352.303] (-2355.868) -- 0:01:52 500000 -- (-2361.279) (-2351.871) (-2359.670) [-2348.669] * (-2364.128) (-2356.579) [-2349.183] (-2350.932) -- 0:01:52 Average standard deviation of split frequencies: 0.001883 500500 -- (-2351.301) (-2356.112) (-2358.231) [-2349.745] * (-2355.746) [-2360.500] (-2362.919) (-2354.636) -- 0:01:51 501000 -- [-2353.739] (-2360.641) (-2348.139) (-2357.432) * (-2350.931) [-2346.870] (-2348.800) (-2354.387) -- 0:01:51 501500 -- (-2352.530) (-2351.821) [-2354.060] (-2358.358) * (-2353.953) (-2348.177) (-2351.910) [-2362.000] -- 0:01:52 502000 -- (-2360.086) [-2358.300] (-2357.451) (-2350.191) * (-2351.462) (-2358.315) [-2354.197] (-2356.961) -- 0:01:52 502500 -- (-2353.588) (-2356.612) (-2353.443) [-2354.023] * (-2353.765) (-2353.699) (-2354.556) [-2351.343] -- 0:01:51 503000 -- (-2355.470) (-2352.287) [-2355.471] (-2349.610) * (-2355.168) (-2357.961) [-2353.835] (-2354.624) -- 0:01:51 503500 -- (-2355.929) [-2349.557] (-2354.554) (-2357.406) * [-2354.428] (-2356.355) (-2348.747) (-2351.019) -- 0:01:51 504000 -- (-2360.209) [-2355.330] (-2355.249) (-2354.432) * (-2357.281) [-2349.031] (-2350.382) (-2349.372) -- 0:01:51 504500 -- (-2355.338) (-2350.111) [-2351.728] (-2355.192) * (-2350.558) (-2354.781) [-2354.725] (-2358.628) -- 0:01:50 505000 -- (-2351.339) (-2352.282) [-2355.410] (-2352.258) * (-2354.938) [-2361.160] (-2359.303) (-2350.910) -- 0:01:50 Average standard deviation of split frequencies: 0.001630 505500 -- (-2352.679) (-2351.373) [-2356.580] (-2356.393) * [-2352.702] (-2355.383) (-2351.007) (-2356.679) -- 0:01:50 506000 -- [-2347.580] (-2355.448) (-2348.440) (-2359.686) * (-2356.477) (-2357.718) [-2349.777] (-2363.776) -- 0:01:51 506500 -- (-2351.218) (-2347.087) (-2355.289) [-2352.072] * (-2359.307) (-2358.639) [-2351.587] (-2357.184) -- 0:01:51 507000 -- [-2352.592] (-2356.353) (-2346.581) (-2362.328) * (-2356.453) [-2349.615] (-2355.961) (-2358.809) -- 0:01:50 507500 -- (-2348.657) [-2352.054] (-2348.108) (-2355.840) * (-2353.755) (-2356.706) [-2352.848] (-2364.691) -- 0:01:50 508000 -- (-2348.188) [-2356.975] (-2355.473) (-2360.218) * [-2356.550] (-2356.627) (-2355.669) (-2358.035) -- 0:01:50 508500 -- (-2357.787) [-2350.965] (-2358.052) (-2351.865) * (-2351.333) (-2356.974) (-2357.963) [-2355.524] -- 0:01:50 509000 -- (-2350.616) (-2356.001) [-2350.933] (-2364.833) * [-2349.268] (-2361.635) (-2352.804) (-2354.914) -- 0:01:49 509500 -- (-2357.165) (-2349.131) [-2349.811] (-2352.875) * [-2351.178] (-2359.346) (-2351.441) (-2355.971) -- 0:01:49 510000 -- (-2355.483) (-2364.380) (-2348.705) [-2354.915] * [-2353.548] (-2359.033) (-2358.292) (-2349.478) -- 0:01:49 Average standard deviation of split frequencies: 0.001615 510500 -- (-2352.968) (-2362.174) [-2349.754] (-2353.533) * (-2356.463) [-2362.162] (-2362.498) (-2356.866) -- 0:01:50 511000 -- [-2351.981] (-2346.193) (-2353.888) (-2361.353) * (-2351.665) (-2349.671) (-2349.617) [-2362.161] -- 0:01:50 511500 -- (-2360.177) (-2352.305) [-2356.056] (-2358.282) * (-2349.464) (-2350.636) [-2352.598] (-2361.007) -- 0:01:49 512000 -- (-2357.363) [-2353.031] (-2365.933) (-2356.418) * (-2349.611) (-2350.814) (-2353.406) [-2353.502] -- 0:01:49 512500 -- (-2355.616) (-2357.480) [-2355.907] (-2353.312) * [-2349.148] (-2351.846) (-2358.745) (-2360.910) -- 0:01:49 513000 -- (-2359.049) [-2351.179] (-2356.948) (-2358.905) * (-2357.038) (-2356.768) [-2357.132] (-2351.145) -- 0:01:49 513500 -- (-2356.643) [-2357.589] (-2352.024) (-2355.812) * [-2359.092] (-2352.312) (-2353.264) (-2360.677) -- 0:01:48 514000 -- [-2359.036] (-2354.763) (-2353.999) (-2354.057) * (-2358.541) [-2347.980] (-2354.575) (-2351.325) -- 0:01:48 514500 -- (-2352.706) [-2350.642] (-2355.345) (-2350.713) * (-2359.311) [-2352.882] (-2355.530) (-2368.304) -- 0:01:48 515000 -- (-2356.397) (-2353.119) [-2350.949] (-2354.834) * (-2357.701) [-2349.611] (-2350.176) (-2360.241) -- 0:01:49 Average standard deviation of split frequencies: 0.003198 515500 -- (-2352.018) (-2350.205) (-2352.909) [-2346.456] * (-2357.659) [-2354.929] (-2352.532) (-2364.239) -- 0:01:49 516000 -- (-2362.232) (-2356.122) [-2348.946] (-2353.008) * (-2364.830) (-2354.273) (-2356.297) [-2355.711] -- 0:01:48 516500 -- [-2353.169] (-2349.034) (-2352.577) (-2357.444) * (-2356.202) [-2355.270] (-2356.292) (-2354.661) -- 0:01:48 517000 -- (-2354.952) (-2354.500) (-2361.931) [-2356.039] * [-2346.326] (-2349.872) (-2356.944) (-2348.069) -- 0:01:48 517500 -- (-2350.289) (-2352.583) [-2359.401] (-2354.952) * (-2349.914) (-2354.963) (-2354.936) [-2357.787] -- 0:01:48 518000 -- (-2352.147) (-2349.219) (-2351.767) [-2353.093] * [-2352.172] (-2360.374) (-2352.625) (-2358.361) -- 0:01:47 518500 -- [-2351.165] (-2354.299) (-2349.675) (-2357.729) * (-2352.800) (-2361.046) [-2353.449] (-2352.771) -- 0:01:47 519000 -- (-2359.943) (-2350.395) (-2351.473) [-2352.182] * [-2350.465] (-2352.841) (-2362.763) (-2346.717) -- 0:01:47 519500 -- (-2352.453) [-2348.467] (-2351.358) (-2360.555) * (-2359.165) [-2351.327] (-2353.537) (-2350.743) -- 0:01:48 520000 -- (-2352.003) [-2358.071] (-2347.825) (-2358.108) * (-2354.406) (-2349.672) (-2355.302) [-2353.645] -- 0:01:48 Average standard deviation of split frequencies: 0.001811 520500 -- [-2360.120] (-2352.028) (-2360.820) (-2363.131) * (-2361.168) (-2354.928) (-2351.123) [-2359.037] -- 0:01:47 521000 -- (-2352.135) (-2351.034) [-2353.254] (-2353.361) * (-2356.204) (-2354.540) (-2349.665) [-2349.346] -- 0:01:47 521500 -- (-2356.357) [-2349.071] (-2358.835) (-2350.641) * (-2351.310) (-2357.552) [-2350.798] (-2358.113) -- 0:01:47 522000 -- [-2355.792] (-2353.114) (-2354.878) (-2356.824) * (-2358.180) [-2346.913] (-2351.855) (-2350.752) -- 0:01:47 522500 -- (-2350.316) (-2351.508) [-2350.339] (-2364.763) * [-2348.831] (-2348.823) (-2354.314) (-2356.099) -- 0:01:46 523000 -- (-2356.846) [-2351.210] (-2359.483) (-2350.243) * [-2358.308] (-2352.473) (-2351.367) (-2353.962) -- 0:01:46 523500 -- (-2354.543) (-2352.677) (-2354.289) [-2356.698] * (-2357.190) (-2357.404) (-2358.459) [-2355.379] -- 0:01:46 524000 -- [-2347.902] (-2350.318) (-2354.581) (-2358.089) * (-2355.502) (-2355.286) (-2355.195) [-2356.543] -- 0:01:47 524500 -- (-2351.386) [-2350.651] (-2355.393) (-2353.951) * [-2360.081] (-2348.844) (-2354.026) (-2356.605) -- 0:01:46 525000 -- (-2355.668) [-2347.830] (-2360.431) (-2356.792) * (-2355.013) [-2354.165] (-2360.779) (-2354.176) -- 0:01:46 Average standard deviation of split frequencies: 0.002016 525500 -- [-2348.837] (-2356.357) (-2350.978) (-2352.361) * [-2355.873] (-2351.311) (-2359.172) (-2347.822) -- 0:01:46 526000 -- (-2354.582) (-2357.661) [-2355.645] (-2354.890) * [-2351.842] (-2356.521) (-2360.724) (-2350.061) -- 0:01:46 526500 -- [-2351.244] (-2354.978) (-2356.579) (-2354.887) * (-2356.959) (-2355.965) (-2351.538) [-2349.139] -- 0:01:46 527000 -- [-2350.482] (-2354.988) (-2354.097) (-2354.474) * (-2362.336) (-2354.262) [-2352.508] (-2354.207) -- 0:01:45 527500 -- (-2359.711) (-2353.052) [-2352.154] (-2353.990) * (-2366.245) (-2349.457) [-2356.399] (-2358.232) -- 0:01:45 528000 -- (-2349.478) (-2351.265) (-2358.091) [-2361.760] * [-2348.783] (-2349.851) (-2355.437) (-2348.249) -- 0:01:45 528500 -- [-2355.305] (-2357.224) (-2347.650) (-2357.351) * (-2354.271) (-2348.140) (-2348.797) [-2349.022] -- 0:01:46 529000 -- (-2352.543) (-2354.515) [-2353.053] (-2363.471) * (-2358.527) (-2349.182) (-2354.173) [-2353.585] -- 0:01:45 529500 -- (-2358.044) (-2354.943) [-2353.819] (-2361.415) * (-2356.078) [-2353.253] (-2355.427) (-2353.052) -- 0:01:45 530000 -- (-2351.780) (-2355.212) [-2353.613] (-2354.435) * (-2346.287) (-2350.135) [-2349.360] (-2349.032) -- 0:01:45 Average standard deviation of split frequencies: 0.002221 530500 -- (-2354.060) (-2366.118) [-2351.770] (-2358.061) * (-2350.041) (-2350.552) (-2356.579) [-2349.228] -- 0:01:45 531000 -- (-2355.720) (-2356.078) (-2353.751) [-2364.769] * (-2351.641) (-2350.760) (-2349.718) [-2349.421] -- 0:01:45 531500 -- (-2349.400) (-2354.658) [-2348.321] (-2358.739) * (-2354.626) (-2360.281) [-2351.608] (-2352.472) -- 0:01:44 532000 -- (-2350.505) (-2348.992) (-2353.416) [-2358.668] * (-2352.879) (-2359.740) (-2357.794) [-2349.556] -- 0:01:44 532500 -- (-2352.754) (-2356.773) (-2364.156) [-2352.886] * [-2347.850] (-2356.043) (-2359.005) (-2350.406) -- 0:01:44 533000 -- (-2354.665) [-2354.616] (-2365.099) (-2359.539) * [-2348.577] (-2358.920) (-2355.997) (-2353.685) -- 0:01:45 533500 -- [-2357.264] (-2350.985) (-2360.015) (-2349.300) * (-2359.469) (-2355.526) [-2352.266] (-2365.764) -- 0:01:44 534000 -- (-2357.023) (-2361.417) (-2361.190) [-2352.301] * (-2365.377) [-2353.564] (-2356.272) (-2358.991) -- 0:01:44 534500 -- [-2353.281] (-2350.523) (-2356.569) (-2353.346) * [-2357.777] (-2352.808) (-2356.477) (-2361.992) -- 0:01:44 535000 -- [-2352.818] (-2354.333) (-2347.978) (-2356.583) * (-2361.544) [-2350.957] (-2349.295) (-2352.438) -- 0:01:44 Average standard deviation of split frequencies: 0.002199 535500 -- [-2353.700] (-2354.671) (-2355.200) (-2353.487) * (-2360.175) [-2352.038] (-2352.031) (-2357.956) -- 0:01:44 536000 -- (-2348.775) [-2353.731] (-2351.823) (-2348.373) * [-2349.971] (-2347.538) (-2354.463) (-2355.550) -- 0:01:43 536500 -- (-2353.099) [-2354.526] (-2354.323) (-2358.507) * (-2352.142) (-2352.782) [-2358.367] (-2361.442) -- 0:01:43 537000 -- (-2352.651) (-2349.336) (-2353.756) [-2354.109] * (-2352.393) (-2359.177) [-2351.259] (-2351.922) -- 0:01:43 537500 -- [-2353.544] (-2352.912) (-2360.440) (-2355.279) * (-2356.931) (-2363.496) [-2354.594] (-2348.453) -- 0:01:44 538000 -- (-2357.415) (-2346.780) [-2357.057] (-2348.050) * (-2353.643) (-2359.777) [-2348.551] (-2349.319) -- 0:01:43 538500 -- (-2362.079) (-2356.641) (-2355.826) [-2354.743] * (-2366.593) (-2353.235) (-2354.354) [-2353.737] -- 0:01:43 539000 -- [-2358.326] (-2357.747) (-2361.358) (-2355.046) * (-2356.822) [-2349.107] (-2348.515) (-2352.754) -- 0:01:43 539500 -- (-2355.532) [-2358.075] (-2350.634) (-2354.551) * (-2353.684) (-2349.792) [-2352.968] (-2352.552) -- 0:01:43 540000 -- (-2352.257) (-2353.728) (-2357.761) [-2355.006] * [-2348.016] (-2349.392) (-2358.187) (-2356.219) -- 0:01:43 Average standard deviation of split frequencies: 0.002616 540500 -- [-2357.161] (-2358.002) (-2355.462) (-2355.634) * (-2358.643) [-2347.607] (-2358.819) (-2352.964) -- 0:01:42 541000 -- (-2356.390) [-2353.404] (-2364.209) (-2351.493) * (-2355.564) (-2355.767) (-2360.705) [-2354.057] -- 0:01:42 541500 -- (-2354.961) (-2351.529) [-2352.027] (-2354.217) * (-2364.108) (-2359.882) (-2360.197) [-2356.730] -- 0:01:42 542000 -- (-2353.676) (-2355.705) [-2354.036] (-2357.093) * (-2368.006) (-2356.766) (-2351.916) [-2353.955] -- 0:01:43 542500 -- (-2360.569) (-2354.001) [-2354.353] (-2354.687) * (-2356.827) [-2353.235] (-2350.834) (-2361.866) -- 0:01:42 543000 -- (-2359.786) [-2351.220] (-2357.663) (-2352.749) * (-2361.797) [-2350.216] (-2354.964) (-2358.122) -- 0:01:42 543500 -- [-2357.848] (-2353.243) (-2350.304) (-2362.809) * (-2351.996) (-2354.761) [-2355.164] (-2361.596) -- 0:01:42 544000 -- [-2352.762] (-2361.062) (-2355.269) (-2359.788) * (-2354.347) (-2351.442) [-2351.287] (-2359.285) -- 0:01:42 544500 -- (-2350.873) [-2348.363] (-2358.915) (-2355.238) * [-2350.630] (-2354.749) (-2348.939) (-2357.907) -- 0:01:42 545000 -- [-2349.463] (-2356.860) (-2357.815) (-2353.693) * (-2353.307) (-2353.546) [-2348.686] (-2359.316) -- 0:01:41 Average standard deviation of split frequencies: 0.002374 545500 -- (-2366.268) (-2351.875) [-2353.796] (-2355.366) * (-2355.563) (-2358.358) (-2350.761) [-2351.360] -- 0:01:41 546000 -- (-2351.484) [-2350.983] (-2353.893) (-2350.977) * (-2363.962) (-2353.363) (-2350.553) [-2349.689] -- 0:01:41 546500 -- (-2353.251) (-2352.741) (-2352.282) [-2354.882] * (-2358.187) (-2356.981) (-2363.522) [-2355.112] -- 0:01:42 547000 -- (-2355.695) [-2354.759] (-2363.509) (-2346.321) * (-2353.050) [-2353.152] (-2361.876) (-2352.640) -- 0:01:41 547500 -- (-2356.952) (-2356.566) [-2352.666] (-2360.319) * (-2356.622) (-2359.199) (-2351.295) [-2351.543] -- 0:01:41 548000 -- (-2349.723) (-2350.320) (-2358.527) [-2349.751] * [-2354.648] (-2354.222) (-2357.239) (-2360.818) -- 0:01:41 548500 -- (-2354.281) [-2350.332] (-2361.477) (-2355.105) * [-2354.702] (-2353.889) (-2351.422) (-2354.813) -- 0:01:41 549000 -- (-2355.021) (-2365.882) (-2352.867) [-2360.135] * (-2355.140) (-2350.379) (-2351.453) [-2359.975] -- 0:01:41 549500 -- (-2354.838) (-2363.622) [-2354.979] (-2351.359) * (-2362.710) (-2349.515) (-2356.112) [-2352.821] -- 0:01:40 550000 -- (-2358.248) (-2355.018) (-2356.763) [-2352.140] * (-2362.524) [-2349.441] (-2350.014) (-2354.555) -- 0:01:40 Average standard deviation of split frequencies: 0.002782 550500 -- (-2349.990) (-2354.703) (-2350.361) [-2352.249] * (-2349.939) (-2357.331) [-2349.560] (-2351.382) -- 0:01:40 551000 -- (-2347.913) (-2351.363) [-2348.969] (-2358.492) * [-2354.001] (-2354.532) (-2348.433) (-2351.718) -- 0:01:41 551500 -- (-2351.897) (-2349.376) (-2351.344) [-2351.439] * (-2357.808) [-2352.677] (-2357.328) (-2353.161) -- 0:01:40 552000 -- (-2351.640) (-2353.093) (-2351.434) [-2353.984] * (-2355.213) [-2360.671] (-2354.124) (-2361.335) -- 0:01:40 552500 -- (-2350.198) [-2360.405] (-2350.889) (-2350.444) * [-2354.317] (-2354.117) (-2351.939) (-2357.112) -- 0:01:40 553000 -- [-2349.949] (-2359.939) (-2352.086) (-2355.652) * (-2361.769) (-2356.829) (-2349.347) [-2354.731] -- 0:01:40 553500 -- (-2350.473) (-2353.592) (-2360.729) [-2355.410] * [-2354.479] (-2354.234) (-2352.404) (-2354.187) -- 0:01:40 554000 -- [-2350.045] (-2356.795) (-2351.880) (-2361.017) * (-2353.958) (-2360.229) (-2355.616) [-2352.999] -- 0:01:39 554500 -- (-2359.196) (-2352.274) (-2352.573) [-2352.589] * [-2351.866] (-2354.450) (-2356.561) (-2359.976) -- 0:01:39 555000 -- [-2350.351] (-2354.901) (-2358.387) (-2358.014) * (-2354.667) [-2356.768] (-2352.162) (-2358.952) -- 0:01:39 Average standard deviation of split frequencies: 0.002332 555500 -- [-2344.500] (-2353.517) (-2358.173) (-2354.240) * (-2356.073) [-2358.592] (-2354.986) (-2349.328) -- 0:01:40 556000 -- [-2347.026] (-2358.666) (-2354.094) (-2353.678) * [-2353.531] (-2351.237) (-2349.527) (-2358.645) -- 0:01:39 556500 -- (-2353.839) (-2356.123) (-2353.442) [-2351.425] * (-2353.124) (-2351.157) (-2364.154) [-2354.008] -- 0:01:39 557000 -- [-2349.638] (-2356.813) (-2354.931) (-2359.994) * [-2352.701] (-2353.386) (-2358.217) (-2354.427) -- 0:01:39 557500 -- [-2360.163] (-2360.858) (-2351.093) (-2353.579) * (-2350.709) [-2349.358] (-2356.484) (-2360.217) -- 0:01:39 558000 -- (-2353.932) (-2360.141) [-2354.735] (-2360.561) * (-2359.994) (-2351.738) (-2356.864) [-2357.396] -- 0:01:39 558500 -- (-2350.265) (-2355.051) [-2356.191] (-2352.855) * [-2359.507] (-2354.218) (-2354.108) (-2350.941) -- 0:01:38 559000 -- (-2356.711) [-2357.768] (-2361.824) (-2354.717) * (-2348.299) (-2354.974) [-2352.782] (-2354.585) -- 0:01:38 559500 -- (-2363.097) (-2364.988) (-2353.689) [-2360.651] * (-2352.754) [-2357.887] (-2358.426) (-2356.157) -- 0:01:38 560000 -- [-2352.294] (-2360.441) (-2350.987) (-2365.225) * (-2353.714) (-2354.182) [-2353.423] (-2352.570) -- 0:01:39 Average standard deviation of split frequencies: 0.002102 560500 -- (-2353.119) (-2348.310) [-2352.437] (-2357.114) * (-2353.066) [-2352.984] (-2358.064) (-2350.743) -- 0:01:38 561000 -- [-2361.539] (-2359.065) (-2352.386) (-2363.355) * (-2352.132) (-2358.885) [-2354.632] (-2356.796) -- 0:01:38 561500 -- [-2356.538] (-2358.821) (-2352.386) (-2348.039) * (-2349.462) (-2357.416) (-2346.332) [-2350.951] -- 0:01:38 562000 -- (-2356.977) [-2357.388] (-2358.545) (-2359.127) * (-2350.161) (-2347.069) [-2353.514] (-2348.912) -- 0:01:38 562500 -- (-2366.010) (-2352.795) (-2355.627) [-2353.462] * (-2360.256) (-2361.076) (-2347.466) [-2350.500] -- 0:01:38 563000 -- (-2351.106) (-2355.690) (-2362.666) [-2355.130] * [-2350.165] (-2360.455) (-2354.693) (-2350.362) -- 0:01:37 563500 -- (-2352.885) [-2352.899] (-2357.990) (-2351.001) * (-2350.926) [-2349.340] (-2348.044) (-2357.894) -- 0:01:37 564000 -- (-2354.976) [-2353.547] (-2358.773) (-2349.217) * (-2355.175) (-2351.755) [-2353.621] (-2351.819) -- 0:01:37 564500 -- (-2350.624) (-2351.208) [-2349.207] (-2354.973) * (-2356.746) (-2352.506) (-2352.387) [-2352.031] -- 0:01:37 565000 -- (-2354.951) (-2352.024) (-2354.768) [-2348.809] * (-2358.247) [-2352.502] (-2355.443) (-2353.856) -- 0:01:37 Average standard deviation of split frequencies: 0.002082 565500 -- [-2353.013] (-2359.081) (-2352.606) (-2353.916) * [-2355.767] (-2354.476) (-2348.805) (-2360.035) -- 0:01:37 566000 -- [-2349.441] (-2355.775) (-2367.322) (-2363.614) * [-2351.756] (-2357.698) (-2352.528) (-2355.808) -- 0:01:37 566500 -- (-2362.965) [-2354.897] (-2356.445) (-2354.454) * (-2354.184) (-2353.483) (-2357.559) [-2365.008] -- 0:01:37 567000 -- [-2348.406] (-2348.552) (-2363.779) (-2354.358) * [-2353.375] (-2351.976) (-2361.807) (-2369.301) -- 0:01:36 567500 -- (-2352.605) [-2352.555] (-2354.250) (-2361.092) * [-2352.237] (-2357.717) (-2352.181) (-2367.657) -- 0:01:36 568000 -- [-2348.568] (-2365.166) (-2359.311) (-2353.615) * [-2353.647] (-2359.647) (-2368.498) (-2351.559) -- 0:01:36 568500 -- (-2363.387) (-2350.654) (-2361.141) [-2359.799] * (-2358.424) [-2357.082] (-2352.693) (-2356.726) -- 0:01:36 569000 -- (-2361.733) [-2361.482] (-2360.894) (-2357.900) * [-2351.032] (-2356.278) (-2346.957) (-2354.676) -- 0:01:36 569500 -- [-2357.457] (-2356.770) (-2360.942) (-2350.604) * [-2351.442] (-2360.028) (-2348.131) (-2357.441) -- 0:01:36 570000 -- (-2356.453) [-2356.358] (-2352.294) (-2351.184) * (-2347.307) (-2353.476) (-2354.973) [-2356.339] -- 0:01:36 Average standard deviation of split frequencies: 0.002272 570500 -- (-2353.991) [-2356.306] (-2359.127) (-2358.289) * (-2353.742) (-2354.119) (-2353.802) [-2351.207] -- 0:01:36 571000 -- (-2360.906) [-2354.412] (-2355.971) (-2360.712) * (-2350.269) [-2352.509] (-2361.950) (-2362.097) -- 0:01:36 571500 -- (-2352.522) (-2359.081) (-2355.678) [-2349.819] * (-2353.890) (-2353.631) [-2355.011] (-2358.081) -- 0:01:35 572000 -- (-2357.984) (-2357.053) (-2357.843) [-2351.567] * [-2356.414] (-2352.504) (-2354.671) (-2356.454) -- 0:01:35 572500 -- [-2349.862] (-2351.137) (-2356.168) (-2350.611) * (-2353.417) [-2353.740] (-2356.876) (-2358.039) -- 0:01:35 573000 -- [-2352.660] (-2350.025) (-2367.370) (-2351.294) * (-2358.557) (-2350.857) [-2353.243] (-2361.077) -- 0:01:35 573500 -- (-2353.537) [-2359.549] (-2361.579) (-2353.605) * [-2354.553] (-2365.274) (-2351.196) (-2362.297) -- 0:01:35 574000 -- [-2361.719] (-2356.259) (-2354.970) (-2357.085) * (-2352.607) [-2355.712] (-2349.982) (-2367.491) -- 0:01:35 574500 -- (-2353.086) [-2351.834] (-2348.253) (-2362.669) * (-2352.576) (-2360.724) [-2350.529] (-2360.284) -- 0:01:35 575000 -- (-2355.313) [-2348.752] (-2358.298) (-2360.574) * (-2349.093) (-2351.630) (-2365.037) [-2359.062] -- 0:01:35 Average standard deviation of split frequencies: 0.001841 575500 -- (-2362.774) (-2353.921) [-2351.587] (-2366.864) * (-2357.151) [-2356.016] (-2362.535) (-2348.912) -- 0:01:35 576000 -- [-2349.866] (-2351.323) (-2353.714) (-2350.779) * (-2354.069) [-2351.793] (-2355.401) (-2350.582) -- 0:01:34 576500 -- [-2348.704] (-2361.344) (-2355.292) (-2361.745) * [-2349.829] (-2349.116) (-2355.520) (-2352.915) -- 0:01:34 577000 -- (-2352.626) (-2355.959) [-2351.740] (-2354.470) * (-2351.235) (-2353.114) (-2357.235) [-2353.982] -- 0:01:34 577500 -- (-2361.117) (-2360.247) (-2354.649) [-2354.405] * (-2358.836) (-2354.380) (-2352.140) [-2348.326] -- 0:01:34 578000 -- (-2347.496) [-2352.439] (-2358.297) (-2359.998) * (-2350.456) [-2353.401] (-2357.876) (-2353.143) -- 0:01:34 578500 -- (-2346.964) [-2347.945] (-2355.465) (-2365.586) * (-2358.069) [-2351.045] (-2356.272) (-2369.191) -- 0:01:34 579000 -- [-2350.373] (-2349.626) (-2356.487) (-2349.151) * (-2360.708) [-2352.665] (-2354.814) (-2362.293) -- 0:01:34 579500 -- (-2354.828) [-2352.492] (-2360.229) (-2354.504) * (-2354.133) [-2355.251] (-2350.311) (-2350.397) -- 0:01:34 580000 -- (-2356.078) [-2354.368] (-2355.892) (-2356.474) * (-2353.822) [-2349.234] (-2354.160) (-2349.988) -- 0:01:34 Average standard deviation of split frequencies: 0.002030 580500 -- [-2356.686] (-2359.224) (-2353.986) (-2353.564) * (-2353.144) (-2348.619) (-2350.791) [-2353.409] -- 0:01:33 581000 -- [-2352.492] (-2364.643) (-2353.641) (-2347.782) * (-2358.211) [-2354.421] (-2354.680) (-2355.655) -- 0:01:33 581500 -- (-2353.260) (-2358.204) (-2350.493) [-2354.388] * (-2357.848) (-2353.522) (-2358.695) [-2350.762] -- 0:01:33 582000 -- (-2351.629) [-2361.298] (-2347.845) (-2362.070) * [-2350.776] (-2355.152) (-2356.250) (-2353.861) -- 0:01:33 582500 -- (-2355.854) (-2361.620) [-2351.382] (-2349.969) * (-2355.702) (-2352.683) (-2351.827) [-2358.417] -- 0:01:33 583000 -- [-2352.563] (-2351.204) (-2357.642) (-2358.371) * (-2356.228) (-2359.697) (-2356.622) [-2349.083] -- 0:01:33 583500 -- (-2354.280) (-2357.988) [-2350.559] (-2348.517) * (-2357.986) [-2357.303] (-2360.710) (-2355.589) -- 0:01:33 584000 -- (-2354.981) [-2352.851] (-2356.036) (-2356.109) * (-2346.664) (-2361.233) (-2349.897) [-2358.548] -- 0:01:33 584500 -- (-2352.162) (-2357.979) (-2356.321) [-2353.501] * (-2363.144) (-2355.175) (-2351.675) [-2351.821] -- 0:01:33 585000 -- [-2357.926] (-2354.252) (-2357.692) (-2352.990) * (-2359.600) (-2349.889) [-2357.981] (-2360.733) -- 0:01:32 Average standard deviation of split frequencies: 0.001810 585500 -- (-2356.274) [-2353.449] (-2360.645) (-2359.024) * (-2346.675) (-2351.585) (-2347.753) [-2349.031] -- 0:01:32 586000 -- (-2362.704) (-2349.586) (-2348.726) [-2348.512] * [-2347.596] (-2360.287) (-2355.422) (-2360.666) -- 0:01:32 586500 -- [-2357.600] (-2354.723) (-2351.150) (-2353.832) * (-2353.264) [-2356.545] (-2361.290) (-2355.455) -- 0:01:32 587000 -- (-2352.037) (-2356.609) (-2351.470) [-2354.985] * [-2356.869] (-2360.160) (-2358.110) (-2355.657) -- 0:01:32 587500 -- (-2354.571) (-2359.360) [-2356.210] (-2360.625) * [-2348.794] (-2362.440) (-2352.327) (-2354.583) -- 0:01:32 588000 -- [-2354.262] (-2359.005) (-2359.850) (-2353.539) * [-2350.621] (-2352.099) (-2355.048) (-2361.684) -- 0:01:32 588500 -- [-2354.606] (-2353.599) (-2359.783) (-2363.261) * (-2360.815) (-2354.223) [-2350.668] (-2360.663) -- 0:01:32 589000 -- (-2354.732) [-2348.080] (-2352.680) (-2364.481) * [-2366.042] (-2355.384) (-2357.891) (-2355.152) -- 0:01:32 589500 -- (-2354.595) [-2350.694] (-2357.247) (-2355.825) * (-2364.325) (-2356.994) (-2354.562) [-2354.884] -- 0:01:31 590000 -- (-2351.422) (-2350.978) [-2354.451] (-2348.869) * (-2355.936) [-2356.603] (-2361.718) (-2350.911) -- 0:01:31 Average standard deviation of split frequencies: 0.001796 590500 -- (-2353.989) (-2354.045) (-2350.253) [-2358.655] * (-2359.116) (-2352.596) (-2350.402) [-2354.169] -- 0:01:31 591000 -- (-2357.686) (-2353.259) (-2347.215) [-2352.404] * (-2354.922) (-2350.748) (-2363.781) [-2352.309] -- 0:01:31 591500 -- [-2355.305] (-2346.367) (-2357.557) (-2361.519) * [-2352.580] (-2353.332) (-2355.536) (-2353.525) -- 0:01:31 592000 -- (-2358.618) [-2351.439] (-2352.230) (-2354.336) * (-2350.586) (-2350.731) (-2353.636) [-2355.186] -- 0:01:31 592500 -- (-2352.901) (-2348.811) [-2353.926] (-2349.833) * [-2354.558] (-2357.288) (-2352.581) (-2354.994) -- 0:01:31 593000 -- (-2350.390) (-2355.981) (-2353.363) [-2358.790] * (-2353.346) [-2350.835] (-2355.830) (-2349.730) -- 0:01:31 593500 -- [-2354.580] (-2365.593) (-2354.956) (-2349.746) * (-2354.974) (-2354.652) [-2353.418] (-2354.103) -- 0:01:31 594000 -- (-2353.958) (-2352.472) (-2360.168) [-2346.661] * [-2353.893] (-2362.213) (-2358.639) (-2361.294) -- 0:01:30 594500 -- (-2351.074) [-2350.523] (-2355.282) (-2359.320) * (-2357.816) (-2357.881) (-2355.041) [-2355.199] -- 0:01:30 595000 -- (-2352.606) (-2349.767) [-2363.574] (-2356.198) * (-2356.786) (-2357.832) [-2358.393] (-2349.508) -- 0:01:30 Average standard deviation of split frequencies: 0.002175 595500 -- (-2348.588) (-2351.470) (-2349.599) [-2357.766] * [-2352.875] (-2350.753) (-2353.998) (-2356.380) -- 0:01:30 596000 -- [-2359.637] (-2352.530) (-2356.536) (-2361.157) * (-2347.756) [-2349.816] (-2360.549) (-2355.176) -- 0:01:30 596500 -- (-2354.499) (-2362.447) (-2357.413) [-2350.521] * (-2350.565) (-2362.088) [-2356.377] (-2356.129) -- 0:01:30 597000 -- (-2351.477) [-2351.608] (-2357.214) (-2349.451) * [-2351.502] (-2349.381) (-2364.920) (-2355.608) -- 0:01:30 597500 -- (-2352.026) [-2356.355] (-2348.629) (-2352.240) * (-2355.287) (-2349.585) [-2348.926] (-2357.309) -- 0:01:30 598000 -- (-2358.778) (-2356.126) [-2353.190] (-2355.889) * (-2356.360) [-2352.091] (-2357.008) (-2353.103) -- 0:01:30 598500 -- (-2358.421) (-2352.481) [-2357.391] (-2351.643) * (-2355.551) (-2352.091) [-2353.256] (-2360.679) -- 0:01:29 599000 -- (-2355.765) (-2353.995) (-2354.483) [-2348.314] * (-2356.932) [-2351.601] (-2360.203) (-2354.501) -- 0:01:29 599500 -- (-2354.523) (-2354.354) (-2357.719) [-2351.717] * [-2352.398] (-2356.016) (-2359.282) (-2349.322) -- 0:01:29 600000 -- (-2355.113) (-2353.301) (-2360.946) [-2353.366] * (-2355.661) (-2354.478) (-2352.913) [-2349.693] -- 0:01:29 Average standard deviation of split frequencies: 0.001766 600500 -- [-2349.725] (-2361.536) (-2357.308) (-2353.048) * (-2357.632) (-2355.319) [-2350.984] (-2358.948) -- 0:01:29 601000 -- (-2354.873) [-2358.040] (-2361.595) (-2352.708) * (-2353.179) (-2353.152) [-2357.336] (-2352.462) -- 0:01:29 601500 -- (-2361.154) [-2351.753] (-2361.352) (-2351.420) * (-2358.776) [-2354.302] (-2350.904) (-2352.971) -- 0:01:29 602000 -- (-2352.705) (-2350.006) [-2351.113] (-2352.476) * (-2362.377) [-2353.977] (-2353.135) (-2358.815) -- 0:01:29 602500 -- (-2350.801) (-2351.920) [-2354.704] (-2351.035) * (-2355.921) (-2362.181) (-2363.328) [-2353.106] -- 0:01:29 603000 -- (-2350.113) (-2351.049) (-2357.279) [-2351.742] * [-2352.368] (-2361.749) (-2350.079) (-2360.090) -- 0:01:28 603500 -- (-2360.870) (-2361.934) (-2352.420) [-2350.755] * (-2355.228) [-2352.913] (-2355.247) (-2348.048) -- 0:01:28 604000 -- (-2355.670) (-2351.062) (-2351.885) [-2352.160] * (-2363.497) (-2358.149) (-2354.147) [-2351.970] -- 0:01:28 604500 -- (-2355.174) (-2351.482) [-2356.407] (-2350.258) * [-2353.980] (-2354.610) (-2350.107) (-2352.789) -- 0:01:28 605000 -- (-2363.025) (-2348.920) (-2360.402) [-2354.673] * (-2359.544) [-2352.403] (-2351.374) (-2358.764) -- 0:01:28 Average standard deviation of split frequencies: 0.002917 605500 -- (-2356.340) (-2352.772) [-2353.148] (-2351.799) * [-2352.953] (-2355.893) (-2350.526) (-2356.855) -- 0:01:28 606000 -- (-2350.492) [-2355.816] (-2355.336) (-2352.187) * (-2353.118) (-2350.586) [-2349.562] (-2351.041) -- 0:01:28 606500 -- (-2363.746) [-2353.010] (-2350.727) (-2353.124) * [-2352.412] (-2355.844) (-2355.609) (-2354.049) -- 0:01:28 607000 -- [-2359.101] (-2351.269) (-2352.886) (-2352.493) * (-2352.995) [-2351.141] (-2354.587) (-2349.934) -- 0:01:28 607500 -- (-2353.604) [-2353.761] (-2351.496) (-2352.775) * [-2347.737] (-2353.907) (-2355.929) (-2350.830) -- 0:01:27 608000 -- (-2350.505) (-2359.923) (-2349.579) [-2356.578] * (-2347.870) (-2355.289) [-2352.630] (-2354.827) -- 0:01:27 608500 -- (-2356.495) [-2354.134] (-2354.004) (-2354.590) * (-2353.351) [-2356.680] (-2355.022) (-2346.701) -- 0:01:27 609000 -- (-2360.110) (-2350.709) (-2360.575) [-2351.812] * (-2346.888) [-2354.909] (-2347.334) (-2351.108) -- 0:01:27 609500 -- (-2351.600) [-2352.969] (-2352.908) (-2350.054) * (-2348.665) (-2356.860) (-2351.847) [-2349.330] -- 0:01:27 610000 -- [-2354.195] (-2350.552) (-2350.438) (-2357.040) * (-2349.328) [-2352.947] (-2350.768) (-2362.544) -- 0:01:27 Average standard deviation of split frequencies: 0.002123 610500 -- [-2350.942] (-2354.457) (-2353.812) (-2349.942) * (-2355.316) (-2357.671) [-2351.984] (-2357.367) -- 0:01:27 611000 -- (-2353.030) (-2354.887) [-2350.797] (-2360.415) * [-2352.298] (-2355.769) (-2352.650) (-2360.635) -- 0:01:27 611500 -- (-2355.031) (-2358.514) [-2349.770] (-2347.212) * (-2360.126) (-2356.967) (-2356.252) [-2351.520] -- 0:01:27 612000 -- [-2357.996] (-2360.555) (-2357.722) (-2353.288) * (-2363.967) [-2354.790] (-2349.886) (-2351.795) -- 0:01:26 612500 -- (-2354.423) (-2364.031) [-2355.752] (-2348.650) * [-2352.651] (-2355.168) (-2353.463) (-2353.858) -- 0:01:26 613000 -- [-2352.170] (-2358.745) (-2354.216) (-2349.506) * [-2353.181] (-2354.553) (-2352.191) (-2355.748) -- 0:01:26 613500 -- (-2355.463) [-2352.088] (-2355.063) (-2351.689) * (-2349.853) [-2350.972] (-2352.681) (-2362.631) -- 0:01:26 614000 -- [-2357.646] (-2350.532) (-2353.487) (-2359.789) * (-2349.432) [-2352.839] (-2357.712) (-2354.390) -- 0:01:26 614500 -- [-2353.403] (-2351.130) (-2359.195) (-2355.309) * [-2353.439] (-2358.052) (-2355.325) (-2359.014) -- 0:01:26 615000 -- (-2361.479) (-2356.649) (-2362.042) [-2355.937] * (-2353.761) (-2359.314) [-2348.432] (-2349.085) -- 0:01:26 Average standard deviation of split frequencies: 0.003061 615500 -- (-2355.304) (-2358.865) [-2353.746] (-2355.562) * [-2349.102] (-2358.195) (-2355.275) (-2362.169) -- 0:01:26 616000 -- (-2351.669) (-2349.867) [-2350.901] (-2359.316) * [-2349.058] (-2357.897) (-2353.683) (-2365.662) -- 0:01:26 616500 -- [-2353.204] (-2352.768) (-2362.146) (-2354.391) * (-2357.058) (-2349.137) (-2355.210) [-2353.831] -- 0:01:25 617000 -- (-2351.646) (-2352.254) [-2353.862] (-2359.843) * [-2352.514] (-2354.106) (-2350.453) (-2350.717) -- 0:01:25 617500 -- (-2353.024) (-2352.289) [-2354.419] (-2357.610) * (-2353.890) (-2354.870) [-2351.878] (-2356.265) -- 0:01:25 618000 -- [-2351.380] (-2354.840) (-2346.820) (-2360.827) * [-2353.073] (-2353.084) (-2354.719) (-2363.553) -- 0:01:25 618500 -- [-2354.779] (-2355.331) (-2351.170) (-2351.047) * (-2354.512) [-2358.442] (-2351.252) (-2356.331) -- 0:01:25 619000 -- [-2352.299] (-2357.235) (-2359.927) (-2353.190) * [-2351.534] (-2356.214) (-2351.897) (-2357.430) -- 0:01:25 619500 -- (-2355.031) [-2354.387] (-2363.658) (-2361.512) * (-2349.827) (-2351.492) (-2358.304) [-2352.764] -- 0:01:25 620000 -- [-2353.671] (-2349.596) (-2369.385) (-2352.856) * (-2357.459) [-2352.201] (-2351.356) (-2355.492) -- 0:01:25 Average standard deviation of split frequencies: 0.002848 620500 -- (-2352.060) (-2356.430) [-2351.960] (-2351.660) * (-2348.558) (-2355.836) [-2353.815] (-2355.695) -- 0:01:25 621000 -- (-2351.488) (-2352.053) [-2357.421] (-2355.605) * [-2354.645] (-2349.465) (-2361.907) (-2356.026) -- 0:01:24 621500 -- (-2358.212) (-2350.372) [-2355.244] (-2353.373) * (-2356.744) [-2351.273] (-2352.370) (-2356.914) -- 0:01:24 622000 -- (-2362.655) [-2353.631] (-2354.087) (-2358.518) * [-2366.430] (-2352.971) (-2354.121) (-2350.944) -- 0:01:24 622500 -- (-2360.901) (-2352.488) [-2350.944] (-2360.983) * (-2351.773) (-2355.314) (-2360.770) [-2348.750] -- 0:01:24 623000 -- [-2356.375] (-2362.442) (-2360.959) (-2358.037) * (-2360.017) [-2358.109] (-2354.110) (-2349.470) -- 0:01:24 623500 -- [-2354.493] (-2355.970) (-2355.335) (-2353.881) * (-2360.983) [-2356.564] (-2353.855) (-2352.739) -- 0:01:24 624000 -- (-2350.804) (-2354.683) [-2353.838] (-2354.470) * [-2358.814] (-2362.871) (-2356.156) (-2352.053) -- 0:01:24 624500 -- [-2355.705] (-2355.106) (-2352.194) (-2351.095) * (-2357.827) (-2362.087) [-2358.951] (-2356.245) -- 0:01:24 625000 -- [-2356.724] (-2356.599) (-2356.272) (-2352.898) * (-2358.234) (-2358.944) [-2358.592] (-2348.778) -- 0:01:24 Average standard deviation of split frequencies: 0.004142 625500 -- (-2360.755) (-2359.975) (-2353.377) [-2354.421] * [-2355.027] (-2351.956) (-2358.361) (-2356.320) -- 0:01:23 626000 -- (-2356.938) (-2358.234) [-2350.951] (-2356.440) * (-2359.491) (-2350.058) (-2351.806) [-2354.857] -- 0:01:23 626500 -- (-2350.972) [-2349.294] (-2354.542) (-2352.146) * (-2357.320) (-2355.796) [-2349.030] (-2363.975) -- 0:01:23 627000 -- (-2354.826) [-2353.403] (-2350.717) (-2352.420) * (-2359.347) (-2355.358) [-2351.996] (-2355.528) -- 0:01:23 627500 -- (-2358.524) (-2359.670) (-2355.898) [-2352.273] * (-2353.662) [-2355.164] (-2358.862) (-2357.925) -- 0:01:23 628000 -- (-2357.550) [-2357.592] (-2359.404) (-2353.728) * [-2346.525] (-2355.801) (-2352.860) (-2351.543) -- 0:01:23 628500 -- (-2354.280) (-2357.716) [-2357.576] (-2354.747) * [-2354.522] (-2351.750) (-2349.991) (-2349.994) -- 0:01:23 629000 -- [-2354.213] (-2357.948) (-2353.453) (-2360.394) * (-2357.595) (-2348.623) (-2352.150) [-2346.180] -- 0:01:23 629500 -- (-2359.551) (-2357.312) (-2355.191) [-2358.938] * [-2348.471] (-2353.798) (-2349.571) (-2349.925) -- 0:01:22 630000 -- (-2353.157) (-2357.616) (-2357.060) [-2354.572] * [-2354.198] (-2365.943) (-2349.090) (-2353.000) -- 0:01:22 Average standard deviation of split frequencies: 0.003550 630500 -- (-2368.859) (-2361.404) [-2352.206] (-2358.294) * (-2350.590) [-2357.098] (-2355.359) (-2348.911) -- 0:01:22 631000 -- (-2356.960) [-2352.599] (-2351.109) (-2351.186) * [-2352.793] (-2362.261) (-2369.690) (-2356.417) -- 0:01:22 631500 -- (-2367.237) (-2353.417) (-2353.323) [-2354.663] * (-2346.926) [-2353.084] (-2357.076) (-2348.776) -- 0:01:22 632000 -- (-2353.721) (-2356.657) (-2355.233) [-2346.208] * (-2368.833) (-2365.113) [-2357.692] (-2351.026) -- 0:01:22 632500 -- (-2357.135) (-2354.709) (-2352.868) [-2354.540] * (-2353.112) (-2353.304) (-2349.669) [-2355.504] -- 0:01:22 633000 -- (-2350.210) (-2350.178) [-2358.397] (-2352.362) * (-2365.035) (-2347.945) (-2352.894) [-2355.462] -- 0:01:22 633500 -- (-2353.535) (-2353.934) [-2350.680] (-2360.473) * (-2363.380) [-2350.695] (-2352.187) (-2362.552) -- 0:01:22 634000 -- (-2359.320) (-2357.695) [-2356.609] (-2349.760) * (-2357.200) [-2349.086] (-2348.334) (-2366.856) -- 0:01:21 634500 -- [-2355.597] (-2357.975) (-2359.231) (-2358.262) * (-2356.888) (-2350.671) (-2359.413) [-2349.978] -- 0:01:21 635000 -- (-2361.076) (-2354.840) (-2353.394) [-2356.241] * (-2359.496) (-2354.871) [-2354.849] (-2357.734) -- 0:01:21 Average standard deviation of split frequencies: 0.003335 635500 -- (-2353.618) [-2351.584] (-2364.558) (-2354.491) * (-2353.264) (-2354.687) [-2351.785] (-2357.445) -- 0:01:21 636000 -- (-2351.033) [-2349.649] (-2353.504) (-2358.519) * (-2351.457) [-2355.469] (-2354.766) (-2359.917) -- 0:01:21 636500 -- (-2354.191) (-2350.840) (-2353.783) [-2353.929] * (-2361.122) [-2347.378] (-2357.846) (-2358.718) -- 0:01:21 637000 -- (-2352.261) [-2352.929] (-2352.180) (-2358.307) * (-2357.386) (-2350.570) [-2358.288] (-2359.136) -- 0:01:21 637500 -- (-2351.103) (-2353.167) (-2354.623) [-2349.485] * (-2359.984) [-2353.456] (-2358.727) (-2353.351) -- 0:01:21 638000 -- (-2352.616) [-2356.499] (-2360.795) (-2350.138) * (-2356.823) [-2345.546] (-2358.271) (-2362.958) -- 0:01:21 638500 -- (-2356.811) [-2347.404] (-2357.259) (-2360.201) * (-2357.569) (-2353.961) [-2355.597] (-2362.421) -- 0:01:20 639000 -- (-2355.116) [-2349.835] (-2351.392) (-2349.198) * [-2353.715] (-2354.312) (-2357.101) (-2365.606) -- 0:01:20 639500 -- [-2355.646] (-2347.744) (-2350.834) (-2356.288) * [-2355.344] (-2352.764) (-2358.085) (-2355.993) -- 0:01:20 640000 -- (-2353.067) [-2355.580] (-2355.864) (-2352.289) * (-2352.235) (-2359.030) [-2361.119] (-2360.163) -- 0:01:20 Average standard deviation of split frequencies: 0.002759 640500 -- (-2361.793) (-2354.356) [-2353.410] (-2355.853) * (-2345.641) (-2352.223) [-2349.719] (-2359.631) -- 0:01:20 641000 -- [-2352.748] (-2349.834) (-2349.751) (-2352.727) * (-2361.199) (-2356.505) [-2349.292] (-2364.392) -- 0:01:20 641500 -- (-2350.291) [-2353.529] (-2349.032) (-2352.179) * (-2352.939) (-2356.426) (-2349.805) [-2358.052] -- 0:01:20 642000 -- [-2354.354] (-2361.217) (-2358.889) (-2348.695) * [-2356.308] (-2360.075) (-2362.470) (-2358.510) -- 0:01:20 642500 -- (-2355.089) (-2355.847) (-2355.342) [-2354.346] * (-2346.527) (-2355.960) (-2356.274) [-2348.568] -- 0:01:20 643000 -- [-2355.010] (-2354.450) (-2355.857) (-2349.084) * [-2355.496] (-2352.581) (-2351.644) (-2352.458) -- 0:01:19 643500 -- (-2350.799) [-2354.836] (-2352.025) (-2352.904) * [-2354.787] (-2352.401) (-2354.024) (-2353.214) -- 0:01:19 644000 -- [-2351.175] (-2351.386) (-2360.687) (-2346.954) * (-2359.385) (-2350.068) (-2353.265) [-2352.795] -- 0:01:19 644500 -- [-2351.388] (-2348.614) (-2353.350) (-2355.311) * [-2349.413] (-2361.028) (-2355.766) (-2360.231) -- 0:01:19 645000 -- (-2353.426) [-2351.715] (-2352.292) (-2352.988) * (-2360.483) (-2351.856) (-2356.817) [-2352.760] -- 0:01:19 Average standard deviation of split frequencies: 0.003101 645500 -- (-2351.725) (-2354.260) [-2350.595] (-2356.280) * (-2360.495) (-2352.128) [-2350.067] (-2347.803) -- 0:01:19 646000 -- (-2351.389) (-2350.929) (-2351.350) [-2347.433] * [-2350.853] (-2345.400) (-2351.210) (-2356.350) -- 0:01:19 646500 -- [-2356.346] (-2357.340) (-2353.995) (-2355.770) * [-2351.075] (-2355.934) (-2355.445) (-2356.694) -- 0:01:19 647000 -- (-2357.747) (-2357.297) [-2353.491] (-2356.295) * [-2346.334] (-2359.591) (-2355.824) (-2351.877) -- 0:01:19 647500 -- (-2354.856) (-2358.726) (-2353.822) [-2351.728] * (-2355.065) (-2350.790) (-2350.467) [-2351.219] -- 0:01:18 648000 -- [-2348.900] (-2352.899) (-2351.835) (-2357.233) * (-2353.978) (-2350.493) [-2353.467] (-2358.746) -- 0:01:18 648500 -- (-2352.600) (-2354.270) (-2353.559) [-2355.979] * (-2352.328) [-2348.338] (-2349.772) (-2357.145) -- 0:01:18 649000 -- (-2354.253) (-2354.945) [-2351.480] (-2348.984) * (-2352.649) [-2349.085] (-2351.990) (-2353.556) -- 0:01:18 649500 -- (-2357.933) [-2354.680] (-2355.716) (-2358.742) * (-2357.217) (-2358.321) [-2357.489] (-2356.705) -- 0:01:18 650000 -- (-2350.906) [-2351.216] (-2354.381) (-2350.564) * (-2356.316) (-2367.348) [-2348.761] (-2355.504) -- 0:01:18 Average standard deviation of split frequencies: 0.002173 650500 -- (-2352.303) (-2355.510) (-2354.724) [-2351.167] * (-2356.613) (-2367.849) (-2357.659) [-2353.501] -- 0:01:18 651000 -- [-2357.659] (-2353.285) (-2348.194) (-2350.244) * (-2354.377) (-2360.011) [-2350.737] (-2357.358) -- 0:01:18 651500 -- [-2350.334] (-2348.061) (-2363.924) (-2352.695) * (-2351.066) (-2357.366) [-2348.665] (-2352.263) -- 0:01:18 652000 -- (-2353.222) (-2350.271) [-2351.803] (-2350.406) * [-2356.786] (-2356.756) (-2347.462) (-2353.841) -- 0:01:17 652500 -- (-2361.430) [-2349.326] (-2361.462) (-2353.178) * [-2357.058] (-2360.912) (-2349.031) (-2355.048) -- 0:01:17 653000 -- (-2355.460) (-2351.212) (-2355.671) [-2349.595] * (-2358.406) (-2354.031) (-2353.911) [-2351.320] -- 0:01:17 653500 -- (-2360.856) [-2349.217] (-2362.164) (-2359.835) * (-2353.956) (-2356.403) [-2350.221] (-2354.961) -- 0:01:17 654000 -- (-2357.016) (-2355.564) [-2361.079] (-2353.329) * (-2350.283) (-2367.527) [-2354.963] (-2353.516) -- 0:01:17 654500 -- (-2356.629) (-2355.197) (-2351.018) [-2350.107] * (-2358.703) (-2355.235) [-2353.306] (-2353.085) -- 0:01:17 655000 -- (-2349.352) [-2350.871] (-2352.705) (-2362.187) * (-2352.137) (-2358.062) [-2354.100] (-2350.382) -- 0:01:17 Average standard deviation of split frequencies: 0.002515 655500 -- [-2349.302] (-2355.399) (-2360.462) (-2357.821) * [-2350.993] (-2355.769) (-2349.154) (-2353.567) -- 0:01:17 656000 -- (-2355.700) (-2348.820) (-2354.137) [-2353.222] * [-2356.894] (-2351.717) (-2353.679) (-2353.453) -- 0:01:17 656500 -- (-2354.825) [-2349.419] (-2353.810) (-2351.411) * (-2355.236) [-2350.260] (-2356.099) (-2355.075) -- 0:01:16 657000 -- [-2354.195] (-2352.792) (-2348.799) (-2352.176) * (-2355.432) (-2348.779) [-2358.920] (-2358.572) -- 0:01:16 657500 -- (-2357.075) [-2349.934] (-2353.294) (-2358.175) * (-2356.712) (-2350.826) [-2349.382] (-2354.538) -- 0:01:16 658000 -- (-2353.349) (-2355.326) [-2350.597] (-2354.185) * (-2351.667) [-2355.761] (-2348.144) (-2363.277) -- 0:01:16 658500 -- (-2350.735) [-2350.825] (-2356.311) (-2353.210) * [-2355.024] (-2351.544) (-2353.583) (-2362.555) -- 0:01:16 659000 -- (-2353.976) [-2349.864] (-2362.449) (-2350.630) * [-2355.102] (-2354.278) (-2349.425) (-2352.666) -- 0:01:16 659500 -- [-2357.182] (-2355.724) (-2354.716) (-2360.897) * (-2362.106) [-2357.975] (-2356.710) (-2352.227) -- 0:01:16 660000 -- (-2357.437) (-2355.381) [-2351.165] (-2356.482) * [-2350.066] (-2348.064) (-2358.072) (-2352.133) -- 0:01:16 Average standard deviation of split frequencies: 0.002319 660500 -- (-2353.025) (-2351.315) [-2352.530] (-2358.115) * (-2364.652) [-2356.110] (-2356.931) (-2361.548) -- 0:01:16 661000 -- (-2356.707) (-2351.278) [-2353.468] (-2352.474) * (-2355.735) (-2352.068) (-2353.389) [-2353.614] -- 0:01:15 661500 -- (-2357.428) [-2356.688] (-2350.864) (-2350.437) * [-2355.514] (-2356.869) (-2352.212) (-2357.089) -- 0:01:15 662000 -- (-2355.476) (-2363.819) (-2357.825) [-2349.918] * [-2357.357] (-2363.088) (-2353.414) (-2358.751) -- 0:01:15 662500 -- (-2359.260) (-2364.450) (-2357.488) [-2352.627] * (-2352.974) (-2356.203) (-2355.685) [-2351.422] -- 0:01:15 663000 -- [-2352.977] (-2354.974) (-2352.510) (-2357.922) * [-2350.965] (-2355.922) (-2353.887) (-2353.164) -- 0:01:15 663500 -- (-2349.187) [-2350.795] (-2354.615) (-2353.312) * [-2351.722] (-2365.926) (-2350.880) (-2350.801) -- 0:01:15 664000 -- (-2352.739) (-2352.603) (-2354.631) [-2351.378] * (-2349.659) (-2362.168) [-2348.246] (-2351.309) -- 0:01:15 664500 -- [-2347.876] (-2361.378) (-2351.483) (-2356.271) * (-2351.596) [-2354.166] (-2352.971) (-2357.710) -- 0:01:15 665000 -- (-2365.922) (-2353.812) [-2349.606] (-2353.128) * (-2349.505) [-2357.856] (-2355.854) (-2364.075) -- 0:01:15 Average standard deviation of split frequencies: 0.003185 665500 -- (-2351.367) [-2355.038] (-2356.906) (-2353.110) * (-2351.422) [-2353.739] (-2353.769) (-2366.364) -- 0:01:14 666000 -- (-2357.223) (-2350.618) [-2350.587] (-2361.139) * (-2353.363) [-2353.695] (-2349.497) (-2354.588) -- 0:01:14 666500 -- (-2351.528) (-2355.084) [-2352.157] (-2349.857) * (-2355.998) (-2356.188) [-2352.649] (-2358.967) -- 0:01:14 667000 -- (-2356.250) [-2357.218] (-2358.666) (-2358.842) * (-2351.862) [-2352.808] (-2348.824) (-2355.939) -- 0:01:14 667500 -- (-2351.158) [-2353.680] (-2354.154) (-2355.804) * (-2353.954) (-2355.846) [-2357.331] (-2357.629) -- 0:01:14 668000 -- (-2354.684) (-2349.390) [-2353.390] (-2354.564) * (-2359.128) [-2351.057] (-2355.423) (-2363.558) -- 0:01:14 668500 -- (-2357.668) (-2355.195) [-2360.645] (-2354.050) * (-2364.397) (-2362.783) (-2348.370) [-2360.768] -- 0:01:14 669000 -- (-2363.986) (-2349.201) [-2353.289] (-2354.040) * (-2359.567) (-2354.735) [-2350.691] (-2351.202) -- 0:01:14 669500 -- [-2355.960] (-2365.644) (-2352.771) (-2359.398) * [-2354.914] (-2359.408) (-2354.499) (-2353.849) -- 0:01:14 670000 -- (-2357.669) (-2351.063) [-2351.828] (-2359.951) * (-2352.831) (-2362.115) [-2353.317] (-2352.160) -- 0:01:13 Average standard deviation of split frequencies: 0.003163 670500 -- (-2355.817) (-2355.358) (-2352.060) [-2353.298] * (-2352.124) (-2355.913) [-2348.547] (-2353.493) -- 0:01:13 671000 -- (-2359.875) (-2361.785) [-2351.659] (-2347.631) * (-2346.035) [-2354.223] (-2348.036) (-2355.466) -- 0:01:13 671500 -- [-2357.764] (-2348.291) (-2351.566) (-2352.349) * (-2353.896) [-2351.713] (-2351.894) (-2353.194) -- 0:01:13 672000 -- (-2356.125) (-2351.997) [-2354.630] (-2353.447) * [-2347.874] (-2349.503) (-2353.519) (-2364.685) -- 0:01:13 672500 -- (-2356.695) (-2359.378) [-2351.755] (-2352.384) * (-2355.294) (-2359.576) (-2354.020) [-2356.464] -- 0:01:13 673000 -- [-2357.376] (-2361.744) (-2350.799) (-2353.287) * (-2353.484) (-2355.872) (-2351.088) [-2353.835] -- 0:01:13 673500 -- (-2350.076) (-2352.490) [-2357.566] (-2354.404) * (-2363.534) (-2354.998) (-2351.493) [-2348.846] -- 0:01:13 674000 -- (-2353.462) (-2359.013) [-2353.656] (-2357.165) * (-2355.067) (-2363.628) (-2353.405) [-2349.885] -- 0:01:13 674500 -- (-2360.957) (-2352.033) [-2350.994] (-2356.754) * (-2353.102) [-2356.718] (-2363.596) (-2362.939) -- 0:01:12 675000 -- (-2366.180) [-2350.576] (-2358.158) (-2349.683) * (-2355.921) [-2353.133] (-2364.209) (-2352.688) -- 0:01:12 Average standard deviation of split frequencies: 0.003487 675500 -- (-2368.943) (-2351.606) [-2358.088] (-2352.719) * [-2351.727] (-2353.441) (-2349.827) (-2355.813) -- 0:01:12 676000 -- (-2358.789) [-2348.277] (-2352.612) (-2352.102) * [-2348.614] (-2353.427) (-2354.623) (-2358.829) -- 0:01:12 676500 -- (-2363.768) (-2364.834) [-2355.629] (-2355.332) * (-2357.163) (-2353.603) [-2352.276] (-2355.830) -- 0:01:12 677000 -- (-2356.340) (-2353.333) (-2359.460) [-2355.589] * (-2360.751) (-2360.896) [-2351.422] (-2351.443) -- 0:01:12 677500 -- (-2352.039) [-2352.385] (-2353.389) (-2360.213) * (-2368.896) (-2360.122) (-2356.451) [-2350.076] -- 0:01:12 678000 -- (-2351.060) (-2351.441) [-2349.538] (-2360.183) * (-2350.728) (-2362.020) [-2359.057] (-2353.801) -- 0:01:12 678500 -- [-2353.993] (-2350.279) (-2355.909) (-2354.982) * (-2359.328) (-2354.038) [-2361.124] (-2351.033) -- 0:01:12 679000 -- (-2356.690) (-2358.337) (-2359.235) [-2352.159] * (-2355.843) (-2362.586) [-2350.478] (-2358.140) -- 0:01:11 679500 -- (-2353.984) (-2357.827) (-2352.734) [-2353.875] * (-2356.039) (-2361.152) (-2355.854) [-2348.989] -- 0:01:11 680000 -- (-2351.837) [-2349.362] (-2356.055) (-2354.404) * (-2355.514) (-2354.067) [-2350.130] (-2359.151) -- 0:01:11 Average standard deviation of split frequencies: 0.003463 680500 -- (-2358.693) (-2355.003) [-2360.619] (-2350.874) * (-2359.067) (-2355.620) (-2350.145) [-2354.882] -- 0:01:11 681000 -- (-2353.455) (-2352.945) [-2352.969] (-2353.993) * [-2354.394] (-2363.020) (-2358.854) (-2351.218) -- 0:01:11 681500 -- (-2358.562) (-2352.413) (-2356.254) [-2348.578] * (-2359.248) (-2364.261) (-2357.324) [-2355.643] -- 0:01:11 682000 -- (-2357.721) (-2358.836) (-2354.001) [-2352.515] * (-2355.900) (-2355.795) [-2352.834] (-2355.941) -- 0:01:11 682500 -- (-2352.871) [-2351.621] (-2349.788) (-2352.140) * (-2354.455) (-2356.755) (-2353.073) [-2345.673] -- 0:01:11 683000 -- (-2358.433) [-2348.773] (-2351.422) (-2356.508) * (-2357.715) (-2355.712) [-2348.760] (-2357.634) -- 0:01:11 683500 -- (-2359.312) [-2352.089] (-2355.454) (-2364.551) * [-2363.221] (-2351.271) (-2349.761) (-2350.918) -- 0:01:10 684000 -- (-2354.432) [-2356.299] (-2361.355) (-2358.165) * (-2360.608) [-2348.974] (-2354.555) (-2352.022) -- 0:01:10 684500 -- (-2351.960) (-2350.816) [-2352.759] (-2353.050) * (-2366.571) (-2351.630) (-2353.918) [-2351.868] -- 0:01:10 685000 -- (-2353.651) (-2357.800) [-2349.430] (-2354.687) * (-2363.658) (-2363.037) (-2353.602) [-2352.781] -- 0:01:10 Average standard deviation of split frequencies: 0.002921 685500 -- [-2348.785] (-2354.729) (-2361.347) (-2356.315) * (-2361.139) [-2351.714] (-2364.094) (-2357.955) -- 0:01:10 686000 -- [-2354.581] (-2352.885) (-2357.702) (-2354.786) * (-2360.103) (-2349.235) [-2349.539] (-2358.461) -- 0:01:10 686500 -- [-2353.790] (-2364.916) (-2352.137) (-2350.089) * (-2358.124) [-2360.629] (-2348.800) (-2345.150) -- 0:01:10 687000 -- (-2354.155) (-2357.855) (-2356.332) [-2357.723] * (-2353.807) (-2348.950) [-2355.934] (-2351.259) -- 0:01:10 687500 -- (-2351.761) (-2356.193) [-2356.771] (-2355.088) * (-2356.718) (-2356.508) (-2348.004) [-2351.856] -- 0:01:10 688000 -- (-2353.041) (-2353.987) [-2353.447] (-2353.706) * [-2354.578] (-2357.289) (-2353.470) (-2350.657) -- 0:01:09 688500 -- [-2351.153] (-2353.540) (-2358.751) (-2352.838) * (-2357.386) (-2359.419) [-2351.058] (-2347.214) -- 0:01:09 689000 -- (-2356.729) [-2353.456] (-2351.913) (-2362.308) * [-2348.796] (-2351.704) (-2357.392) (-2355.632) -- 0:01:09 689500 -- (-2355.387) [-2350.808] (-2358.215) (-2358.222) * [-2349.621] (-2353.336) (-2361.374) (-2356.674) -- 0:01:09 690000 -- (-2363.126) [-2353.472] (-2357.526) (-2352.653) * (-2353.983) (-2350.976) [-2353.411] (-2351.920) -- 0:01:09 Average standard deviation of split frequencies: 0.002560 690500 -- [-2351.920] (-2355.302) (-2358.193) (-2351.372) * (-2361.600) (-2354.815) [-2353.342] (-2353.977) -- 0:01:09 691000 -- (-2356.174) (-2358.103) [-2357.479] (-2356.110) * [-2350.289] (-2361.356) (-2354.066) (-2349.316) -- 0:01:09 691500 -- (-2349.872) [-2351.138] (-2357.126) (-2353.466) * (-2352.034) (-2360.069) (-2352.035) [-2356.793] -- 0:01:09 692000 -- [-2347.165] (-2356.095) (-2357.919) (-2353.342) * (-2349.448) (-2354.002) [-2353.351] (-2356.189) -- 0:01:08 692500 -- (-2357.304) (-2348.455) (-2349.843) [-2353.111] * (-2353.594) [-2352.458] (-2354.019) (-2352.723) -- 0:01:08 693000 -- (-2359.749) (-2353.106) (-2351.662) [-2362.217] * [-2350.647] (-2355.135) (-2358.779) (-2354.498) -- 0:01:08 693500 -- (-2352.125) (-2356.841) (-2352.353) [-2348.121] * [-2354.372] (-2353.460) (-2359.472) (-2352.108) -- 0:01:08 694000 -- (-2353.628) (-2357.287) (-2355.798) [-2353.443] * [-2351.325] (-2355.734) (-2351.219) (-2352.084) -- 0:01:08 694500 -- [-2350.360] (-2356.394) (-2355.668) (-2352.965) * [-2352.642] (-2351.327) (-2359.309) (-2365.139) -- 0:01:08 695000 -- (-2358.799) (-2350.915) (-2361.618) [-2347.176] * (-2356.286) [-2356.290] (-2350.036) (-2353.145) -- 0:01:08 Average standard deviation of split frequencies: 0.002709 695500 -- (-2352.433) (-2352.417) [-2356.851] (-2359.559) * [-2353.484] (-2354.600) (-2348.261) (-2358.711) -- 0:01:08 696000 -- (-2360.701) [-2352.117] (-2354.850) (-2362.129) * [-2353.694] (-2353.277) (-2357.958) (-2358.348) -- 0:01:08 696500 -- [-2349.684] (-2356.264) (-2362.856) (-2353.198) * (-2357.067) [-2356.076] (-2351.079) (-2357.596) -- 0:01:07 697000 -- (-2364.727) (-2352.619) [-2356.020] (-2357.652) * [-2346.528] (-2356.202) (-2355.558) (-2353.204) -- 0:01:07 697500 -- (-2361.042) (-2348.364) [-2357.609] (-2356.452) * (-2357.558) [-2350.024] (-2351.813) (-2352.458) -- 0:01:07 698000 -- [-2351.338] (-2356.351) (-2360.009) (-2360.486) * [-2350.453] (-2355.792) (-2356.527) (-2357.466) -- 0:01:07 698500 -- (-2354.777) (-2357.383) [-2358.599] (-2359.883) * (-2350.433) (-2353.314) [-2354.977] (-2358.697) -- 0:01:07 699000 -- (-2357.074) (-2354.885) [-2356.267] (-2352.800) * (-2354.442) [-2356.805] (-2356.324) (-2357.032) -- 0:01:07 699500 -- (-2354.035) [-2353.732] (-2358.062) (-2361.266) * (-2350.902) (-2356.430) [-2352.837] (-2359.204) -- 0:01:07 700000 -- [-2350.772] (-2352.290) (-2362.723) (-2353.101) * (-2353.337) (-2356.760) (-2350.753) [-2358.319] -- 0:01:07 Average standard deviation of split frequencies: 0.003364 700500 -- (-2350.608) (-2350.046) (-2350.631) [-2354.595] * (-2360.189) (-2353.970) [-2357.788] (-2358.879) -- 0:01:07 701000 -- [-2357.307] (-2351.936) (-2357.325) (-2353.262) * (-2357.419) [-2354.801] (-2362.408) (-2358.467) -- 0:01:06 701500 -- (-2355.924) [-2349.212] (-2357.463) (-2360.079) * (-2357.139) (-2350.526) [-2352.675] (-2351.718) -- 0:01:06 702000 -- [-2349.608] (-2354.641) (-2350.911) (-2357.491) * [-2353.429] (-2350.360) (-2363.054) (-2359.041) -- 0:01:06 702500 -- (-2349.664) (-2352.084) [-2354.229] (-2355.582) * (-2357.594) (-2362.597) [-2353.501] (-2353.604) -- 0:01:06 703000 -- (-2353.479) [-2353.172] (-2356.206) (-2353.518) * [-2353.783] (-2360.943) (-2363.795) (-2359.567) -- 0:01:06 703500 -- (-2354.523) (-2355.287) (-2359.530) [-2351.372] * [-2353.969] (-2355.761) (-2350.247) (-2352.555) -- 0:01:06 704000 -- (-2357.412) (-2351.429) [-2352.316] (-2362.767) * (-2358.089) [-2353.857] (-2348.028) (-2359.035) -- 0:01:06 704500 -- (-2347.098) (-2359.107) (-2353.741) [-2352.022] * [-2352.008] (-2354.551) (-2355.557) (-2357.395) -- 0:01:05 705000 -- (-2353.671) (-2352.701) [-2351.292] (-2356.880) * (-2349.826) (-2352.804) (-2353.422) [-2352.729] -- 0:01:06 Average standard deviation of split frequencies: 0.004173 705500 -- (-2352.775) (-2350.810) [-2351.048] (-2355.257) * (-2354.222) [-2350.780] (-2352.977) (-2349.490) -- 0:01:05 706000 -- (-2354.762) (-2355.000) (-2356.366) [-2353.179] * (-2352.208) (-2349.894) (-2361.800) [-2353.388] -- 0:01:05 706500 -- (-2360.800) (-2357.525) (-2351.289) [-2358.349] * (-2350.604) (-2365.766) (-2356.271) [-2356.266] -- 0:01:05 707000 -- (-2356.130) (-2356.629) [-2355.953] (-2352.889) * (-2354.789) (-2353.654) (-2351.617) [-2355.153] -- 0:01:05 707500 -- (-2360.464) (-2350.507) [-2352.863] (-2352.846) * (-2352.406) [-2346.436] (-2350.938) (-2353.054) -- 0:01:05 708000 -- (-2360.024) (-2355.818) [-2350.795] (-2353.827) * (-2364.129) [-2350.236] (-2352.230) (-2350.581) -- 0:01:05 708500 -- (-2363.573) [-2351.733] (-2357.253) (-2351.437) * (-2353.643) (-2356.353) (-2355.799) [-2349.910] -- 0:01:05 709000 -- (-2362.522) [-2349.225] (-2357.316) (-2355.930) * [-2358.850] (-2351.131) (-2353.457) (-2356.034) -- 0:01:04 709500 -- (-2358.430) (-2347.914) (-2350.200) [-2354.904] * (-2360.695) [-2356.252] (-2354.139) (-2351.033) -- 0:01:05 710000 -- (-2354.962) [-2348.035] (-2351.879) (-2355.125) * [-2354.377] (-2353.740) (-2351.608) (-2350.159) -- 0:01:04 Average standard deviation of split frequencies: 0.004146 710500 -- (-2363.865) (-2350.908) (-2353.046) [-2351.131] * (-2354.989) (-2354.489) [-2357.357] (-2353.304) -- 0:01:04 711000 -- [-2350.562] (-2359.004) (-2349.649) (-2352.738) * (-2353.414) [-2353.536] (-2353.281) (-2357.786) -- 0:01:04 711500 -- (-2361.314) (-2353.286) (-2360.610) [-2360.869] * (-2354.181) (-2356.566) [-2359.356] (-2364.102) -- 0:01:04 712000 -- (-2346.389) [-2352.315] (-2361.476) (-2356.869) * (-2350.778) (-2350.610) (-2355.203) [-2363.202] -- 0:01:04 712500 -- (-2348.688) (-2358.906) (-2357.107) [-2355.475] * (-2354.083) (-2353.507) [-2352.785] (-2362.332) -- 0:01:04 713000 -- (-2355.123) (-2355.539) (-2354.899) [-2354.119] * (-2352.156) (-2352.487) (-2356.094) [-2348.333] -- 0:01:04 713500 -- (-2353.544) [-2354.084] (-2355.590) (-2359.152) * [-2353.611] (-2359.411) (-2360.584) (-2353.934) -- 0:01:03 714000 -- (-2350.066) (-2350.935) [-2350.829] (-2348.746) * (-2354.923) [-2357.059] (-2363.810) (-2355.338) -- 0:01:04 714500 -- [-2347.957] (-2358.956) (-2355.866) (-2347.680) * (-2352.439) [-2356.100] (-2362.988) (-2354.518) -- 0:01:03 715000 -- (-2358.339) (-2366.064) [-2352.349] (-2348.900) * (-2357.766) (-2354.581) [-2349.426] (-2354.287) -- 0:01:03 Average standard deviation of split frequencies: 0.004773 715500 -- (-2353.079) [-2354.369] (-2349.779) (-2356.689) * (-2352.144) (-2355.849) [-2354.526] (-2353.522) -- 0:01:03 716000 -- (-2356.160) (-2357.601) [-2358.286] (-2354.152) * [-2353.799] (-2356.189) (-2350.205) (-2356.317) -- 0:01:03 716500 -- [-2350.224] (-2357.989) (-2352.729) (-2357.591) * (-2350.118) [-2354.173] (-2353.701) (-2359.697) -- 0:01:03 717000 -- (-2360.475) (-2352.821) (-2349.107) [-2360.416] * (-2348.469) [-2356.435] (-2360.165) (-2352.057) -- 0:01:03 717500 -- (-2368.366) [-2352.699] (-2357.688) (-2354.887) * (-2351.803) (-2348.958) [-2351.606] (-2353.103) -- 0:01:02 718000 -- (-2352.128) (-2360.265) (-2347.570) [-2353.516] * [-2350.483] (-2356.899) (-2354.565) (-2355.129) -- 0:01:02 718500 -- (-2348.702) (-2355.769) (-2361.867) [-2355.102] * (-2351.910) (-2349.874) (-2360.941) [-2351.694] -- 0:01:03 719000 -- (-2363.344) (-2356.626) [-2348.921] (-2359.976) * (-2366.421) (-2351.216) (-2355.069) [-2346.253] -- 0:01:02 719500 -- (-2355.765) [-2351.994] (-2352.491) (-2352.082) * [-2360.467] (-2349.374) (-2355.248) (-2353.563) -- 0:01:02 720000 -- [-2355.536] (-2355.313) (-2355.955) (-2354.605) * (-2357.321) (-2355.104) [-2349.854] (-2356.083) -- 0:01:02 Average standard deviation of split frequencies: 0.004252 720500 -- [-2351.834] (-2355.009) (-2355.205) (-2363.079) * (-2363.747) [-2350.617] (-2352.616) (-2364.389) -- 0:01:02 721000 -- (-2360.882) (-2352.364) [-2349.686] (-2351.851) * (-2354.430) (-2354.146) [-2349.185] (-2363.380) -- 0:01:02 721500 -- (-2360.660) (-2350.718) [-2351.959] (-2349.616) * (-2352.854) (-2362.334) [-2354.640] (-2354.977) -- 0:01:02 722000 -- (-2352.235) [-2357.006] (-2363.734) (-2352.035) * (-2348.473) [-2349.231] (-2350.703) (-2356.876) -- 0:01:01 722500 -- (-2367.545) (-2354.336) [-2354.900] (-2362.062) * (-2352.871) (-2354.137) [-2353.222] (-2351.163) -- 0:01:01 723000 -- (-2353.955) (-2354.215) (-2352.075) [-2358.296] * (-2353.279) (-2351.516) [-2348.226] (-2356.256) -- 0:01:02 723500 -- [-2357.183] (-2357.965) (-2354.135) (-2355.290) * (-2359.154) (-2354.039) [-2355.526] (-2353.927) -- 0:01:01 724000 -- (-2353.000) (-2358.812) [-2350.306] (-2357.799) * [-2349.989] (-2351.585) (-2353.514) (-2361.908) -- 0:01:01 724500 -- [-2350.691] (-2370.770) (-2355.836) (-2351.827) * [-2353.814] (-2354.917) (-2351.086) (-2372.243) -- 0:01:01 725000 -- (-2355.750) (-2352.467) [-2351.322] (-2351.660) * (-2357.905) (-2356.697) [-2350.756] (-2358.428) -- 0:01:01 Average standard deviation of split frequencies: 0.005032 725500 -- (-2363.425) (-2350.317) (-2349.692) [-2347.139] * (-2351.901) (-2347.672) (-2357.311) [-2353.359] -- 0:01:01 726000 -- (-2353.571) (-2357.542) [-2354.130] (-2352.012) * (-2350.178) [-2355.779] (-2362.209) (-2359.115) -- 0:01:01 726500 -- (-2353.302) (-2357.264) [-2350.588] (-2352.569) * [-2354.605] (-2350.772) (-2355.774) (-2346.721) -- 0:01:00 727000 -- [-2351.393] (-2353.160) (-2354.978) (-2357.726) * (-2354.677) [-2354.355] (-2350.294) (-2353.967) -- 0:01:00 727500 -- (-2354.625) (-2353.308) [-2350.709] (-2351.479) * [-2352.885] (-2351.634) (-2357.028) (-2360.800) -- 0:01:01 728000 -- (-2352.806) (-2356.436) [-2355.133] (-2351.590) * (-2352.061) [-2350.501] (-2350.024) (-2351.295) -- 0:01:00 728500 -- (-2348.177) (-2357.399) (-2362.238) [-2358.130] * (-2357.004) [-2349.559] (-2361.174) (-2355.092) -- 0:01:00 729000 -- (-2356.420) [-2352.677] (-2354.940) (-2354.579) * (-2351.780) (-2354.664) [-2354.055] (-2356.745) -- 0:01:00 729500 -- [-2354.458] (-2355.050) (-2355.976) (-2358.396) * (-2348.307) (-2355.461) [-2352.594] (-2358.037) -- 0:01:00 730000 -- [-2353.844] (-2352.930) (-2362.938) (-2355.462) * (-2347.971) [-2347.522] (-2346.851) (-2350.355) -- 0:01:00 Average standard deviation of split frequencies: 0.004355 730500 -- (-2351.329) (-2351.510) (-2355.303) [-2354.682] * (-2352.984) (-2348.244) [-2352.941] (-2352.402) -- 0:01:00 731000 -- (-2359.192) (-2351.725) (-2357.370) [-2354.224] * (-2352.221) (-2351.646) (-2353.431) [-2348.771] -- 0:00:59 731500 -- (-2351.917) (-2357.828) [-2357.490] (-2351.035) * (-2354.257) [-2353.749] (-2352.441) (-2353.139) -- 0:00:59 732000 -- (-2350.295) (-2352.149) (-2358.314) [-2350.346] * [-2354.682] (-2356.204) (-2357.159) (-2356.796) -- 0:01:00 732500 -- (-2353.146) (-2356.987) (-2364.223) [-2356.166] * [-2351.469] (-2357.671) (-2355.567) (-2355.133) -- 0:00:59 733000 -- (-2353.836) [-2356.438] (-2358.023) (-2352.538) * [-2359.313] (-2356.425) (-2355.342) (-2352.443) -- 0:00:59 733500 -- (-2353.712) (-2357.919) (-2358.721) [-2360.083] * (-2357.477) (-2356.551) [-2351.264] (-2362.950) -- 0:00:59 734000 -- [-2358.458] (-2354.551) (-2365.401) (-2362.961) * (-2349.603) [-2357.986] (-2348.352) (-2357.362) -- 0:00:59 734500 -- [-2352.323] (-2349.253) (-2365.201) (-2351.585) * (-2352.871) [-2355.075] (-2359.333) (-2361.602) -- 0:00:59 735000 -- (-2352.163) [-2350.497] (-2363.227) (-2349.654) * (-2365.293) [-2350.756] (-2361.512) (-2361.365) -- 0:00:59 Average standard deviation of split frequencies: 0.004163 735500 -- (-2358.316) (-2360.710) [-2353.252] (-2354.063) * (-2349.983) (-2350.931) [-2356.312] (-2372.628) -- 0:00:58 736000 -- (-2350.076) (-2355.519) [-2351.149] (-2353.696) * (-2354.793) (-2356.341) [-2350.401] (-2358.213) -- 0:00:58 736500 -- (-2349.173) (-2354.101) (-2357.520) [-2349.026] * (-2359.511) [-2351.851] (-2350.642) (-2363.477) -- 0:00:59 737000 -- (-2355.897) (-2356.005) (-2352.796) [-2354.863] * (-2353.792) [-2352.076] (-2356.655) (-2354.637) -- 0:00:58 737500 -- (-2360.190) (-2352.843) [-2352.260] (-2355.222) * (-2355.014) (-2358.070) (-2354.865) [-2352.721] -- 0:00:58 738000 -- (-2350.012) [-2354.048] (-2349.462) (-2353.101) * (-2367.718) (-2348.712) (-2351.037) [-2351.593] -- 0:00:58 738500 -- (-2349.277) [-2357.882] (-2346.577) (-2352.205) * (-2350.036) (-2352.037) [-2356.331] (-2356.907) -- 0:00:58 739000 -- [-2354.423] (-2348.823) (-2356.239) (-2354.601) * (-2355.127) [-2347.857] (-2358.555) (-2357.622) -- 0:00:58 739500 -- (-2351.965) (-2354.936) [-2351.201] (-2354.768) * (-2355.469) (-2360.641) (-2354.377) [-2355.361] -- 0:00:58 740000 -- (-2355.391) [-2352.256] (-2357.321) (-2349.576) * [-2352.602] (-2359.895) (-2351.664) (-2357.057) -- 0:00:57 Average standard deviation of split frequencies: 0.004933 740500 -- (-2352.973) (-2353.523) (-2359.844) [-2354.854] * (-2357.259) [-2352.778] (-2354.023) (-2358.207) -- 0:00:57 741000 -- [-2353.383] (-2354.484) (-2356.459) (-2355.076) * (-2357.174) [-2357.305] (-2352.691) (-2360.602) -- 0:00:58 741500 -- (-2350.285) [-2350.059] (-2351.670) (-2357.427) * (-2356.502) (-2357.904) (-2355.204) [-2353.621] -- 0:00:57 742000 -- [-2349.920] (-2355.915) (-2357.887) (-2355.150) * (-2360.402) [-2351.435] (-2355.416) (-2353.293) -- 0:00:57 742500 -- (-2355.923) [-2346.809] (-2353.033) (-2357.707) * (-2359.684) [-2348.718] (-2355.634) (-2354.761) -- 0:00:57 743000 -- (-2351.692) (-2353.459) [-2354.846] (-2349.822) * (-2356.235) [-2351.208] (-2356.767) (-2364.354) -- 0:00:57 743500 -- [-2349.526] (-2349.714) (-2360.996) (-2351.947) * (-2362.405) [-2349.087] (-2358.033) (-2353.569) -- 0:00:57 744000 -- (-2353.747) [-2354.568] (-2360.032) (-2348.206) * [-2357.632] (-2359.465) (-2352.776) (-2361.957) -- 0:00:57 744500 -- (-2355.519) (-2357.555) [-2354.502] (-2358.342) * (-2353.370) (-2350.845) [-2353.029] (-2357.421) -- 0:00:56 745000 -- (-2357.708) (-2352.988) (-2360.819) [-2352.499] * (-2356.094) (-2355.775) (-2355.042) [-2355.139] -- 0:00:56 Average standard deviation of split frequencies: 0.004581 745500 -- (-2356.929) (-2354.515) (-2358.817) [-2354.982] * (-2356.023) (-2353.401) [-2350.462] (-2355.463) -- 0:00:57 746000 -- (-2352.764) [-2346.793] (-2354.699) (-2357.402) * (-2363.894) (-2359.131) (-2357.305) [-2350.238] -- 0:00:56 746500 -- (-2358.596) (-2351.798) (-2357.728) [-2346.413] * [-2359.994] (-2362.783) (-2357.408) (-2351.106) -- 0:00:56 747000 -- [-2351.492] (-2352.970) (-2356.322) (-2355.006) * [-2349.614] (-2358.252) (-2352.306) (-2350.948) -- 0:00:56 747500 -- (-2357.636) [-2361.911] (-2358.801) (-2356.396) * (-2351.212) (-2362.957) (-2352.133) [-2350.202] -- 0:00:56 748000 -- (-2352.635) (-2352.919) (-2351.921) [-2354.324] * (-2359.581) (-2356.258) [-2355.663] (-2349.826) -- 0:00:56 748500 -- (-2351.899) (-2357.255) (-2351.146) [-2353.882] * (-2355.117) (-2360.164) [-2353.120] (-2361.047) -- 0:00:56 749000 -- [-2350.217] (-2351.524) (-2358.083) (-2352.774) * (-2348.383) (-2360.741) [-2350.287] (-2354.033) -- 0:00:55 749500 -- (-2356.237) [-2353.320] (-2353.688) (-2361.330) * (-2348.674) [-2355.782] (-2354.448) (-2350.815) -- 0:00:55 750000 -- [-2358.742] (-2352.660) (-2350.702) (-2352.927) * (-2355.796) (-2356.145) (-2359.145) [-2347.568] -- 0:00:56 Average standard deviation of split frequencies: 0.006123 750500 -- (-2362.841) (-2352.365) (-2350.405) [-2356.943] * (-2355.025) (-2356.896) [-2356.493] (-2350.130) -- 0:00:55 751000 -- (-2361.787) (-2359.194) (-2352.344) [-2351.671] * [-2356.975] (-2364.786) (-2362.382) (-2353.255) -- 0:00:55 751500 -- [-2355.828] (-2352.700) (-2349.675) (-2353.327) * (-2363.321) (-2363.079) [-2356.427] (-2357.553) -- 0:00:55 752000 -- (-2354.152) (-2353.844) (-2362.499) [-2351.678] * (-2371.114) (-2361.361) [-2355.058] (-2356.664) -- 0:00:55 752500 -- (-2357.556) (-2352.648) (-2353.628) [-2353.783] * (-2357.154) (-2352.335) (-2356.663) [-2358.656] -- 0:00:55 753000 -- [-2351.093] (-2356.260) (-2349.449) (-2348.138) * (-2356.335) [-2357.695] (-2353.703) (-2357.730) -- 0:00:55 753500 -- [-2351.293] (-2354.456) (-2354.728) (-2367.992) * (-2357.773) (-2355.962) [-2353.582] (-2352.384) -- 0:00:54 754000 -- (-2354.009) (-2367.199) (-2351.356) [-2352.207] * (-2355.160) (-2356.726) [-2353.178] (-2355.215) -- 0:00:55 754500 -- [-2353.038] (-2354.212) (-2356.799) (-2355.014) * (-2349.542) (-2360.415) (-2352.240) [-2349.541] -- 0:00:54 755000 -- [-2355.205] (-2360.547) (-2352.493) (-2359.402) * (-2353.744) [-2362.504] (-2356.774) (-2354.683) -- 0:00:54 Average standard deviation of split frequencies: 0.006236 755500 -- (-2351.480) (-2364.045) (-2352.946) [-2355.277] * (-2355.942) [-2355.156] (-2361.108) (-2359.081) -- 0:00:54 756000 -- (-2354.280) (-2360.285) [-2350.142] (-2351.351) * [-2350.284] (-2356.112) (-2356.173) (-2353.931) -- 0:00:54 756500 -- (-2357.574) (-2351.779) (-2347.780) [-2356.514] * [-2351.482] (-2350.931) (-2356.992) (-2352.415) -- 0:00:54 757000 -- (-2357.594) (-2370.423) (-2352.224) [-2349.045] * (-2349.833) (-2352.167) (-2355.822) [-2356.465] -- 0:00:54 757500 -- (-2354.877) (-2349.881) [-2357.756] (-2357.134) * [-2351.086] (-2353.307) (-2359.765) (-2350.313) -- 0:00:54 758000 -- (-2361.026) (-2352.219) [-2353.875] (-2352.485) * (-2361.288) (-2354.339) (-2358.538) [-2356.715] -- 0:00:53 758500 -- (-2354.866) (-2359.328) [-2362.613] (-2353.117) * (-2356.734) (-2356.480) [-2358.066] (-2353.541) -- 0:00:54 759000 -- (-2349.122) [-2353.205] (-2364.049) (-2362.870) * (-2352.313) (-2355.369) [-2359.635] (-2358.893) -- 0:00:53 759500 -- (-2363.946) [-2351.744] (-2356.972) (-2359.395) * (-2352.551) (-2358.990) (-2357.440) [-2357.588] -- 0:00:53 760000 -- (-2359.077) (-2357.739) (-2350.271) [-2349.347] * (-2357.567) [-2349.690] (-2356.624) (-2350.518) -- 0:00:53 Average standard deviation of split frequencies: 0.007282 760500 -- (-2360.788) (-2351.371) [-2358.109] (-2350.947) * (-2349.975) [-2349.587] (-2356.246) (-2355.774) -- 0:00:53 761000 -- (-2364.622) (-2352.907) (-2352.189) [-2350.794] * (-2356.529) (-2353.061) [-2348.868] (-2348.669) -- 0:00:53 761500 -- (-2352.979) (-2355.160) [-2353.215] (-2360.954) * (-2353.325) (-2352.680) [-2347.012] (-2359.853) -- 0:00:53 762000 -- (-2357.248) (-2363.032) [-2349.292] (-2355.176) * (-2350.365) (-2362.765) (-2354.224) [-2351.061] -- 0:00:53 762500 -- (-2351.093) [-2360.303] (-2347.983) (-2352.760) * (-2356.298) [-2355.499] (-2354.625) (-2353.693) -- 0:00:52 763000 -- [-2365.945] (-2356.668) (-2356.595) (-2355.414) * (-2360.997) (-2351.781) (-2352.614) [-2349.508] -- 0:00:53 763500 -- (-2357.122) (-2361.898) [-2350.691] (-2353.015) * (-2353.646) (-2370.431) [-2355.899] (-2353.742) -- 0:00:52 764000 -- (-2363.135) (-2358.100) (-2349.026) [-2353.656] * (-2356.781) (-2357.718) (-2355.324) [-2351.648] -- 0:00:52 764500 -- (-2354.377) [-2358.603] (-2355.707) (-2351.695) * (-2363.658) [-2350.679] (-2351.264) (-2354.261) -- 0:00:52 765000 -- (-2354.449) (-2350.181) [-2350.420] (-2354.108) * (-2353.874) (-2355.469) [-2355.802] (-2350.807) -- 0:00:52 Average standard deviation of split frequencies: 0.007231 765500 -- (-2358.806) [-2347.679] (-2360.618) (-2360.258) * [-2347.355] (-2358.810) (-2350.353) (-2357.635) -- 0:00:52 766000 -- (-2353.070) (-2350.405) (-2356.234) [-2348.189] * [-2357.634] (-2358.169) (-2358.659) (-2357.408) -- 0:00:52 766500 -- [-2356.572] (-2357.152) (-2354.464) (-2352.826) * (-2349.720) [-2355.414] (-2354.729) (-2356.233) -- 0:00:52 767000 -- (-2350.210) (-2355.499) (-2360.919) [-2352.153] * (-2350.104) (-2356.787) (-2350.717) [-2352.369] -- 0:00:52 767500 -- (-2355.781) (-2352.742) [-2353.141] (-2351.199) * (-2357.099) (-2351.127) [-2351.522] (-2357.963) -- 0:00:52 768000 -- (-2362.172) [-2355.162] (-2360.717) (-2354.997) * (-2354.493) (-2347.395) [-2352.918] (-2347.530) -- 0:00:51 768500 -- (-2359.280) [-2354.191] (-2352.880) (-2351.632) * (-2356.315) (-2350.809) (-2358.085) [-2353.676] -- 0:00:51 769000 -- (-2352.341) (-2358.170) (-2354.565) [-2351.156] * (-2354.138) (-2356.798) [-2360.132] (-2351.267) -- 0:00:51 769500 -- (-2351.120) (-2358.137) (-2360.771) [-2352.842] * (-2353.855) (-2356.857) [-2352.275] (-2353.559) -- 0:00:51 770000 -- (-2348.156) [-2354.702] (-2354.092) (-2356.235) * [-2350.209] (-2363.638) (-2350.692) (-2357.600) -- 0:00:51 Average standard deviation of split frequencies: 0.006881 770500 -- (-2351.177) (-2358.279) [-2352.722] (-2356.454) * (-2350.357) [-2361.608] (-2355.627) (-2354.510) -- 0:00:51 771000 -- (-2356.513) (-2357.164) [-2351.270] (-2349.812) * (-2350.515) [-2357.419] (-2360.990) (-2351.261) -- 0:00:51 771500 -- (-2356.688) (-2368.179) (-2356.353) [-2353.736] * [-2352.813] (-2359.123) (-2356.206) (-2353.421) -- 0:00:51 772000 -- (-2359.725) (-2350.126) [-2350.237] (-2362.553) * (-2357.163) (-2361.117) (-2356.382) [-2357.535] -- 0:00:51 772500 -- (-2359.385) [-2351.527] (-2355.234) (-2354.039) * [-2354.113] (-2354.251) (-2357.468) (-2353.853) -- 0:00:50 773000 -- (-2353.826) [-2353.316] (-2352.665) (-2354.946) * (-2358.742) (-2356.840) [-2352.170] (-2360.233) -- 0:00:50 773500 -- (-2352.380) (-2357.882) (-2350.233) [-2355.173] * (-2359.611) (-2356.616) (-2348.931) [-2355.298] -- 0:00:50 774000 -- (-2352.291) (-2358.579) (-2355.763) [-2349.484] * (-2358.368) (-2354.655) [-2353.502] (-2352.926) -- 0:00:50 774500 -- (-2356.398) [-2348.295] (-2350.577) (-2355.543) * (-2357.735) (-2349.856) (-2356.186) [-2353.668] -- 0:00:50 775000 -- (-2355.005) (-2353.102) (-2354.010) [-2348.945] * (-2358.944) [-2353.695] (-2348.736) (-2352.789) -- 0:00:50 Average standard deviation of split frequencies: 0.007442 775500 -- (-2348.070) (-2362.263) [-2353.010] (-2352.711) * (-2351.821) [-2352.827] (-2359.755) (-2362.509) -- 0:00:50 776000 -- (-2348.222) (-2356.837) [-2352.165] (-2359.415) * (-2354.330) (-2351.855) (-2347.568) [-2351.882] -- 0:00:50 776500 -- (-2353.348) (-2350.297) [-2354.611] (-2356.810) * (-2354.566) (-2357.103) (-2356.143) [-2351.867] -- 0:00:50 777000 -- [-2349.496] (-2353.054) (-2355.704) (-2358.906) * [-2347.582] (-2352.950) (-2350.777) (-2363.257) -- 0:00:49 777500 -- [-2355.706] (-2350.689) (-2358.311) (-2354.520) * (-2364.657) (-2353.795) (-2352.767) [-2351.021] -- 0:00:49 778000 -- [-2353.234] (-2349.495) (-2353.317) (-2361.270) * (-2353.181) (-2359.198) (-2353.631) [-2355.518] -- 0:00:49 778500 -- (-2353.336) [-2353.310] (-2355.606) (-2356.490) * [-2350.676] (-2363.380) (-2358.913) (-2356.293) -- 0:00:49 779000 -- (-2356.917) (-2351.635) (-2360.696) [-2358.221] * [-2350.288] (-2345.966) (-2351.121) (-2349.170) -- 0:00:49 779500 -- (-2350.050) (-2353.788) (-2361.137) [-2357.816] * (-2350.230) (-2355.389) (-2353.868) [-2355.994] -- 0:00:49 780000 -- [-2350.853] (-2359.867) (-2357.672) (-2357.833) * (-2370.796) (-2360.742) [-2359.251] (-2353.272) -- 0:00:49 Average standard deviation of split frequencies: 0.007246 780500 -- (-2353.957) (-2355.041) (-2352.174) [-2350.727] * (-2355.354) (-2366.165) [-2351.885] (-2362.754) -- 0:00:49 781000 -- [-2357.994] (-2348.563) (-2354.842) (-2354.110) * (-2352.434) (-2362.717) (-2350.602) [-2354.257] -- 0:00:49 781500 -- (-2348.572) (-2349.146) [-2356.425] (-2354.281) * (-2352.242) (-2360.395) [-2359.331] (-2351.024) -- 0:00:48 782000 -- (-2356.948) [-2352.049] (-2355.409) (-2353.092) * (-2356.055) (-2361.749) (-2346.410) [-2350.234] -- 0:00:48 782500 -- [-2353.224] (-2357.374) (-2358.783) (-2350.687) * (-2353.044) (-2358.352) [-2346.558] (-2361.652) -- 0:00:48 783000 -- (-2352.753) (-2353.464) (-2355.249) [-2349.442] * (-2353.749) [-2351.969] (-2352.349) (-2358.517) -- 0:00:48 783500 -- (-2350.886) [-2347.245] (-2353.426) (-2350.260) * (-2360.932) (-2349.533) (-2355.460) [-2357.543] -- 0:00:48 784000 -- [-2358.889] (-2356.784) (-2350.438) (-2349.223) * [-2350.556] (-2362.626) (-2346.660) (-2355.132) -- 0:00:48 784500 -- (-2357.769) (-2350.862) [-2352.059] (-2353.946) * (-2357.281) (-2358.091) (-2355.824) [-2352.749] -- 0:00:48 785000 -- [-2351.362] (-2352.578) (-2352.236) (-2355.615) * (-2359.797) [-2350.877] (-2362.983) (-2357.527) -- 0:00:48 Average standard deviation of split frequencies: 0.006597 785500 -- [-2352.959] (-2356.707) (-2348.636) (-2353.944) * [-2348.063] (-2355.175) (-2353.866) (-2353.143) -- 0:00:48 786000 -- (-2352.861) [-2352.641] (-2360.671) (-2358.458) * (-2353.195) (-2352.470) [-2352.418] (-2351.428) -- 0:00:47 786500 -- (-2354.101) [-2349.850] (-2359.119) (-2351.319) * [-2357.876] (-2356.753) (-2353.360) (-2355.898) -- 0:00:47 787000 -- (-2348.613) (-2368.374) (-2359.651) [-2354.169] * [-2358.752] (-2359.628) (-2352.455) (-2349.962) -- 0:00:47 787500 -- (-2361.185) (-2360.367) (-2356.549) [-2360.229] * [-2359.760] (-2357.381) (-2349.170) (-2354.401) -- 0:00:47 788000 -- (-2350.875) (-2362.872) [-2353.856] (-2361.256) * (-2354.466) (-2363.663) [-2349.036] (-2357.511) -- 0:00:47 788500 -- (-2356.387) (-2353.749) (-2349.012) [-2355.590] * [-2351.782] (-2357.964) (-2352.640) (-2356.162) -- 0:00:47 789000 -- [-2358.831] (-2350.980) (-2350.024) (-2349.762) * (-2356.793) (-2352.762) (-2356.778) [-2351.788] -- 0:00:47 789500 -- [-2353.616] (-2353.955) (-2350.665) (-2351.942) * (-2355.068) (-2364.331) [-2356.956] (-2354.125) -- 0:00:47 790000 -- (-2355.949) [-2362.033] (-2349.866) (-2350.039) * (-2356.787) (-2358.779) [-2357.602] (-2355.448) -- 0:00:47 Average standard deviation of split frequencies: 0.007453 790500 -- (-2360.184) [-2356.037] (-2358.847) (-2351.930) * (-2354.583) [-2354.421] (-2354.484) (-2362.252) -- 0:00:46 791000 -- (-2359.863) (-2353.516) [-2353.434] (-2353.143) * (-2358.754) [-2359.140] (-2352.651) (-2350.578) -- 0:00:46 791500 -- (-2362.144) (-2359.936) [-2351.011] (-2345.359) * (-2357.719) (-2351.943) (-2351.226) [-2355.348] -- 0:00:46 792000 -- (-2353.477) [-2355.530] (-2353.404) (-2362.572) * (-2355.866) (-2349.759) (-2352.651) [-2354.583] -- 0:00:46 792500 -- (-2362.330) [-2357.536] (-2355.484) (-2359.241) * [-2352.703] (-2361.381) (-2350.022) (-2356.372) -- 0:00:46 793000 -- (-2352.421) (-2357.976) [-2360.523] (-2353.482) * [-2350.334] (-2354.693) (-2355.292) (-2351.026) -- 0:00:46 793500 -- (-2360.211) (-2353.209) [-2352.238] (-2356.505) * (-2352.443) (-2360.203) [-2353.037] (-2348.245) -- 0:00:46 794000 -- (-2358.199) [-2360.093] (-2349.647) (-2359.466) * (-2352.785) [-2356.959] (-2365.818) (-2346.906) -- 0:00:46 794500 -- (-2350.336) [-2353.664] (-2364.259) (-2354.545) * (-2357.546) (-2355.959) [-2353.256] (-2358.768) -- 0:00:46 795000 -- (-2356.863) (-2356.424) (-2354.391) [-2354.233] * [-2357.476] (-2356.259) (-2360.405) (-2362.479) -- 0:00:45 Average standard deviation of split frequencies: 0.005774 795500 -- (-2356.895) (-2352.457) (-2353.313) [-2359.104] * (-2349.262) [-2356.366] (-2355.784) (-2350.206) -- 0:00:45 796000 -- (-2354.813) [-2351.531] (-2361.923) (-2351.608) * (-2358.911) (-2359.067) [-2359.250] (-2364.097) -- 0:00:45 796500 -- [-2358.430] (-2363.832) (-2353.796) (-2348.854) * (-2363.302) [-2352.402] (-2353.209) (-2353.363) -- 0:00:45 797000 -- [-2361.509] (-2351.856) (-2361.869) (-2352.804) * [-2352.631] (-2350.532) (-2359.877) (-2354.009) -- 0:00:45 797500 -- (-2360.219) [-2349.880] (-2360.265) (-2357.200) * (-2358.256) [-2351.390] (-2355.665) (-2355.087) -- 0:00:45 798000 -- (-2354.531) [-2352.873] (-2354.314) (-2351.535) * (-2357.607) (-2353.051) [-2351.866] (-2351.795) -- 0:00:45 798500 -- (-2351.632) (-2355.858) [-2349.240] (-2354.552) * (-2355.408) (-2353.682) (-2355.858) [-2352.090] -- 0:00:45 799000 -- [-2357.316] (-2357.155) (-2348.836) (-2346.832) * (-2361.252) (-2356.656) (-2361.231) [-2350.514] -- 0:00:45 799500 -- (-2361.011) (-2348.925) [-2361.352] (-2349.877) * (-2355.778) [-2359.334] (-2349.139) (-2364.712) -- 0:00:44 800000 -- (-2352.235) (-2351.899) [-2351.763] (-2352.712) * (-2359.285) (-2363.535) (-2354.019) [-2355.734] -- 0:00:44 Average standard deviation of split frequencies: 0.004857 800500 -- (-2361.103) (-2354.000) (-2350.117) [-2356.269] * (-2354.975) [-2357.836] (-2364.426) (-2365.039) -- 0:00:44 801000 -- (-2352.638) [-2348.202] (-2350.830) (-2358.758) * (-2369.747) [-2356.232] (-2353.799) (-2353.785) -- 0:00:44 801500 -- [-2348.218] (-2366.900) (-2353.914) (-2354.629) * (-2351.701) (-2355.322) [-2348.495] (-2354.125) -- 0:00:44 802000 -- [-2352.205] (-2357.194) (-2349.418) (-2356.906) * (-2351.589) (-2366.347) (-2348.639) [-2347.303] -- 0:00:44 802500 -- (-2351.738) (-2354.875) (-2356.949) [-2357.373] * (-2356.241) (-2347.541) (-2358.668) [-2354.007] -- 0:00:44 803000 -- [-2351.158] (-2352.167) (-2347.434) (-2357.393) * [-2356.468] (-2352.449) (-2357.978) (-2354.325) -- 0:00:44 803500 -- (-2352.955) [-2349.336] (-2362.143) (-2355.706) * (-2353.669) (-2350.213) (-2355.799) [-2352.748] -- 0:00:44 804000 -- [-2356.862] (-2351.456) (-2356.552) (-2355.167) * (-2349.521) (-2350.889) (-2352.384) [-2350.747] -- 0:00:43 804500 -- [-2353.211] (-2352.846) (-2356.567) (-2351.192) * (-2355.550) (-2353.135) [-2346.168] (-2353.643) -- 0:00:43 805000 -- (-2356.619) (-2360.882) [-2350.202] (-2350.437) * [-2354.545] (-2363.244) (-2355.589) (-2355.398) -- 0:00:43 Average standard deviation of split frequencies: 0.004533 805500 -- [-2354.576] (-2354.704) (-2353.209) (-2352.537) * (-2351.541) (-2357.136) (-2357.311) [-2354.346] -- 0:00:43 806000 -- (-2353.957) [-2353.462] (-2353.238) (-2359.327) * (-2352.618) [-2358.955] (-2358.707) (-2354.475) -- 0:00:43 806500 -- (-2348.090) (-2350.944) (-2358.518) [-2352.863] * (-2366.703) [-2353.184] (-2360.776) (-2356.206) -- 0:00:43 807000 -- [-2348.988] (-2356.942) (-2356.732) (-2356.322) * (-2350.598) (-2356.829) [-2351.999] (-2348.872) -- 0:00:43 807500 -- (-2355.088) (-2357.958) (-2352.763) [-2350.222] * (-2365.188) (-2353.417) [-2354.976] (-2352.903) -- 0:00:43 808000 -- (-2349.899) [-2347.766] (-2356.759) (-2349.587) * (-2356.736) (-2361.157) [-2350.376] (-2356.601) -- 0:00:43 808500 -- (-2357.699) (-2355.985) (-2357.199) [-2354.404] * (-2358.713) (-2361.181) [-2359.746] (-2366.954) -- 0:00:42 809000 -- (-2351.868) [-2351.327] (-2357.291) (-2355.778) * (-2348.920) (-2361.081) [-2355.497] (-2357.716) -- 0:00:42 809500 -- (-2351.675) [-2349.031] (-2352.956) (-2353.014) * (-2352.744) (-2357.587) [-2352.391] (-2360.472) -- 0:00:42 810000 -- (-2348.897) (-2352.242) (-2348.358) [-2357.415] * (-2348.946) [-2355.600] (-2357.596) (-2364.190) -- 0:00:42 Average standard deviation of split frequencies: 0.004071 810500 -- (-2350.814) [-2355.990] (-2351.750) (-2359.243) * [-2350.847] (-2348.267) (-2358.280) (-2354.070) -- 0:00:42 811000 -- (-2353.189) (-2355.827) [-2348.813] (-2356.594) * (-2350.616) (-2356.554) [-2352.485] (-2355.352) -- 0:00:42 811500 -- (-2351.798) [-2351.971] (-2348.582) (-2355.138) * (-2356.638) (-2355.504) [-2353.998] (-2362.499) -- 0:00:42 812000 -- [-2354.293] (-2347.911) (-2350.685) (-2354.353) * [-2358.528] (-2359.607) (-2354.875) (-2357.087) -- 0:00:42 812500 -- (-2349.977) (-2355.325) (-2360.771) [-2352.972] * (-2362.280) (-2364.407) [-2358.054] (-2360.819) -- 0:00:42 813000 -- (-2352.002) (-2351.971) (-2358.381) [-2353.002] * (-2361.165) (-2360.562) [-2356.677] (-2359.081) -- 0:00:41 813500 -- [-2353.593] (-2351.540) (-2359.145) (-2357.144) * (-2353.923) (-2351.105) (-2351.730) [-2352.114] -- 0:00:41 814000 -- (-2351.644) [-2349.586] (-2357.032) (-2353.418) * (-2351.066) (-2360.824) [-2354.897] (-2353.655) -- 0:00:41 814500 -- [-2356.494] (-2359.145) (-2367.609) (-2362.190) * [-2345.928] (-2355.754) (-2354.742) (-2355.673) -- 0:00:41 815000 -- (-2360.076) [-2349.697] (-2358.178) (-2361.414) * (-2353.150) [-2349.716] (-2366.358) (-2353.046) -- 0:00:41 Average standard deviation of split frequencies: 0.003899 815500 -- (-2358.695) [-2354.006] (-2355.077) (-2352.291) * [-2355.789] (-2349.197) (-2349.847) (-2347.039) -- 0:00:41 816000 -- (-2356.684) (-2356.035) [-2354.205] (-2361.510) * [-2353.416] (-2355.320) (-2353.617) (-2349.053) -- 0:00:41 816500 -- (-2351.840) [-2350.945] (-2352.332) (-2352.798) * (-2353.235) (-2353.803) (-2354.730) [-2352.529] -- 0:00:41 817000 -- (-2357.463) (-2354.967) [-2356.276] (-2349.788) * (-2357.637) (-2352.351) [-2354.169] (-2357.935) -- 0:00:40 817500 -- (-2355.949) [-2353.026] (-2355.589) (-2351.830) * [-2356.677] (-2358.218) (-2353.162) (-2359.834) -- 0:00:40 818000 -- [-2355.856] (-2357.985) (-2355.974) (-2356.261) * (-2353.355) (-2361.837) (-2356.358) [-2354.797] -- 0:00:40 818500 -- (-2358.382) [-2353.794] (-2353.211) (-2348.050) * (-2351.662) [-2351.467] (-2357.272) (-2352.320) -- 0:00:40 819000 -- (-2358.084) (-2350.716) (-2352.275) [-2352.034] * (-2348.658) [-2358.538] (-2356.275) (-2345.910) -- 0:00:40 819500 -- (-2354.352) [-2353.079] (-2360.557) (-2351.171) * [-2357.645] (-2354.724) (-2356.126) (-2357.097) -- 0:00:40 820000 -- (-2364.524) (-2350.995) [-2350.675] (-2354.915) * [-2361.329] (-2355.427) (-2356.323) (-2351.333) -- 0:00:40 Average standard deviation of split frequencies: 0.005601 820500 -- (-2355.240) [-2347.130] (-2352.445) (-2353.811) * [-2353.340] (-2351.272) (-2357.821) (-2353.441) -- 0:00:40 821000 -- [-2356.442] (-2353.457) (-2354.824) (-2354.645) * (-2354.096) (-2356.734) [-2355.685] (-2355.652) -- 0:00:40 821500 -- (-2357.311) [-2352.846] (-2351.557) (-2358.025) * (-2357.605) (-2354.345) [-2352.346] (-2357.983) -- 0:00:39 822000 -- (-2357.654) (-2354.102) (-2354.553) [-2358.230] * (-2361.615) [-2349.667] (-2353.856) (-2355.362) -- 0:00:39 822500 -- (-2356.567) (-2356.982) (-2350.986) [-2348.475] * (-2363.059) [-2353.724] (-2352.718) (-2354.344) -- 0:00:39 823000 -- (-2366.444) (-2363.549) [-2349.156] (-2354.433) * (-2353.364) (-2352.865) (-2348.146) [-2351.843] -- 0:00:39 823500 -- (-2360.994) (-2351.769) [-2353.038] (-2352.282) * (-2360.795) (-2352.149) [-2358.118] (-2354.009) -- 0:00:39 824000 -- (-2351.361) [-2355.416] (-2357.817) (-2357.589) * (-2350.244) (-2362.957) [-2356.821] (-2360.910) -- 0:00:39 824500 -- (-2357.612) [-2348.593] (-2349.901) (-2355.791) * (-2350.861) (-2362.535) (-2360.804) [-2358.222] -- 0:00:39 825000 -- (-2356.298) (-2356.181) (-2355.968) [-2351.902] * (-2353.336) (-2364.122) [-2356.115] (-2355.454) -- 0:00:39 Average standard deviation of split frequencies: 0.005992 825500 -- (-2368.518) [-2346.908] (-2349.668) (-2347.662) * (-2354.659) (-2355.200) (-2355.233) [-2359.581] -- 0:00:39 826000 -- (-2358.077) (-2353.713) [-2347.974] (-2354.909) * [-2355.946] (-2352.731) (-2351.893) (-2355.574) -- 0:00:38 826500 -- [-2359.103] (-2355.631) (-2350.945) (-2354.025) * [-2354.881] (-2355.491) (-2356.007) (-2350.924) -- 0:00:38 827000 -- (-2357.614) (-2354.602) (-2352.416) [-2348.882] * (-2349.924) (-2357.635) (-2353.897) [-2348.848] -- 0:00:38 827500 -- (-2357.877) (-2349.979) (-2356.670) [-2356.091] * (-2349.819) [-2352.364] (-2353.606) (-2353.615) -- 0:00:38 828000 -- (-2350.958) [-2350.781] (-2360.604) (-2351.651) * (-2352.192) (-2358.665) (-2359.487) [-2355.411] -- 0:00:38 828500 -- (-2359.320) [-2356.995] (-2353.672) (-2352.630) * [-2349.762] (-2349.326) (-2354.463) (-2359.870) -- 0:00:38 829000 -- (-2352.147) [-2353.260] (-2354.107) (-2350.178) * (-2354.733) (-2353.224) (-2351.452) [-2345.987] -- 0:00:38 829500 -- (-2355.751) (-2356.028) (-2352.945) [-2362.964] * (-2357.853) (-2358.191) (-2351.626) [-2350.538] -- 0:00:38 830000 -- (-2356.901) (-2358.859) (-2358.209) [-2355.767] * [-2348.586] (-2364.773) (-2355.595) (-2353.035) -- 0:00:38 Average standard deviation of split frequencies: 0.006526 830500 -- (-2357.995) (-2353.488) (-2353.813) [-2353.400] * (-2353.673) (-2353.493) [-2355.747] (-2349.023) -- 0:00:37 831000 -- (-2350.675) [-2351.931] (-2356.002) (-2358.240) * [-2348.720] (-2357.403) (-2348.516) (-2355.812) -- 0:00:37 831500 -- [-2352.797] (-2356.469) (-2356.995) (-2357.023) * (-2360.153) (-2355.183) [-2352.552] (-2351.772) -- 0:00:37 832000 -- (-2353.320) [-2348.024] (-2357.784) (-2360.031) * (-2350.357) [-2350.763] (-2352.478) (-2352.425) -- 0:00:37 832500 -- [-2351.552] (-2360.466) (-2359.839) (-2357.124) * (-2352.862) (-2361.355) [-2346.963] (-2353.505) -- 0:00:37 833000 -- [-2357.401] (-2349.461) (-2356.200) (-2355.127) * [-2354.058] (-2352.473) (-2355.298) (-2357.245) -- 0:00:37 833500 -- (-2354.068) (-2352.570) (-2353.444) [-2350.728] * (-2357.847) [-2358.925] (-2357.043) (-2348.968) -- 0:00:37 834000 -- [-2350.490] (-2351.477) (-2360.003) (-2358.599) * (-2353.037) [-2354.036] (-2359.401) (-2358.354) -- 0:00:37 834500 -- (-2358.770) (-2352.169) [-2355.686] (-2354.406) * [-2356.038] (-2353.089) (-2352.813) (-2352.149) -- 0:00:37 835000 -- (-2358.841) (-2355.115) (-2357.267) [-2351.335] * (-2357.324) (-2354.339) [-2351.154] (-2355.411) -- 0:00:36 Average standard deviation of split frequencies: 0.006344 835500 -- (-2357.599) (-2349.743) (-2360.718) [-2352.881] * (-2357.141) [-2354.707] (-2354.828) (-2357.021) -- 0:00:36 836000 -- (-2349.264) [-2352.367] (-2353.577) (-2355.919) * (-2361.006) (-2358.394) (-2348.293) [-2351.552] -- 0:00:36 836500 -- (-2362.051) (-2362.673) [-2348.741] (-2352.663) * (-2350.141) (-2355.617) (-2352.009) [-2359.099] -- 0:00:36 837000 -- (-2352.345) (-2352.092) [-2354.360] (-2355.140) * (-2357.577) (-2362.373) (-2354.147) [-2351.458] -- 0:00:36 837500 -- (-2352.312) [-2355.931] (-2353.138) (-2361.578) * [-2356.327] (-2357.551) (-2353.289) (-2352.939) -- 0:00:36 838000 -- [-2352.914] (-2362.376) (-2350.981) (-2354.906) * (-2347.470) (-2358.467) (-2350.165) [-2352.731] -- 0:00:36 838500 -- (-2351.389) (-2361.462) (-2347.256) [-2358.134] * (-2353.867) [-2355.177] (-2352.550) (-2346.068) -- 0:00:36 839000 -- [-2352.036] (-2356.753) (-2349.821) (-2358.831) * [-2352.023] (-2355.711) (-2356.595) (-2355.001) -- 0:00:36 839500 -- [-2358.060] (-2349.422) (-2352.244) (-2367.130) * [-2351.891] (-2356.770) (-2353.594) (-2357.400) -- 0:00:35 840000 -- (-2365.675) [-2353.967] (-2363.033) (-2359.297) * (-2361.542) (-2356.376) [-2353.178] (-2353.051) -- 0:00:35 Average standard deviation of split frequencies: 0.006449 840500 -- (-2357.583) [-2351.864] (-2360.129) (-2352.359) * (-2356.453) (-2361.607) [-2349.126] (-2352.696) -- 0:00:35 841000 -- [-2360.461] (-2353.726) (-2364.817) (-2357.515) * [-2350.034] (-2354.631) (-2352.498) (-2353.461) -- 0:00:35 841500 -- (-2357.130) [-2352.371] (-2356.903) (-2363.147) * (-2350.270) (-2352.616) [-2349.557] (-2356.780) -- 0:00:35 842000 -- [-2353.085] (-2355.036) (-2351.531) (-2353.178) * (-2347.317) (-2353.672) [-2353.247] (-2357.674) -- 0:00:35 842500 -- (-2347.627) [-2357.085] (-2359.522) (-2358.597) * (-2353.529) (-2352.378) [-2346.457] (-2351.741) -- 0:00:35 843000 -- [-2345.984] (-2353.297) (-2357.590) (-2351.253) * (-2356.226) (-2356.198) [-2350.094] (-2356.632) -- 0:00:35 843500 -- (-2364.175) (-2353.774) (-2355.264) [-2348.707] * (-2352.713) (-2350.645) (-2351.536) [-2351.629] -- 0:00:35 844000 -- (-2353.592) [-2348.948] (-2357.148) (-2352.754) * (-2352.911) (-2357.913) [-2354.275] (-2360.608) -- 0:00:34 844500 -- (-2353.480) (-2354.543) [-2356.191] (-2352.578) * (-2360.259) (-2353.348) (-2354.573) [-2352.371] -- 0:00:34 845000 -- [-2354.626] (-2354.056) (-2352.293) (-2351.796) * (-2367.088) (-2351.984) (-2356.222) [-2349.620] -- 0:00:34 Average standard deviation of split frequencies: 0.006408 845500 -- (-2351.912) (-2358.304) [-2357.270] (-2352.358) * (-2355.007) [-2351.236] (-2351.196) (-2347.387) -- 0:00:34 846000 -- (-2355.469) (-2356.345) [-2346.910] (-2356.977) * (-2352.189) [-2349.396] (-2348.876) (-2352.548) -- 0:00:34 846500 -- (-2350.568) [-2357.684] (-2356.441) (-2352.883) * (-2355.343) (-2352.741) [-2352.804] (-2354.343) -- 0:00:34 847000 -- [-2350.526] (-2355.607) (-2351.741) (-2360.033) * (-2359.338) [-2350.062] (-2360.338) (-2351.475) -- 0:00:34 847500 -- [-2348.784] (-2352.325) (-2352.563) (-2359.832) * (-2350.063) [-2349.943] (-2355.575) (-2353.828) -- 0:00:34 848000 -- [-2349.462] (-2357.251) (-2355.983) (-2356.807) * [-2348.563] (-2352.324) (-2353.304) (-2352.621) -- 0:00:34 848500 -- (-2352.289) [-2352.175] (-2363.362) (-2351.680) * (-2360.056) [-2350.788] (-2357.396) (-2348.542) -- 0:00:33 849000 -- (-2367.641) [-2350.768] (-2352.652) (-2352.498) * (-2359.332) (-2361.494) [-2354.953] (-2356.126) -- 0:00:33 849500 -- (-2360.828) (-2357.624) [-2349.068] (-2349.968) * (-2356.710) [-2353.204] (-2353.198) (-2356.248) -- 0:00:33 850000 -- (-2352.039) [-2351.120] (-2360.944) (-2351.218) * (-2350.495) [-2353.258] (-2351.224) (-2358.210) -- 0:00:33 Average standard deviation of split frequencies: 0.007204 850500 -- (-2354.770) (-2355.211) (-2359.315) [-2354.371] * (-2356.640) (-2350.842) (-2356.430) [-2357.553] -- 0:00:33 851000 -- (-2353.212) [-2347.979] (-2359.861) (-2358.327) * (-2352.243) (-2354.236) [-2356.663] (-2357.369) -- 0:00:33 851500 -- (-2351.352) [-2354.179] (-2352.519) (-2354.770) * [-2349.820] (-2357.175) (-2355.175) (-2355.788) -- 0:00:33 852000 -- (-2353.729) (-2353.603) (-2354.364) [-2357.749] * [-2359.903] (-2359.983) (-2356.762) (-2359.474) -- 0:00:33 852500 -- [-2359.016] (-2349.994) (-2357.046) (-2356.015) * [-2349.553] (-2353.444) (-2355.874) (-2364.542) -- 0:00:33 853000 -- (-2359.377) [-2353.304] (-2354.676) (-2357.492) * (-2355.936) (-2364.647) (-2352.128) [-2363.257] -- 0:00:32 853500 -- (-2351.969) (-2351.835) [-2351.524] (-2355.088) * (-2354.431) (-2361.464) (-2349.388) [-2351.832] -- 0:00:32 854000 -- (-2350.266) (-2356.925) [-2351.669] (-2352.133) * (-2356.786) (-2360.847) [-2349.700] (-2362.098) -- 0:00:32 854500 -- (-2354.452) [-2352.639] (-2355.329) (-2362.664) * (-2360.324) (-2356.787) (-2359.621) [-2356.458] -- 0:00:32 855000 -- (-2350.907) (-2352.803) [-2355.546] (-2361.665) * (-2348.092) [-2363.104] (-2357.226) (-2357.417) -- 0:00:32 Average standard deviation of split frequencies: 0.007297 855500 -- (-2349.585) (-2356.087) [-2353.625] (-2361.461) * [-2351.910] (-2357.154) (-2351.564) (-2355.345) -- 0:00:32 856000 -- (-2352.241) (-2352.397) [-2351.035] (-2359.273) * (-2354.042) (-2357.296) [-2357.596] (-2352.090) -- 0:00:32 856500 -- (-2353.048) (-2355.160) (-2357.048) [-2365.326] * (-2355.718) (-2358.226) [-2351.816] (-2351.812) -- 0:00:32 857000 -- (-2352.215) (-2356.829) [-2349.833] (-2355.494) * (-2352.625) (-2355.731) (-2367.416) [-2355.316] -- 0:00:32 857500 -- (-2353.295) [-2355.242] (-2357.851) (-2352.404) * [-2355.341] (-2363.187) (-2354.142) (-2351.352) -- 0:00:31 858000 -- [-2354.898] (-2360.872) (-2353.740) (-2356.967) * [-2354.069] (-2357.734) (-2357.878) (-2347.974) -- 0:00:31 858500 -- (-2355.863) (-2354.226) [-2350.477] (-2362.440) * (-2349.237) [-2354.217] (-2358.447) (-2354.067) -- 0:00:31 859000 -- (-2361.077) (-2353.244) [-2357.096] (-2348.695) * (-2352.848) [-2355.747] (-2354.305) (-2353.912) -- 0:00:31 859500 -- (-2357.581) [-2352.112] (-2358.694) (-2350.455) * (-2360.274) [-2354.042] (-2359.384) (-2355.305) -- 0:00:31 860000 -- (-2353.039) [-2357.947] (-2367.988) (-2365.360) * (-2357.148) (-2346.659) (-2351.353) [-2358.315] -- 0:00:31 Average standard deviation of split frequencies: 0.006710 860500 -- (-2351.675) (-2365.310) [-2353.250] (-2350.382) * (-2355.596) [-2355.459] (-2352.039) (-2351.549) -- 0:00:31 861000 -- [-2351.726] (-2362.470) (-2365.613) (-2356.215) * (-2350.836) (-2355.442) (-2357.941) [-2357.822] -- 0:00:31 861500 -- (-2357.186) (-2354.655) (-2357.464) [-2351.416] * [-2354.766] (-2354.895) (-2353.730) (-2358.782) -- 0:00:31 862000 -- (-2361.768) (-2354.771) [-2352.323] (-2354.295) * (-2352.663) (-2350.126) [-2356.857] (-2353.914) -- 0:00:30 862500 -- (-2357.047) [-2347.024] (-2353.435) (-2358.987) * (-2352.292) [-2356.725] (-2358.246) (-2350.894) -- 0:00:30 863000 -- (-2360.737) (-2349.908) (-2362.615) [-2356.437] * [-2350.105] (-2352.076) (-2355.557) (-2352.608) -- 0:00:30 863500 -- (-2360.941) [-2358.959] (-2354.583) (-2356.683) * (-2355.260) (-2358.177) [-2350.083] (-2349.411) -- 0:00:30 864000 -- (-2351.002) (-2359.278) (-2356.151) [-2352.379] * (-2356.206) [-2360.165] (-2351.725) (-2353.431) -- 0:00:30 864500 -- [-2351.922] (-2371.438) (-2358.162) (-2350.405) * (-2359.134) (-2349.923) [-2352.498] (-2356.504) -- 0:00:30 865000 -- (-2350.290) [-2355.516] (-2352.432) (-2358.671) * (-2357.620) (-2358.109) [-2355.338] (-2350.915) -- 0:00:30 Average standard deviation of split frequencies: 0.006260 865500 -- (-2355.450) (-2355.687) [-2354.157] (-2357.584) * (-2355.899) (-2354.648) [-2355.131] (-2351.904) -- 0:00:30 866000 -- (-2351.340) (-2352.872) (-2356.016) [-2349.690] * (-2352.187) (-2348.559) [-2349.954] (-2350.310) -- 0:00:30 866500 -- [-2352.355] (-2356.197) (-2354.785) (-2354.953) * [-2352.808] (-2354.021) (-2356.444) (-2351.185) -- 0:00:29 867000 -- (-2354.949) (-2356.051) (-2359.651) [-2349.653] * (-2355.138) [-2349.658] (-2359.533) (-2361.518) -- 0:00:29 867500 -- (-2367.387) [-2357.039] (-2359.617) (-2359.345) * (-2351.655) (-2352.511) (-2350.656) [-2355.419] -- 0:00:29 868000 -- (-2355.637) (-2354.337) [-2356.208] (-2364.225) * (-2362.651) (-2352.884) [-2350.657] (-2350.248) -- 0:00:29 868500 -- (-2351.347) (-2354.558) [-2354.581] (-2358.098) * [-2351.790] (-2349.549) (-2351.317) (-2350.732) -- 0:00:29 869000 -- (-2352.852) [-2350.378] (-2354.735) (-2356.956) * (-2356.348) [-2350.836] (-2364.279) (-2351.687) -- 0:00:29 869500 -- (-2348.708) (-2351.567) (-2350.545) [-2355.299] * (-2354.235) (-2346.825) (-2371.242) [-2353.703] -- 0:00:29 870000 -- [-2352.784] (-2359.409) (-2353.925) (-2359.836) * [-2352.760] (-2364.149) (-2354.290) (-2354.022) -- 0:00:29 Average standard deviation of split frequencies: 0.006903 870500 -- (-2357.031) [-2355.963] (-2350.052) (-2353.104) * (-2356.520) (-2357.868) (-2350.243) [-2355.867] -- 0:00:29 871000 -- (-2358.044) [-2355.665] (-2358.334) (-2356.234) * (-2356.130) (-2355.894) (-2352.679) [-2355.239] -- 0:00:28 871500 -- (-2359.371) [-2359.189] (-2353.635) (-2357.792) * (-2352.527) [-2352.966] (-2357.948) (-2354.960) -- 0:00:28 872000 -- [-2347.914] (-2359.318) (-2347.089) (-2362.077) * (-2364.379) [-2347.886] (-2361.461) (-2353.500) -- 0:00:28 872500 -- (-2362.467) (-2363.105) (-2361.420) [-2356.468] * (-2354.430) [-2349.929] (-2358.546) (-2362.267) -- 0:00:28 873000 -- (-2352.889) (-2361.794) [-2365.336] (-2355.365) * (-2359.773) (-2354.214) (-2364.605) [-2350.238] -- 0:00:28 873500 -- (-2357.247) [-2353.231] (-2354.918) (-2355.090) * (-2352.985) [-2352.530] (-2358.678) (-2355.840) -- 0:00:28 874000 -- (-2355.206) (-2363.360) (-2354.139) [-2351.964] * [-2346.333] (-2354.005) (-2357.439) (-2352.081) -- 0:00:28 874500 -- [-2349.768] (-2357.803) (-2360.772) (-2351.526) * (-2348.094) (-2350.241) (-2358.318) [-2347.745] -- 0:00:28 875000 -- (-2352.656) [-2354.108] (-2353.709) (-2355.956) * [-2356.084] (-2356.747) (-2357.355) (-2352.406) -- 0:00:28 Average standard deviation of split frequencies: 0.007265 875500 -- [-2348.586] (-2358.625) (-2353.161) (-2364.156) * (-2351.117) [-2354.485] (-2355.708) (-2354.594) -- 0:00:27 876000 -- (-2352.043) [-2356.404] (-2352.247) (-2357.521) * (-2357.313) (-2362.297) (-2357.075) [-2351.729] -- 0:00:27 876500 -- [-2348.591] (-2356.859) (-2361.315) (-2355.511) * (-2356.793) (-2356.990) [-2352.803] (-2358.975) -- 0:00:27 877000 -- (-2354.411) [-2351.629] (-2355.074) (-2359.776) * (-2351.797) (-2357.957) [-2353.425] (-2350.851) -- 0:00:27 877500 -- (-2351.653) (-2356.384) (-2354.968) [-2351.913] * (-2353.502) (-2357.352) [-2350.509] (-2354.395) -- 0:00:27 878000 -- (-2355.680) [-2350.376] (-2348.176) (-2351.010) * (-2351.311) [-2353.182] (-2353.161) (-2354.784) -- 0:00:27 878500 -- (-2359.243) (-2349.538) [-2351.628] (-2354.873) * (-2350.276) (-2356.834) [-2353.842] (-2352.414) -- 0:00:27 879000 -- (-2352.178) [-2353.256] (-2354.817) (-2357.604) * (-2356.548) (-2356.550) (-2355.957) [-2355.313] -- 0:00:27 879500 -- (-2347.505) [-2353.683] (-2356.931) (-2351.858) * [-2355.208] (-2355.421) (-2357.846) (-2357.960) -- 0:00:26 880000 -- (-2354.717) (-2353.903) (-2353.887) [-2355.870] * (-2357.957) (-2360.657) (-2350.153) [-2351.426] -- 0:00:26 Average standard deviation of split frequencies: 0.006691 880500 -- (-2355.170) (-2350.938) [-2350.249] (-2353.222) * (-2352.152) [-2348.971] (-2350.474) (-2354.170) -- 0:00:26 881000 -- (-2355.461) (-2357.811) [-2354.835] (-2353.119) * [-2362.547] (-2356.350) (-2348.138) (-2350.746) -- 0:00:26 881500 -- (-2351.977) (-2353.241) (-2353.934) [-2356.677] * [-2353.029] (-2362.402) (-2351.794) (-2354.609) -- 0:00:26 882000 -- (-2352.618) (-2352.823) (-2350.992) [-2355.078] * (-2356.554) (-2357.274) (-2357.374) [-2349.954] -- 0:00:26 882500 -- (-2349.511) (-2355.857) [-2355.899] (-2351.899) * (-2356.374) [-2349.251] (-2358.572) (-2347.851) -- 0:00:26 883000 -- (-2353.436) [-2350.153] (-2366.981) (-2353.959) * (-2362.195) (-2356.345) (-2359.933) [-2348.965] -- 0:00:26 883500 -- (-2364.959) [-2352.983] (-2354.173) (-2348.021) * [-2356.324] (-2352.593) (-2362.092) (-2352.935) -- 0:00:26 884000 -- [-2352.934] (-2349.912) (-2352.620) (-2351.690) * (-2353.718) (-2356.548) (-2358.578) [-2355.722] -- 0:00:25 884500 -- (-2348.968) [-2347.856] (-2358.866) (-2355.391) * (-2349.244) (-2353.836) (-2352.747) [-2356.855] -- 0:00:25 885000 -- (-2353.164) [-2352.132] (-2352.758) (-2356.876) * (-2351.478) (-2349.776) (-2347.702) [-2353.488] -- 0:00:25 Average standard deviation of split frequencies: 0.005986 885500 -- (-2356.509) (-2350.399) [-2353.344] (-2351.761) * (-2354.894) [-2355.695] (-2357.711) (-2354.663) -- 0:00:25 886000 -- [-2354.623] (-2353.148) (-2355.301) (-2356.700) * [-2352.463] (-2353.487) (-2353.562) (-2353.293) -- 0:00:25 886500 -- (-2356.490) [-2353.802] (-2357.481) (-2351.528) * (-2355.800) (-2353.019) [-2350.137] (-2362.211) -- 0:00:25 887000 -- (-2360.279) [-2355.587] (-2354.875) (-2352.350) * (-2352.141) [-2353.400] (-2358.172) (-2357.136) -- 0:00:25 887500 -- (-2350.078) (-2354.506) [-2350.821] (-2354.018) * [-2356.051] (-2350.769) (-2354.362) (-2359.670) -- 0:00:25 888000 -- (-2358.530) (-2351.712) (-2360.188) [-2351.413] * [-2350.336] (-2352.314) (-2354.291) (-2359.075) -- 0:00:25 888500 -- (-2351.710) (-2351.266) [-2357.358] (-2364.535) * [-2351.487] (-2352.227) (-2359.195) (-2356.087) -- 0:00:24 889000 -- (-2358.857) (-2358.220) [-2357.794] (-2361.563) * [-2350.005] (-2360.956) (-2353.683) (-2358.914) -- 0:00:24 889500 -- [-2351.820] (-2347.997) (-2356.333) (-2359.284) * [-2349.364] (-2358.007) (-2353.142) (-2352.520) -- 0:00:24 890000 -- (-2364.352) (-2356.015) (-2361.472) [-2359.235] * (-2361.853) (-2364.022) [-2353.685] (-2358.952) -- 0:00:24 Average standard deviation of split frequencies: 0.005557 890500 -- (-2358.759) [-2354.009] (-2359.176) (-2358.362) * (-2353.814) (-2353.595) [-2359.481] (-2360.742) -- 0:00:24 891000 -- (-2356.803) (-2354.789) [-2350.013] (-2357.609) * (-2354.078) [-2358.966] (-2351.390) (-2362.089) -- 0:00:24 891500 -- (-2354.360) [-2347.940] (-2356.870) (-2354.708) * (-2352.710) (-2360.146) (-2355.846) [-2352.126] -- 0:00:24 892000 -- [-2352.078] (-2355.968) (-2357.788) (-2360.983) * (-2353.000) (-2351.077) [-2354.142] (-2347.999) -- 0:00:24 892500 -- (-2362.809) (-2361.084) [-2355.647] (-2355.433) * (-2354.278) (-2360.024) (-2353.863) [-2349.539] -- 0:00:24 893000 -- [-2354.910] (-2350.042) (-2357.629) (-2359.551) * (-2353.333) [-2360.411] (-2353.268) (-2352.752) -- 0:00:23 893500 -- [-2346.325] (-2358.521) (-2350.741) (-2351.462) * [-2353.469] (-2351.639) (-2348.282) (-2356.813) -- 0:00:23 894000 -- [-2355.056] (-2351.171) (-2354.946) (-2352.355) * (-2349.586) (-2352.676) [-2357.051] (-2358.593) -- 0:00:23 894500 -- (-2365.999) [-2355.206] (-2359.920) (-2351.431) * [-2352.958] (-2359.849) (-2354.160) (-2353.277) -- 0:00:23 895000 -- (-2358.179) (-2350.717) (-2360.265) [-2355.065] * (-2353.140) (-2361.654) [-2354.927] (-2354.524) -- 0:00:23 Average standard deviation of split frequencies: 0.004867 895500 -- [-2356.992] (-2358.604) (-2354.809) (-2354.422) * (-2355.985) (-2356.054) [-2360.289] (-2355.099) -- 0:00:23 896000 -- (-2357.029) (-2357.177) (-2354.277) [-2353.950] * (-2349.403) (-2361.043) [-2349.654] (-2355.260) -- 0:00:23 896500 -- [-2352.573] (-2355.480) (-2355.007) (-2351.140) * (-2356.078) (-2364.488) (-2353.402) [-2352.430] -- 0:00:23 897000 -- (-2358.174) [-2354.989] (-2353.407) (-2354.019) * [-2355.808] (-2353.418) (-2357.202) (-2353.238) -- 0:00:23 897500 -- (-2352.464) (-2350.454) (-2354.998) [-2352.167] * [-2352.323] (-2364.500) (-2358.616) (-2349.499) -- 0:00:22 898000 -- [-2356.386] (-2350.070) (-2349.852) (-2355.220) * [-2356.453] (-2349.894) (-2360.478) (-2354.298) -- 0:00:22 898500 -- (-2355.365) [-2352.836] (-2356.686) (-2354.539) * (-2359.629) (-2354.272) (-2354.749) [-2353.489] -- 0:00:22 899000 -- [-2351.893] (-2354.763) (-2354.474) (-2357.342) * (-2367.960) (-2349.495) (-2353.772) [-2359.039] -- 0:00:22 899500 -- [-2351.068] (-2350.036) (-2354.609) (-2366.344) * (-2358.126) [-2349.158] (-2350.699) (-2351.487) -- 0:00:22 900000 -- (-2356.497) [-2358.466] (-2355.488) (-2358.386) * (-2356.665) (-2355.017) [-2353.662] (-2354.606) -- 0:00:22 Average standard deviation of split frequencies: 0.004187 900500 -- (-2353.702) [-2347.567] (-2353.684) (-2352.128) * [-2355.632] (-2353.001) (-2351.125) (-2355.307) -- 0:00:22 901000 -- [-2348.658] (-2351.673) (-2356.705) (-2361.730) * (-2355.517) [-2351.206] (-2350.076) (-2355.663) -- 0:00:22 901500 -- [-2354.998] (-2359.749) (-2354.918) (-2354.778) * (-2350.084) (-2352.579) (-2366.742) [-2349.016] -- 0:00:22 902000 -- (-2357.033) (-2358.692) (-2365.540) [-2360.710] * (-2349.846) (-2353.845) [-2357.954] (-2351.456) -- 0:00:21 902500 -- (-2361.596) (-2352.498) (-2355.040) [-2349.182] * (-2354.893) (-2353.960) [-2350.356] (-2360.652) -- 0:00:21 903000 -- (-2358.885) (-2357.529) [-2357.330] (-2356.077) * (-2351.209) (-2356.513) (-2351.062) [-2347.337] -- 0:00:21 903500 -- (-2352.289) [-2352.915] (-2361.077) (-2350.412) * (-2349.247) (-2357.161) (-2349.421) [-2359.245] -- 0:00:21 904000 -- (-2355.294) [-2351.764] (-2349.131) (-2352.722) * [-2350.747] (-2361.188) (-2351.739) (-2367.339) -- 0:00:21 904500 -- (-2348.584) (-2347.993) (-2359.405) [-2350.554] * (-2352.333) [-2356.161] (-2353.857) (-2352.170) -- 0:00:21 905000 -- [-2353.087] (-2351.435) (-2350.163) (-2350.939) * (-2350.902) (-2349.720) (-2351.872) [-2347.211] -- 0:00:21 Average standard deviation of split frequencies: 0.004032 905500 -- [-2353.529] (-2349.896) (-2355.115) (-2357.988) * (-2351.075) (-2354.111) [-2349.712] (-2355.635) -- 0:00:21 906000 -- (-2354.634) (-2359.013) (-2356.359) [-2352.294] * [-2359.915] (-2351.610) (-2353.330) (-2357.189) -- 0:00:21 906500 -- (-2353.673) [-2350.705] (-2367.774) (-2351.245) * (-2355.825) (-2358.337) (-2355.447) [-2352.039] -- 0:00:20 907000 -- (-2355.772) (-2359.858) [-2352.056] (-2355.197) * (-2360.037) (-2350.131) (-2357.449) [-2356.098] -- 0:00:20 907500 -- [-2355.594] (-2358.705) (-2356.127) (-2356.673) * (-2361.216) (-2357.709) [-2352.829] (-2352.817) -- 0:00:20 908000 -- (-2354.754) [-2355.313] (-2352.800) (-2363.068) * (-2355.472) (-2357.915) [-2352.289] (-2357.769) -- 0:00:20 908500 -- (-2370.520) [-2357.866] (-2355.023) (-2355.015) * [-2350.859] (-2362.552) (-2350.561) (-2354.888) -- 0:00:20 909000 -- (-2358.536) (-2363.521) (-2349.016) [-2355.107] * (-2347.916) (-2353.997) (-2360.436) [-2349.666] -- 0:00:20 909500 -- (-2356.594) [-2358.962] (-2354.533) (-2355.075) * (-2348.508) (-2349.271) [-2360.706] (-2355.584) -- 0:00:20 910000 -- (-2354.955) (-2360.124) [-2346.987] (-2353.361) * [-2356.681] (-2356.570) (-2356.617) (-2354.848) -- 0:00:20 Average standard deviation of split frequencies: 0.003494 910500 -- [-2356.409] (-2352.376) (-2353.130) (-2353.729) * (-2350.166) (-2354.674) [-2350.327] (-2357.087) -- 0:00:20 911000 -- (-2357.833) [-2353.421] (-2360.245) (-2361.189) * (-2350.703) [-2353.010] (-2353.233) (-2353.818) -- 0:00:19 911500 -- (-2350.875) [-2353.778] (-2357.431) (-2354.992) * [-2348.945] (-2356.834) (-2353.004) (-2354.758) -- 0:00:19 912000 -- (-2350.366) [-2354.341] (-2354.862) (-2350.291) * (-2356.614) (-2357.811) (-2359.751) [-2349.780] -- 0:00:19 912500 -- (-2356.917) (-2352.829) (-2358.882) [-2356.354] * (-2353.160) (-2359.187) [-2353.618] (-2356.521) -- 0:00:19 913000 -- (-2350.670) [-2350.721] (-2351.246) (-2359.523) * [-2351.971] (-2360.113) (-2358.483) (-2354.509) -- 0:00:19 913500 -- [-2350.518] (-2361.471) (-2356.265) (-2354.364) * [-2353.475] (-2350.129) (-2360.183) (-2354.455) -- 0:00:19 914000 -- [-2350.254] (-2352.709) (-2353.087) (-2356.086) * [-2349.922] (-2356.698) (-2371.441) (-2362.550) -- 0:00:19 914500 -- (-2354.981) [-2350.025] (-2348.472) (-2349.110) * [-2352.294] (-2362.601) (-2353.567) (-2358.660) -- 0:00:19 915000 -- (-2357.671) (-2351.823) [-2350.457] (-2358.109) * (-2351.727) [-2354.392] (-2347.723) (-2353.922) -- 0:00:19 Average standard deviation of split frequencies: 0.003474 915500 -- (-2350.687) (-2360.648) (-2352.421) [-2353.426] * (-2362.151) (-2355.562) [-2347.107] (-2358.451) -- 0:00:18 916000 -- (-2360.121) (-2358.702) [-2349.889] (-2352.555) * (-2351.628) (-2358.433) (-2358.860) [-2351.442] -- 0:00:18 916500 -- (-2358.970) (-2358.145) (-2354.125) [-2351.407] * (-2356.086) [-2349.030] (-2354.514) (-2354.227) -- 0:00:18 917000 -- (-2354.684) (-2355.467) [-2350.702] (-2364.411) * (-2359.120) [-2352.074] (-2352.200) (-2354.816) -- 0:00:18 917500 -- [-2355.300] (-2354.231) (-2351.645) (-2350.835) * (-2350.214) (-2361.393) [-2356.269] (-2353.622) -- 0:00:18 918000 -- [-2348.657] (-2350.323) (-2354.241) (-2364.914) * [-2353.859] (-2349.992) (-2357.197) (-2353.626) -- 0:00:18 918500 -- (-2355.603) (-2353.872) [-2355.254] (-2355.975) * (-2352.075) (-2349.168) [-2358.071] (-2354.489) -- 0:00:18 919000 -- [-2351.140] (-2351.645) (-2359.644) (-2356.997) * (-2354.446) [-2349.838] (-2356.590) (-2354.474) -- 0:00:18 919500 -- (-2350.606) (-2357.582) (-2352.670) [-2360.134] * (-2351.996) [-2350.460] (-2356.175) (-2356.336) -- 0:00:18 920000 -- (-2350.743) [-2356.423] (-2354.394) (-2352.968) * (-2351.989) (-2353.680) (-2355.907) [-2353.420] -- 0:00:17 Average standard deviation of split frequencies: 0.003200 920500 -- [-2354.765] (-2352.834) (-2357.906) (-2360.600) * (-2357.148) (-2349.838) [-2351.504] (-2352.040) -- 0:00:17 921000 -- (-2357.987) (-2355.780) (-2357.478) [-2350.665] * (-2359.838) (-2351.271) (-2347.957) [-2353.334] -- 0:00:17 921500 -- (-2356.382) (-2355.501) (-2356.461) [-2350.108] * [-2349.944] (-2353.424) (-2358.838) (-2348.408) -- 0:00:17 922000 -- (-2355.279) (-2354.683) [-2352.067] (-2354.165) * (-2353.749) (-2354.944) [-2349.012] (-2346.482) -- 0:00:17 922500 -- (-2355.935) (-2353.200) (-2355.936) [-2359.530] * (-2362.203) [-2352.198] (-2350.967) (-2348.529) -- 0:00:17 923000 -- (-2348.374) (-2361.152) (-2352.122) [-2353.640] * (-2355.174) (-2350.542) (-2349.289) [-2351.747] -- 0:00:17 923500 -- (-2360.794) (-2351.514) [-2351.948] (-2350.675) * [-2353.621] (-2348.588) (-2356.891) (-2348.936) -- 0:00:17 924000 -- (-2357.547) (-2359.028) (-2351.443) [-2348.885] * (-2351.870) (-2356.075) (-2352.054) [-2350.793] -- 0:00:17 924500 -- (-2364.071) (-2352.518) (-2355.906) [-2353.365] * (-2358.256) (-2358.305) [-2353.126] (-2357.825) -- 0:00:16 925000 -- [-2362.510] (-2355.407) (-2356.790) (-2356.696) * [-2353.159] (-2349.563) (-2358.122) (-2359.700) -- 0:00:16 Average standard deviation of split frequencies: 0.003309 925500 -- (-2357.867) (-2352.038) (-2354.623) [-2352.215] * (-2357.759) [-2353.778] (-2350.715) (-2362.509) -- 0:00:16 926000 -- (-2360.435) (-2356.840) [-2355.764] (-2350.968) * (-2353.777) (-2354.348) (-2361.580) [-2354.814] -- 0:00:16 926500 -- (-2355.037) (-2359.249) [-2350.371] (-2354.858) * [-2347.577] (-2353.786) (-2358.976) (-2363.820) -- 0:00:16 927000 -- (-2356.444) (-2351.746) [-2349.307] (-2351.128) * [-2351.713] (-2356.062) (-2356.442) (-2355.297) -- 0:00:16 927500 -- [-2353.889] (-2355.097) (-2354.135) (-2351.459) * (-2358.211) (-2359.097) [-2355.696] (-2355.486) -- 0:00:16 928000 -- (-2365.879) [-2358.668] (-2350.152) (-2350.883) * [-2350.395] (-2357.967) (-2353.473) (-2354.584) -- 0:00:16 928500 -- (-2357.614) (-2352.621) (-2355.417) [-2346.945] * [-2357.565] (-2358.828) (-2351.372) (-2350.051) -- 0:00:16 929000 -- (-2351.834) (-2352.893) [-2355.118] (-2352.493) * [-2352.726] (-2350.807) (-2357.558) (-2349.072) -- 0:00:15 929500 -- (-2357.389) (-2363.113) [-2352.976] (-2349.136) * (-2356.529) (-2354.429) (-2354.621) [-2349.716] -- 0:00:15 930000 -- (-2357.504) [-2352.461] (-2354.699) (-2350.083) * (-2363.244) (-2356.882) [-2353.566] (-2348.448) -- 0:00:15 Average standard deviation of split frequencies: 0.003672 930500 -- (-2353.655) (-2350.450) (-2354.180) [-2354.423] * (-2358.959) [-2351.212] (-2350.076) (-2352.803) -- 0:00:15 931000 -- (-2348.256) [-2350.128] (-2353.513) (-2356.582) * (-2361.762) (-2351.869) (-2359.678) [-2351.795] -- 0:00:15 931500 -- (-2353.157) (-2362.939) [-2354.977] (-2361.800) * (-2354.456) (-2352.683) [-2355.643] (-2354.136) -- 0:00:15 932000 -- (-2352.624) [-2350.977] (-2349.790) (-2355.722) * (-2356.488) [-2348.629] (-2356.690) (-2357.657) -- 0:00:15 932500 -- (-2351.499) [-2352.657] (-2357.865) (-2354.964) * (-2354.037) (-2352.883) (-2357.797) [-2356.378] -- 0:00:15 933000 -- (-2352.512) (-2357.765) (-2350.482) [-2352.631] * (-2354.114) [-2350.498] (-2360.122) (-2349.944) -- 0:00:15 933500 -- [-2355.800] (-2355.123) (-2351.343) (-2361.383) * (-2358.094) (-2349.868) [-2353.457] (-2352.241) -- 0:00:14 934000 -- (-2352.358) (-2357.394) (-2355.501) [-2352.544] * (-2357.070) (-2348.756) (-2352.747) [-2349.754] -- 0:00:14 934500 -- (-2355.183) (-2353.123) (-2357.732) [-2354.791] * (-2356.714) [-2353.545] (-2358.618) (-2351.914) -- 0:00:14 935000 -- (-2349.680) (-2358.630) (-2348.081) [-2349.507] * (-2356.045) (-2361.202) (-2353.662) [-2349.692] -- 0:00:14 Average standard deviation of split frequencies: 0.004533 935500 -- (-2362.697) (-2362.334) (-2363.782) [-2360.127] * (-2354.377) (-2358.318) (-2356.074) [-2350.794] -- 0:00:14 936000 -- (-2355.106) [-2356.701] (-2352.115) (-2361.189) * [-2352.036] (-2352.311) (-2360.341) (-2354.285) -- 0:00:14 936500 -- (-2349.493) [-2355.956] (-2356.692) (-2358.183) * (-2354.803) (-2354.954) [-2351.223] (-2356.889) -- 0:00:14 937000 -- [-2354.631] (-2348.360) (-2355.154) (-2350.934) * (-2359.017) (-2352.959) (-2354.620) [-2354.037] -- 0:00:14 937500 -- (-2354.377) (-2357.831) [-2352.349] (-2348.564) * (-2366.009) (-2352.858) (-2353.614) [-2347.400] -- 0:00:14 938000 -- (-2354.286) (-2357.454) (-2354.682) [-2353.140] * [-2360.196] (-2358.757) (-2355.925) (-2352.262) -- 0:00:13 938500 -- (-2354.114) (-2354.717) (-2349.799) [-2352.958] * (-2354.463) (-2353.060) [-2348.898] (-2353.999) -- 0:00:13 939000 -- (-2359.431) (-2348.583) (-2356.119) [-2353.025] * (-2352.802) [-2355.652] (-2359.307) (-2357.557) -- 0:00:13 939500 -- (-2350.906) (-2350.563) (-2348.367) [-2349.911] * (-2348.787) (-2364.867) (-2352.315) [-2356.799] -- 0:00:13 940000 -- (-2350.792) (-2350.935) (-2348.146) [-2351.357] * (-2359.183) (-2354.038) (-2354.368) [-2351.636] -- 0:00:13 Average standard deviation of split frequencies: 0.004385 940500 -- (-2357.340) (-2354.113) (-2354.838) [-2352.286] * (-2357.139) (-2361.903) [-2353.044] (-2359.904) -- 0:00:13 941000 -- [-2350.741] (-2357.181) (-2351.447) (-2359.670) * (-2359.665) (-2355.296) (-2356.829) [-2353.577] -- 0:00:13 941500 -- (-2360.889) (-2359.537) (-2347.973) [-2353.299] * (-2353.766) (-2355.484) (-2363.613) [-2353.360] -- 0:00:13 942000 -- (-2354.477) [-2355.102] (-2353.387) (-2356.145) * (-2356.126) (-2350.533) (-2352.369) [-2348.824] -- 0:00:12 942500 -- (-2370.050) (-2362.779) [-2350.966] (-2354.360) * (-2363.938) [-2352.753] (-2353.084) (-2354.649) -- 0:00:12 943000 -- (-2355.748) [-2355.163] (-2357.584) (-2358.774) * (-2353.691) [-2354.057] (-2348.871) (-2354.838) -- 0:00:12 943500 -- (-2357.696) [-2354.171] (-2358.903) (-2356.245) * (-2350.000) (-2361.225) (-2353.450) [-2352.888] -- 0:00:12 944000 -- [-2352.111] (-2354.855) (-2347.934) (-2357.341) * (-2360.183) (-2352.297) [-2356.622] (-2358.728) -- 0:00:12 944500 -- (-2352.908) [-2353.680] (-2351.744) (-2353.135) * (-2352.725) [-2355.007] (-2359.045) (-2363.176) -- 0:00:12 945000 -- (-2348.102) [-2348.324] (-2355.866) (-2356.086) * (-2353.027) (-2352.948) (-2357.869) [-2352.256] -- 0:00:12 Average standard deviation of split frequencies: 0.004859 945500 -- (-2355.074) (-2352.037) (-2357.273) [-2352.303] * (-2352.131) [-2355.800] (-2358.731) (-2349.942) -- 0:00:12 946000 -- (-2355.211) (-2359.110) (-2356.302) [-2355.087] * (-2353.680) (-2358.181) [-2358.662] (-2354.622) -- 0:00:12 946500 -- (-2354.862) (-2351.478) [-2350.604] (-2351.196) * (-2365.291) (-2357.622) (-2348.034) [-2350.151] -- 0:00:11 947000 -- [-2351.775] (-2351.849) (-2359.357) (-2349.672) * [-2354.976] (-2354.601) (-2352.508) (-2353.761) -- 0:00:11 947500 -- (-2356.313) (-2354.496) [-2357.396] (-2356.378) * (-2358.247) (-2354.792) (-2349.808) [-2359.304] -- 0:00:11 948000 -- (-2353.258) [-2356.090] (-2351.092) (-2358.925) * (-2353.682) (-2355.947) (-2354.817) [-2354.661] -- 0:00:11 948500 -- (-2360.147) (-2354.461) (-2353.091) [-2354.499] * [-2352.149] (-2360.610) (-2352.868) (-2351.264) -- 0:00:11 949000 -- (-2355.978) [-2360.699] (-2353.502) (-2360.466) * (-2358.953) [-2354.424] (-2353.578) (-2352.598) -- 0:00:11 949500 -- (-2356.448) [-2350.518] (-2361.110) (-2354.632) * [-2355.121] (-2360.479) (-2354.619) (-2348.805) -- 0:00:11 950000 -- (-2360.220) [-2352.560] (-2353.753) (-2352.782) * (-2355.723) [-2348.286] (-2363.653) (-2355.490) -- 0:00:11 Average standard deviation of split frequencies: 0.005702 950500 -- [-2350.426] (-2358.704) (-2351.596) (-2355.460) * (-2356.495) (-2356.931) (-2352.241) [-2357.883] -- 0:00:11 951000 -- [-2355.561] (-2359.730) (-2347.101) (-2356.298) * (-2357.773) (-2348.088) [-2354.140] (-2361.433) -- 0:00:10 951500 -- [-2353.057] (-2351.467) (-2360.101) (-2356.614) * (-2351.927) [-2347.476] (-2346.771) (-2354.704) -- 0:00:10 952000 -- (-2358.840) (-2357.104) [-2360.094] (-2363.315) * [-2353.514] (-2351.919) (-2355.490) (-2354.827) -- 0:00:10 952500 -- [-2348.800] (-2352.106) (-2352.991) (-2355.520) * (-2358.043) (-2352.501) (-2357.437) [-2350.732] -- 0:00:10 953000 -- (-2354.651) (-2352.307) [-2348.930] (-2349.706) * (-2352.059) [-2350.379] (-2352.192) (-2352.998) -- 0:00:10 953500 -- [-2353.000] (-2360.075) (-2356.055) (-2354.036) * (-2348.088) (-2351.359) (-2363.910) [-2354.320] -- 0:00:10 954000 -- [-2355.206] (-2355.006) (-2353.832) (-2352.824) * [-2349.939] (-2356.223) (-2358.518) (-2362.719) -- 0:00:10 954500 -- [-2361.317] (-2352.033) (-2350.949) (-2353.273) * (-2357.997) [-2364.521] (-2354.441) (-2349.722) -- 0:00:10 955000 -- (-2354.371) (-2353.851) [-2356.220] (-2356.241) * (-2355.500) [-2354.656] (-2360.024) (-2353.788) -- 0:00:10 Average standard deviation of split frequencies: 0.005671 955500 -- (-2357.465) (-2355.390) (-2351.058) [-2353.259] * (-2355.304) (-2355.037) [-2355.444] (-2350.937) -- 0:00:09 956000 -- [-2347.425] (-2353.138) (-2359.074) (-2346.558) * (-2353.071) (-2359.521) [-2348.661] (-2356.703) -- 0:00:09 956500 -- [-2350.931] (-2363.200) (-2358.757) (-2356.079) * [-2347.994] (-2359.317) (-2351.986) (-2355.354) -- 0:00:09 957000 -- [-2353.376] (-2362.134) (-2355.611) (-2353.541) * [-2355.259] (-2349.544) (-2350.250) (-2350.275) -- 0:00:09 957500 -- [-2350.821] (-2358.602) (-2356.951) (-2358.043) * [-2361.406] (-2359.050) (-2350.159) (-2354.450) -- 0:00:09 958000 -- (-2360.554) (-2359.169) (-2355.967) [-2351.440] * (-2358.157) (-2353.908) (-2367.590) [-2355.684] -- 0:00:09 958500 -- [-2352.154] (-2360.811) (-2359.071) (-2354.463) * (-2349.309) (-2359.121) [-2355.857] (-2351.737) -- 0:00:09 959000 -- (-2352.218) [-2350.966] (-2363.041) (-2355.526) * (-2348.114) [-2350.933] (-2357.613) (-2353.532) -- 0:00:09 959500 -- (-2356.510) [-2356.345] (-2361.324) (-2365.765) * [-2355.906] (-2347.940) (-2358.864) (-2357.849) -- 0:00:09 960000 -- (-2366.844) (-2352.852) [-2359.353] (-2364.850) * (-2357.013) [-2355.272] (-2362.283) (-2355.452) -- 0:00:08 Average standard deviation of split frequencies: 0.006011 960500 -- (-2353.864) [-2349.575] (-2353.933) (-2357.248) * (-2360.004) [-2349.309] (-2358.697) (-2358.628) -- 0:00:08 961000 -- (-2351.013) (-2357.248) [-2349.143] (-2352.285) * (-2353.530) (-2355.897) (-2353.739) [-2356.961] -- 0:00:08 961500 -- (-2350.376) (-2352.356) [-2352.420] (-2357.248) * (-2358.366) [-2349.754] (-2358.343) (-2354.735) -- 0:00:08 962000 -- [-2351.921] (-2352.320) (-2350.038) (-2356.749) * [-2348.915] (-2350.155) (-2351.037) (-2356.351) -- 0:00:08 962500 -- [-2354.630] (-2351.667) (-2356.902) (-2351.505) * [-2347.833] (-2355.996) (-2346.806) (-2368.277) -- 0:00:08 963000 -- (-2352.085) (-2351.399) [-2349.977] (-2354.434) * [-2350.238] (-2360.729) (-2353.101) (-2368.523) -- 0:00:08 963500 -- (-2353.725) (-2358.695) (-2348.946) [-2361.168] * [-2349.629] (-2351.168) (-2356.722) (-2365.881) -- 0:00:08 964000 -- (-2355.080) [-2349.401] (-2353.023) (-2352.661) * (-2356.026) (-2352.134) [-2351.993] (-2360.559) -- 0:00:08 964500 -- (-2356.124) (-2358.858) (-2355.898) [-2353.396] * (-2355.111) [-2354.220] (-2357.639) (-2364.577) -- 0:00:07 965000 -- (-2355.795) [-2364.891] (-2361.062) (-2357.521) * (-2351.958) [-2355.171] (-2356.611) (-2367.701) -- 0:00:07 Average standard deviation of split frequencies: 0.006222 965500 -- (-2349.789) [-2364.875] (-2355.920) (-2362.557) * (-2351.648) (-2355.872) (-2349.028) [-2355.486] -- 0:00:07 966000 -- (-2359.996) (-2359.331) (-2359.755) [-2353.390] * [-2348.766] (-2357.633) (-2352.773) (-2355.143) -- 0:00:07 966500 -- [-2359.171] (-2354.009) (-2353.502) (-2357.576) * (-2349.591) (-2352.589) [-2356.092] (-2347.309) -- 0:00:07 967000 -- (-2360.119) (-2361.788) [-2356.866] (-2353.544) * (-2352.108) (-2354.086) [-2350.940] (-2349.843) -- 0:00:07 967500 -- (-2356.640) (-2365.911) [-2350.783] (-2357.624) * (-2361.756) (-2353.525) [-2349.935] (-2360.018) -- 0:00:07 968000 -- (-2362.810) (-2362.623) [-2353.698] (-2353.556) * [-2352.403] (-2352.072) (-2363.670) (-2350.750) -- 0:00:07 968500 -- (-2355.434) [-2352.440] (-2359.619) (-2349.871) * [-2350.826] (-2361.868) (-2351.981) (-2353.577) -- 0:00:07 969000 -- (-2358.966) [-2359.428] (-2359.134) (-2353.076) * (-2354.013) (-2362.059) (-2355.272) [-2351.694] -- 0:00:06 969500 -- [-2356.420] (-2351.503) (-2362.231) (-2363.417) * (-2356.237) (-2357.235) (-2350.028) [-2349.698] -- 0:00:06 970000 -- (-2352.945) [-2353.691] (-2352.956) (-2352.247) * (-2354.558) (-2357.293) (-2352.166) [-2353.838] -- 0:00:06 Average standard deviation of split frequencies: 0.006556 970500 -- (-2357.425) (-2350.454) [-2353.874] (-2352.619) * [-2349.098] (-2362.386) (-2350.758) (-2352.187) -- 0:00:06 971000 -- (-2352.475) (-2352.463) (-2349.203) [-2351.607] * (-2354.452) (-2358.531) [-2355.098] (-2350.969) -- 0:00:06 971500 -- [-2358.244] (-2354.074) (-2357.451) (-2353.840) * (-2359.519) (-2365.756) [-2349.213] (-2348.762) -- 0:00:06 972000 -- (-2354.133) (-2360.458) [-2359.062] (-2348.172) * (-2358.221) (-2360.796) [-2350.307] (-2367.031) -- 0:00:06 972500 -- [-2355.103] (-2354.078) (-2353.704) (-2348.487) * (-2353.706) (-2360.700) [-2349.945] (-2351.441) -- 0:00:06 973000 -- (-2352.520) [-2355.456] (-2359.621) (-2353.490) * (-2357.425) (-2366.958) (-2355.738) [-2355.619] -- 0:00:06 973500 -- (-2355.020) (-2357.923) (-2352.799) [-2351.418] * (-2349.974) [-2357.913] (-2360.886) (-2354.263) -- 0:00:05 974000 -- (-2353.779) [-2353.577] (-2352.571) (-2352.371) * (-2361.595) (-2358.036) [-2352.852] (-2352.872) -- 0:00:05 974500 -- (-2357.475) [-2351.813] (-2356.474) (-2353.532) * (-2350.807) (-2359.346) [-2352.322] (-2354.101) -- 0:00:05 975000 -- [-2356.440] (-2349.411) (-2355.164) (-2355.851) * (-2356.374) (-2351.515) [-2348.009] (-2361.302) -- 0:00:05 Average standard deviation of split frequencies: 0.005554 975500 -- [-2355.185] (-2351.660) (-2352.992) (-2352.433) * (-2354.240) [-2354.463] (-2351.728) (-2357.347) -- 0:00:05 976000 -- [-2350.543] (-2356.154) (-2356.861) (-2359.778) * (-2354.281) (-2351.386) [-2351.147] (-2352.287) -- 0:00:05 976500 -- [-2352.617] (-2364.416) (-2366.836) (-2358.570) * (-2354.571) [-2350.577] (-2351.778) (-2350.662) -- 0:00:05 977000 -- (-2353.381) (-2357.865) [-2353.662] (-2356.542) * (-2358.798) (-2353.541) (-2348.462) [-2349.817] -- 0:00:05 977500 -- [-2354.886] (-2358.757) (-2355.939) (-2359.375) * (-2361.419) (-2350.988) [-2355.210] (-2359.226) -- 0:00:05 978000 -- (-2359.834) [-2363.112] (-2358.851) (-2358.751) * [-2349.188] (-2354.061) (-2350.991) (-2365.728) -- 0:00:04 978500 -- (-2359.566) [-2352.212] (-2357.458) (-2349.902) * (-2358.206) (-2358.514) [-2351.062] (-2361.175) -- 0:00:04 979000 -- (-2359.387) (-2359.870) (-2344.507) [-2350.476] * (-2354.767) (-2352.843) [-2350.711] (-2356.501) -- 0:00:04 979500 -- [-2354.409] (-2353.548) (-2354.998) (-2352.578) * (-2353.757) (-2352.369) [-2348.733] (-2360.646) -- 0:00:04 980000 -- (-2362.493) (-2351.915) [-2347.679] (-2358.247) * (-2352.402) (-2354.728) [-2352.507] (-2357.116) -- 0:00:04 Average standard deviation of split frequencies: 0.005889 980500 -- (-2357.080) (-2356.610) (-2352.884) [-2352.588] * [-2352.652] (-2348.830) (-2362.084) (-2354.959) -- 0:00:04 981000 -- (-2352.778) [-2353.023] (-2355.930) (-2356.954) * (-2358.200) (-2352.526) (-2355.470) [-2351.817] -- 0:00:04 981500 -- (-2352.582) (-2351.842) [-2355.858] (-2353.318) * (-2348.908) [-2355.218] (-2352.580) (-2349.909) -- 0:00:04 982000 -- (-2349.918) (-2352.531) (-2354.496) [-2354.134] * (-2352.683) [-2357.109] (-2352.364) (-2355.892) -- 0:00:04 982500 -- [-2351.339] (-2357.424) (-2351.373) (-2354.416) * (-2350.696) (-2353.605) [-2351.903] (-2363.723) -- 0:00:03 983000 -- (-2351.433) [-2352.375] (-2359.970) (-2356.410) * (-2351.186) (-2357.860) [-2353.992] (-2363.729) -- 0:00:03 983500 -- [-2349.114] (-2352.789) (-2355.816) (-2353.657) * [-2351.462] (-2355.651) (-2352.580) (-2356.288) -- 0:00:03 984000 -- (-2354.392) [-2347.775] (-2351.510) (-2355.303) * (-2348.869) (-2356.123) [-2352.896] (-2357.322) -- 0:00:03 984500 -- [-2354.170] (-2351.690) (-2356.993) (-2356.528) * (-2353.984) (-2353.175) (-2360.468) [-2357.529] -- 0:00:03 985000 -- (-2358.835) (-2358.315) [-2350.687] (-2350.106) * (-2357.432) (-2357.515) (-2353.146) [-2355.621] -- 0:00:03 Average standard deviation of split frequencies: 0.006693 985500 -- (-2362.106) (-2360.494) [-2354.174] (-2350.155) * (-2356.823) (-2350.938) (-2360.150) [-2357.030] -- 0:00:03 986000 -- (-2365.119) (-2357.881) (-2350.482) [-2350.720] * (-2352.229) [-2349.095] (-2354.491) (-2356.034) -- 0:00:03 986500 -- (-2364.208) (-2354.457) (-2353.016) [-2354.281] * [-2353.655] (-2350.327) (-2361.476) (-2354.433) -- 0:00:03 987000 -- (-2359.610) [-2351.315] (-2351.550) (-2350.856) * [-2352.489] (-2355.749) (-2360.508) (-2354.169) -- 0:00:02 987500 -- (-2354.189) [-2351.596] (-2352.072) (-2348.759) * (-2353.422) (-2355.769) (-2347.854) [-2347.461] -- 0:00:02 988000 -- (-2357.137) [-2361.494] (-2355.041) (-2356.796) * (-2359.679) (-2356.717) [-2352.317] (-2351.760) -- 0:00:02 988500 -- (-2354.802) (-2355.458) [-2358.512] (-2355.071) * (-2355.619) (-2362.976) [-2350.500] (-2354.538) -- 0:00:02 989000 -- (-2349.790) (-2354.635) [-2352.578] (-2351.007) * [-2348.311] (-2365.796) (-2356.940) (-2352.746) -- 0:00:02 989500 -- (-2357.235) (-2350.964) (-2362.468) [-2352.581] * [-2352.544] (-2368.321) (-2353.093) (-2355.306) -- 0:00:02 990000 -- (-2358.444) [-2353.119] (-2351.273) (-2351.943) * (-2349.231) (-2354.375) [-2351.414] (-2355.780) -- 0:00:02 Average standard deviation of split frequencies: 0.006662 990500 -- (-2355.225) (-2356.726) (-2355.528) [-2356.747] * (-2352.964) (-2352.027) [-2355.448] (-2352.665) -- 0:00:02 991000 -- (-2357.190) (-2358.892) (-2354.661) [-2358.912] * (-2352.764) [-2352.837] (-2361.493) (-2347.446) -- 0:00:02 991500 -- (-2356.604) (-2357.327) [-2348.969] (-2358.378) * (-2358.447) (-2353.112) [-2353.415] (-2354.273) -- 0:00:01 992000 -- (-2357.729) [-2350.893] (-2357.357) (-2349.511) * [-2358.362] (-2352.614) (-2359.055) (-2349.688) -- 0:00:01 992500 -- (-2355.847) [-2349.779] (-2363.195) (-2349.953) * (-2358.400) [-2353.289] (-2360.229) (-2350.669) -- 0:00:01 993000 -- (-2354.615) (-2354.800) [-2353.846] (-2360.080) * (-2352.511) (-2357.488) (-2361.173) [-2350.799] -- 0:00:01 993500 -- (-2354.649) (-2357.418) [-2348.921] (-2357.268) * (-2353.903) (-2352.165) (-2361.158) [-2349.642] -- 0:00:01 994000 -- (-2355.877) (-2353.984) [-2353.902] (-2355.986) * (-2359.643) (-2352.305) (-2359.213) [-2359.215] -- 0:00:01 994500 -- (-2360.128) (-2355.699) (-2347.656) [-2358.043] * [-2352.951] (-2355.327) (-2361.223) (-2348.966) -- 0:00:01 995000 -- (-2348.673) (-2356.626) [-2348.871] (-2350.961) * (-2363.161) (-2355.239) (-2361.206) [-2352.569] -- 0:00:01 Average standard deviation of split frequencies: 0.006626 995500 -- (-2356.756) (-2356.821) (-2357.557) [-2355.017] * [-2352.946] (-2368.523) (-2351.797) (-2354.466) -- 0:00:01 996000 -- (-2350.069) [-2351.239] (-2357.210) (-2353.614) * (-2347.872) (-2357.284) [-2350.524] (-2357.168) -- 0:00:00 996500 -- (-2356.892) [-2356.097] (-2354.724) (-2350.252) * (-2352.339) [-2355.312] (-2348.282) (-2352.559) -- 0:00:00 997000 -- (-2352.500) (-2350.787) [-2346.210] (-2354.044) * [-2356.016] (-2347.547) (-2358.776) (-2349.172) -- 0:00:00 997500 -- (-2357.738) [-2354.874] (-2350.773) (-2359.486) * (-2355.082) [-2354.074] (-2356.146) (-2352.900) -- 0:00:00 998000 -- (-2355.629) [-2351.407] (-2355.065) (-2358.132) * (-2352.992) (-2360.094) [-2354.313] (-2358.132) -- 0:00:00 998500 -- (-2355.848) (-2355.247) [-2360.033] (-2358.884) * (-2364.090) (-2361.706) (-2354.736) [-2355.307] -- 0:00:00 999000 -- [-2346.958] (-2352.247) (-2357.084) (-2356.842) * (-2352.251) [-2353.517] (-2357.308) (-2356.749) -- 0:00:00 999500 -- (-2354.690) [-2354.219] (-2354.620) (-2359.576) * (-2354.782) (-2356.931) (-2353.975) [-2352.996] -- 0:00:00 1000000 -- (-2354.580) [-2355.460] (-2352.949) (-2354.940) * (-2353.887) [-2355.215] (-2349.939) (-2349.007) -- 0:00:00 Average standard deviation of split frequencies: 0.005771 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2354.580473 -- 12.451258 Chain 1 -- -2354.580479 -- 12.451258 Chain 2 -- -2355.459528 -- 13.434514 Chain 2 -- -2355.459530 -- 13.434514 Chain 3 -- -2352.949022 -- 12.665435 Chain 3 -- -2352.949022 -- 12.665435 Chain 4 -- -2354.940262 -- 9.051675 Chain 4 -- -2354.940264 -- 9.051675 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2353.886979 -- 14.256202 Chain 1 -- -2353.886982 -- 14.256202 Chain 2 -- -2355.215382 -- 9.255858 Chain 2 -- -2355.215380 -- 9.255858 Chain 3 -- -2349.939347 -- 10.748901 Chain 3 -- -2349.939353 -- 10.748901 Chain 4 -- -2349.007466 -- 10.791340 Chain 4 -- -2349.007466 -- 10.791340 Analysis completed in 3 mins 43 seconds Analysis used 223.23 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2343.15 Likelihood of best state for "cold" chain of run 2 was -2343.15 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 52.4 % ( 49 %) Dirichlet(Revmat{all}) 67.7 % ( 56 %) Slider(Revmat{all}) 24.4 % ( 37 %) Dirichlet(Pi{all}) 27.0 % ( 28 %) Slider(Pi{all}) 64.9 % ( 24 %) Multiplier(Alpha{1,2}) 43.4 % ( 25 %) Multiplier(Alpha{3}) 43.7 % ( 20 %) Slider(Pinvar{all}) 5.6 % ( 3 %) ExtSPR(Tau{all},V{all}) 2.8 % ( 3 %) ExtTBR(Tau{all},V{all}) 8.8 % ( 15 %) NNI(Tau{all},V{all}) 12.3 % ( 15 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 28 %) Multiplier(V{all}) 36.0 % ( 36 %) Nodeslider(V{all}) 26.0 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 53.0 % ( 53 %) Dirichlet(Revmat{all}) 68.2 % ( 52 %) Slider(Revmat{all}) 24.2 % ( 18 %) Dirichlet(Pi{all}) 27.2 % ( 31 %) Slider(Pi{all}) 64.5 % ( 35 %) Multiplier(Alpha{1,2}) 43.1 % ( 28 %) Multiplier(Alpha{3}) 43.5 % ( 26 %) Slider(Pinvar{all}) 5.6 % ( 4 %) ExtSPR(Tau{all},V{all}) 2.7 % ( 4 %) ExtTBR(Tau{all},V{all}) 9.0 % ( 9 %) NNI(Tau{all},V{all}) 12.3 % ( 17 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 31 %) Multiplier(V{all}) 35.6 % ( 35 %) Nodeslider(V{all}) 25.6 % ( 25 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.82 0.67 0.54 2 | 166034 0.84 0.69 3 | 166533 166484 0.85 4 | 166908 167428 166613 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.82 0.67 0.54 2 | 166297 0.84 0.69 3 | 166928 166325 0.85 4 | 167482 166717 166251 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2351.29 | 1 2 | | 1 2 | | 1 1 1 2 2 | | 2 2 2 2 1 2 2 | | 22 12 1 1 1 2 1 121 1 1 21 2 | | 121 2 1 2 1 2 22 22 * *1 1 11 12| |2 2 2 1 *1 1 2 22 1 1 2 2 1| | 2 11 2 2 1* 12 21 11 1 2 11 | |11 2 22 1 22 11 1 11 22 11 2 12 | | 2 2 | | 1 2 2 | | 2 1 | | 2 | | 2 1 | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2355.99 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2349.51 -2360.38 2 -2349.62 -2360.11 -------------------------------------- TOTAL -2349.56 -2360.25 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.598460 0.009453 0.419233 0.783002 0.589213 1308.81 1336.85 1.000 r(A<->C){all} 0.060198 0.000535 0.017425 0.105924 0.058069 636.63 936.88 1.000 r(A<->G){all} 0.302016 0.002879 0.202935 0.407400 0.299056 671.05 673.71 1.000 r(A<->T){all} 0.095279 0.001031 0.036036 0.159353 0.092172 806.25 859.89 1.000 r(C<->G){all} 0.070218 0.000517 0.028129 0.114298 0.068591 881.69 922.77 1.001 r(C<->T){all} 0.442857 0.003376 0.334826 0.559949 0.442739 643.71 753.74 1.000 r(G<->T){all} 0.029432 0.000349 0.000369 0.065507 0.026363 783.06 888.64 1.000 pi(A){all} 0.232778 0.000154 0.209900 0.257917 0.232473 1247.18 1263.37 1.000 pi(C){all} 0.265570 0.000164 0.239568 0.289702 0.265306 1107.26 1235.94 1.001 pi(G){all} 0.271292 0.000176 0.245437 0.297976 0.271464 1275.61 1307.67 1.002 pi(T){all} 0.230360 0.000160 0.205557 0.254634 0.230313 1217.72 1259.88 1.002 alpha{1,2} 0.034983 0.000500 0.000101 0.074905 0.032654 1333.08 1334.50 1.000 alpha{3} 2.975165 0.830374 1.460144 4.822226 2.854021 1376.44 1421.17 1.000 pinvar{all} 0.552452 0.001549 0.471232 0.625442 0.554531 1390.96 1439.25 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- ...*** 9 -- ...**. 10 -- ....** ------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 2989 0.995670 0.000471 0.995336 0.996003 2 8 2831 0.943038 0.004240 0.940040 0.946036 2 9 2089 0.695869 0.009893 0.688874 0.702865 2 10 802 0.267155 0.008480 0.261159 0.273151 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.028873 0.000087 0.011932 0.048492 0.028132 1.001 2 length{all}[2] 0.005729 0.000010 0.000659 0.011846 0.005191 1.000 2 length{all}[3] 0.003527 0.000006 0.000011 0.008114 0.003041 1.000 2 length{all}[4] 0.032391 0.000089 0.016987 0.053103 0.031584 1.000 2 length{all}[5] 0.040959 0.000180 0.014670 0.067954 0.040138 1.000 2 length{all}[6] 0.418764 0.007829 0.266671 0.600516 0.408338 1.000 2 length{all}[7] 0.016348 0.000050 0.003736 0.030449 0.015447 1.000 2 length{all}[8] 0.033232 0.000235 0.004694 0.061451 0.032076 1.000 2 length{all}[9] 0.022624 0.000190 0.000027 0.048503 0.020498 1.000 2 length{all}[10] 0.015289 0.000106 0.000016 0.033933 0.013383 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005771 Maximum standard deviation of split frequencies = 0.009893 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------ C2 (2) |----------------------100----------------------+ | \------------------------ C3 (3) + | /------------------------ C4 (4) | /-----------70----------+ | | \------------------------ C5 (5) \-----------94----------+ \------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----- C1 (1) | | / C2 (2) |--+ | \ C3 (3) + | /----- C4 (4) | /---+ | | \------ C5 (5) \----+ \------------------------------------------------------------------- C6 (6) |---------------| 0.100 expected changes per site Calculating tree probabilities... Credible sets of trees (9 trees sampled): 90 % credible set contains 2 trees 95 % credible set contains 4 trees 99 % credible set contains 5 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 6 ls = 1065 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 181 patterns at 355 / 355 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 176656 bytes for conP 24616 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 178 353312 bytes for conP, adjusted 0.039401 0.031915 0.005764 0.005620 0.040563 0.011811 0.052595 0.066116 0.359004 0.300000 1.300000 ntime & nrate & np: 9 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 11 lnL0 = -2544.447119 Iterating by ming2 Initial: fx= 2544.447119 x= 0.03940 0.03192 0.00576 0.00562 0.04056 0.01181 0.05259 0.06612 0.35900 0.30000 1.30000 1 h-m-p 0.0000 0.0001 392.9193 +YCCCCC 2538.555269 5 0.0001 27 | 0/11 2 h-m-p 0.0000 0.0003 2334.9433 YCYCC 2533.369925 4 0.0000 47 | 0/11 3 h-m-p 0.0000 0.0001 664.1257 +YYCYYCCC 2521.413736 7 0.0001 73 | 0/11 4 h-m-p 0.0000 0.0003 2269.7390 +YCYYC 2456.274464 4 0.0002 94 | 0/11 5 h-m-p 0.0000 0.0000 6820.1248 +YYCCC 2442.930250 4 0.0000 115 | 0/11 6 h-m-p 0.0001 0.0005 244.7717 YCCCCC 2438.658021 5 0.0002 138 | 0/11 7 h-m-p 0.0001 0.0006 378.6053 ++ 2426.710929 m 0.0006 152 | 0/11 8 h-m-p -0.0000 -0.0000 1271.7976 h-m-p: -8.48405968e-21 -4.24202984e-20 1.27179765e+03 2426.710929 .. | 0/11 9 h-m-p 0.0000 0.0001 3346.2402 YYYCCCCC 2412.625266 7 0.0000 188 | 0/11 10 h-m-p 0.0000 0.0001 399.0514 +YYYYCCCCC 2405.267583 8 0.0001 215 | 0/11 11 h-m-p 0.0000 0.0002 742.0695 YCCCC 2395.692098 4 0.0001 236 | 0/11 12 h-m-p 0.0000 0.0001 478.1823 +YYYCCCCC 2391.917659 7 0.0001 262 | 0/11 13 h-m-p 0.0000 0.0002 689.5160 YCCCC 2387.528977 4 0.0001 283 | 0/11 14 h-m-p 0.0001 0.0005 542.9713 +YYYYYCCCCC 2365.873858 9 0.0004 311 | 0/11 15 h-m-p 0.0000 0.0001 5201.8871 +YYYCCCCC 2282.413602 7 0.0001 338 | 0/11 16 h-m-p 0.0000 0.0002 229.0214 YCC 2282.112825 2 0.0000 355 | 0/11 17 h-m-p 0.0000 0.0015 133.2688 ++YYYCC 2278.810103 4 0.0006 376 | 0/11 18 h-m-p 0.0002 0.0008 112.3629 CYC 2278.392433 2 0.0001 393 | 0/11 19 h-m-p 0.0001 0.0101 271.8479 +++YYYYYYC 2256.109396 6 0.0036 416 | 0/11 20 h-m-p 0.0477 0.8001 20.2829 YYCCC 2248.366333 4 0.0197 436 | 0/11 21 h-m-p 1.0026 5.0128 0.0632 YCCCCC 2238.872840 5 2.2971 459 | 0/11 22 h-m-p 0.5949 2.9745 0.0438 +YCCC 2234.821605 3 1.8499 490 | 0/11 23 h-m-p 1.0633 8.0000 0.0762 YCCC 2232.565243 3 2.4403 520 | 0/11 24 h-m-p 1.6000 8.0000 0.0657 YCCC 2229.654227 3 3.9094 550 | 0/11 25 h-m-p 0.4207 2.1037 0.0476 +YYCCC 2227.216761 4 1.5145 582 | 0/11 26 h-m-p 0.9328 7.5813 0.0774 YCC 2225.101634 2 1.5418 610 | 0/11 27 h-m-p 1.1041 5.5205 0.0152 CCCC 2223.578654 3 1.8644 641 | 0/11 28 h-m-p 1.4610 7.3049 0.0108 YYC 2223.276051 2 1.2323 668 | 0/11 29 h-m-p 0.4227 8.0000 0.0314 +CCC 2223.140721 2 2.1063 698 | 0/11 30 h-m-p 1.6000 8.0000 0.0087 C 2223.098452 0 1.6177 723 | 0/11 31 h-m-p 1.6000 8.0000 0.0031 +YC 2223.068326 1 4.1518 750 | 0/11 32 h-m-p 1.6000 8.0000 0.0016 CC 2223.052658 1 1.9831 777 | 0/11 33 h-m-p 1.1271 8.0000 0.0029 CC 2223.046378 1 1.6513 804 | 0/11 34 h-m-p 1.6000 8.0000 0.0003 C 2223.045769 0 1.8016 829 | 0/11 35 h-m-p 1.2265 8.0000 0.0004 YC 2223.045441 1 2.7047 855 | 0/11 36 h-m-p 1.6000 8.0000 0.0002 C 2223.045426 0 1.4236 880 | 0/11 37 h-m-p 1.6000 8.0000 0.0000 C 2223.045425 0 1.3261 905 | 0/11 38 h-m-p 1.6000 8.0000 0.0000 C 2223.045425 0 1.3880 930 | 0/11 39 h-m-p 1.6000 8.0000 0.0000 Y 2223.045425 0 1.0311 955 | 0/11 40 h-m-p 0.6612 8.0000 0.0000 C 2223.045425 0 0.6612 980 | 0/11 41 h-m-p 1.0111 8.0000 0.0000 Y 2223.045425 0 0.2528 1005 | 0/11 42 h-m-p 0.3150 8.0000 0.0000 C 2223.045425 0 0.3150 1030 | 0/11 43 h-m-p 0.4672 8.0000 0.0000 ----C 2223.045425 0 0.0005 1059 Out.. lnL = -2223.045425 1060 lfun, 1060 eigenQcodon, 9540 P(t) Time used: 0:04 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 178 0.039401 0.031915 0.005764 0.005620 0.040563 0.011811 0.052595 0.066116 0.359004 2.391925 0.747245 0.296991 ntime & nrate & np: 9 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.934650 np = 12 lnL0 = -2313.808652 Iterating by ming2 Initial: fx= 2313.808652 x= 0.03940 0.03192 0.00576 0.00562 0.04056 0.01181 0.05259 0.06612 0.35900 2.39193 0.74724 0.29699 1 h-m-p 0.0000 0.0001 350.2695 +YCYCCC 2308.974446 5 0.0001 26 | 0/12 2 h-m-p 0.0001 0.0007 699.8862 YYCYC 2306.423516 4 0.0001 46 | 0/12 3 h-m-p 0.0000 0.0001 731.1123 +CYYYCCCC 2294.482420 7 0.0001 73 | 0/12 4 h-m-p 0.0000 0.0000 3751.6467 ++ 2280.453543 m 0.0000 88 | 0/12 5 h-m-p 0.0000 0.0000 230.9224 h-m-p: 7.42651816e-18 3.71325908e-17 2.30922379e+02 2280.453543 .. | 0/12 6 h-m-p 0.0000 0.0002 17731.4410 -YYCYYCCC 2274.565182 7 0.0000 127 | 0/12 7 h-m-p 0.0000 0.0001 406.2669 ++ 2262.066130 m 0.0001 142 | 0/12 8 h-m-p 0.0000 0.0001 948.6599 +CYCCC 2234.310029 4 0.0001 165 | 0/12 9 h-m-p 0.0000 0.0001 594.0858 +YCYCCC 2231.159388 5 0.0000 189 | 0/12 10 h-m-p 0.0001 0.0006 99.5008 +YYYCCC 2228.221368 5 0.0005 212 | 0/12 11 h-m-p 0.0000 0.0001 134.6861 +YCYC 2227.917765 3 0.0001 232 | 0/12 12 h-m-p 0.0008 0.0193 9.6930 YCCC 2227.735902 3 0.0013 252 | 0/12 13 h-m-p 0.0002 0.0042 63.2770 +YC 2227.172023 1 0.0005 269 | 0/12 14 h-m-p 0.0007 0.0033 20.7172 YC 2227.044923 1 0.0003 285 | 0/12 15 h-m-p 0.0004 0.0066 17.3581 +YC 2226.559659 1 0.0013 302 | 0/12 16 h-m-p 0.0003 0.0016 61.2510 YCCC 2225.831775 3 0.0006 322 | 0/12 17 h-m-p 0.0007 0.0034 32.1306 CCC 2225.745699 2 0.0002 341 | 0/12 18 h-m-p 0.0091 2.7552 0.7771 ++YCCC 2224.828392 3 0.3475 363 | 0/12 19 h-m-p 0.2550 2.5603 1.0589 CCCC 2224.322148 3 0.3648 396 | 0/12 20 h-m-p 1.6000 8.0000 0.0609 CC 2223.792876 1 1.6073 413 | 0/12 21 h-m-p 0.4939 2.4694 0.0131 YC 2223.583036 1 1.0451 441 | 0/12 22 h-m-p 0.5442 8.0000 0.0252 +CCC 2223.330375 2 2.0900 473 | 0/12 23 h-m-p 1.6000 8.0000 0.0289 +YC 2223.003393 1 4.1349 502 | 0/12 24 h-m-p 1.6000 8.0000 0.0510 CC 2222.822975 1 2.3080 531 | 0/12 25 h-m-p 1.6000 8.0000 0.0236 C 2222.801232 0 1.6000 558 | 0/12 26 h-m-p 1.6000 8.0000 0.0062 CC 2222.797629 1 1.8922 587 | 0/12 27 h-m-p 1.6000 8.0000 0.0032 C 2222.797397 0 1.5923 614 | 0/12 28 h-m-p 1.6000 8.0000 0.0002 ++ 2222.796472 m 8.0000 641 | 0/12 29 h-m-p 1.0013 8.0000 0.0018 C 2222.794087 0 1.0413 668 | 0/12 30 h-m-p 1.3739 8.0000 0.0013 C 2222.793951 0 1.4649 695 | 0/12 31 h-m-p 1.6000 8.0000 0.0001 Y 2222.793950 0 0.9926 722 | 0/12 32 h-m-p 1.6000 8.0000 0.0000 Y 2222.793950 0 1.0259 749 | 0/12 33 h-m-p 1.6000 8.0000 0.0000 Y 2222.793950 0 1.0954 776 | 0/12 34 h-m-p 1.6000 8.0000 0.0000 ++ 2222.793950 m 8.0000 803 | 0/12 35 h-m-p 1.1559 8.0000 0.0000 -C 2222.793950 0 0.0735 831 | 0/12 36 h-m-p 0.0885 8.0000 0.0000 -------------N 2222.793950 0 0.0000 871 Out.. lnL = -2222.793950 872 lfun, 2616 eigenQcodon, 15696 P(t) Time used: 0:10 Model 2: PositiveSelection TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 178 initial w for M2:NSpselection reset. 0.039401 0.031915 0.005764 0.005620 0.040563 0.011811 0.052595 0.066116 0.359004 2.408241 0.896732 0.199894 0.157918 2.073080 ntime & nrate & np: 9 3 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.063199 np = 14 lnL0 = -2349.015567 Iterating by ming2 Initial: fx= 2349.015567 x= 0.03940 0.03192 0.00576 0.00562 0.04056 0.01181 0.05259 0.06612 0.35900 2.40824 0.89673 0.19989 0.15792 2.07308 1 h-m-p 0.0000 0.0015 394.9639 +YCYCCC 2344.663962 5 0.0001 28 | 0/14 2 h-m-p 0.0000 0.0001 214.2374 +YYCCC 2342.510347 4 0.0001 52 | 0/14 3 h-m-p 0.0000 0.0000 1147.2453 +YCYCCC 2341.193829 5 0.0000 78 | 0/14 4 h-m-p 0.0000 0.0002 728.4638 ++ 2321.034829 m 0.0002 95 | 1/14 5 h-m-p 0.0004 0.0070 215.9309 +YCCCC 2302.486079 4 0.0028 120 | 1/14 6 h-m-p 0.0013 0.0067 236.2982 YCCCC 2298.420375 4 0.0008 144 | 1/14 7 h-m-p 0.0011 0.0057 77.2557 YCYCCC 2293.180766 5 0.0029 169 | 1/14 8 h-m-p 0.0012 0.0060 148.0161 CCCC 2289.835118 3 0.0013 192 | 1/14 9 h-m-p 0.0036 0.0180 20.8051 CYCCC 2286.966370 4 0.0070 216 | 1/14 10 h-m-p 0.0027 0.0136 24.5772 ++ 2274.403536 m 0.0136 233 | 1/14 11 h-m-p -0.0000 -0.0000 34.7516 h-m-p: -3.96701384e-19 -1.98350692e-18 3.47515726e+01 2274.403536 .. | 1/14 12 h-m-p 0.0000 0.0001 421.5629 +YCYCCC 2267.969183 5 0.0001 274 | 1/14 13 h-m-p 0.0000 0.0001 569.0649 +YCCCC 2264.973790 4 0.0001 299 | 1/14 14 h-m-p 0.0000 0.0004 606.0346 YCYC 2260.076179 3 0.0001 320 | 1/14 15 h-m-p 0.0001 0.0004 432.1668 YCYCCC 2252.082675 5 0.0002 345 | 1/14 16 h-m-p 0.0002 0.0009 149.3440 CYCCC 2249.576413 4 0.0003 369 | 1/14 17 h-m-p 0.0003 0.0017 69.2336 YYC 2249.122550 2 0.0003 388 | 1/14 18 h-m-p 0.0003 0.0050 67.3725 +YCCC 2248.220617 3 0.0008 411 | 1/14 19 h-m-p 0.0003 0.0032 180.0581 +YYC 2245.543072 2 0.0009 431 | 1/14 20 h-m-p 0.0011 0.0055 49.1416 YCYCCC 2243.846016 5 0.0026 456 | 0/14 21 h-m-p 0.0002 0.0026 669.8085 YCCC 2241.033046 3 0.0004 478 | 0/14 22 h-m-p 0.0002 0.0009 1558.1798 CCCCC 2237.454302 4 0.0002 503 | 0/14 23 h-m-p 0.0791 0.3955 1.1838 ++ 2230.742869 m 0.3955 520 | 1/14 24 h-m-p 0.1090 0.5452 2.1041 +YCYCCC 2227.660707 5 0.2953 546 | 1/14 25 h-m-p 0.7300 6.7911 0.8513 CCCC 2225.927711 3 0.5949 569 | 1/14 26 h-m-p 0.1496 0.7481 1.1084 YCCCC 2225.152724 4 0.3308 606 | 1/14 27 h-m-p 0.5117 3.8390 0.7164 CCC 2224.057652 2 0.7254 627 | 1/14 28 h-m-p 0.9599 7.1667 0.5414 CYCC 2223.237991 3 1.2775 662 | 1/14 29 h-m-p 1.6000 8.0000 0.3367 CCC 2222.952476 2 1.4563 696 | 1/14 30 h-m-p 1.6000 8.0000 0.2122 CCC 2222.829405 2 1.4781 730 | 1/14 31 h-m-p 1.6000 8.0000 0.1616 CCC 2222.799472 2 1.5418 764 | 1/14 32 h-m-p 1.6000 8.0000 0.0899 CC 2222.794624 1 1.2951 796 | 1/14 33 h-m-p 1.6000 8.0000 0.0377 YC 2222.794015 1 0.8340 827 | 1/14 34 h-m-p 1.6000 8.0000 0.0107 YC 2222.793953 1 0.9865 858 | 1/14 35 h-m-p 1.6000 8.0000 0.0020 Y 2222.793950 0 0.8647 888 | 1/14 36 h-m-p 1.6000 8.0000 0.0001 Y 2222.793950 0 1.1203 918 | 1/14 37 h-m-p 1.4233 8.0000 0.0001 Y 2222.793950 0 1.0408 948 | 1/14 38 h-m-p 1.6000 8.0000 0.0000 ---C 2222.793950 0 0.0063 981 | 1/14 39 h-m-p 0.0160 8.0000 0.0000 -C 2222.793950 0 0.0010 1012 Out.. lnL = -2222.793950 1013 lfun, 4052 eigenQcodon, 27351 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2243.576842 S = -2185.833893 -48.741819 Calculating f(w|X), posterior probabilities of site classes. did 10 / 181 patterns 0:22 did 20 / 181 patterns 0:22 did 30 / 181 patterns 0:22 did 40 / 181 patterns 0:22 did 50 / 181 patterns 0:22 did 60 / 181 patterns 0:22 did 70 / 181 patterns 0:22 did 80 / 181 patterns 0:22 did 90 / 181 patterns 0:22 did 100 / 181 patterns 0:22 did 110 / 181 patterns 0:22 did 120 / 181 patterns 0:22 did 130 / 181 patterns 0:23 did 140 / 181 patterns 0:23 did 150 / 181 patterns 0:23 did 160 / 181 patterns 0:23 did 170 / 181 patterns 0:23 did 180 / 181 patterns 0:23 did 181 / 181 patterns 0:23 Time used: 0:23 Model 3: discrete TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 178 0.039401 0.031915 0.005764 0.005620 0.040563 0.011811 0.052595 0.066116 0.359004 2.408239 0.215184 0.509770 0.018836 0.047183 0.068376 ntime & nrate & np: 9 4 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 13.856961 np = 15 lnL0 = -2224.523802 Iterating by ming2 Initial: fx= 2224.523802 x= 0.03940 0.03192 0.00576 0.00562 0.04056 0.01181 0.05259 0.06612 0.35900 2.40824 0.21518 0.50977 0.01884 0.04718 0.06838 1 h-m-p 0.0000 0.0001 231.5109 +CCCC 2223.290395 3 0.0001 27 | 0/15 2 h-m-p 0.0001 0.0003 137.3102 YCCC 2223.108179 3 0.0000 50 | 0/15 3 h-m-p 0.0000 0.0001 99.8744 CCCC 2223.012706 3 0.0000 74 | 0/15 4 h-m-p 0.0001 0.0007 38.5167 +YC 2222.900979 1 0.0002 94 | 0/15 5 h-m-p 0.0003 0.0016 9.5778 CC 2222.879621 1 0.0005 114 | 0/15 6 h-m-p 0.0001 0.0005 23.1822 ++ 2222.813869 m 0.0005 132 | 1/15 7 h-m-p 0.0000 0.0069 263.6737 CCC 2222.792567 2 0.0000 154 | 1/15 8 h-m-p 0.0008 0.0155 6.3993 CY 2222.782365 1 0.0008 174 | 1/15 9 h-m-p 0.0004 0.0069 11.5167 +YCCC 2222.677085 3 0.0037 198 | 1/15 10 h-m-p 0.0002 0.0012 32.5587 CY 2222.665183 1 0.0002 218 | 1/15 11 h-m-p 0.0019 0.0136 3.8260 YC 2222.659724 1 0.0013 237 | 1/15 12 h-m-p 0.0016 0.0182 3.1238 YC 2222.659118 1 0.0002 256 | 1/15 13 h-m-p 0.0160 8.0000 0.0932 +++YC 2222.635922 1 0.6562 278 | 1/15 14 h-m-p 0.4904 8.0000 0.1247 YC 2222.629040 1 0.3198 311 | 1/15 15 h-m-p 0.5984 4.3102 0.0666 YC 2222.626117 1 0.3515 344 | 1/15 16 h-m-p 1.6000 8.0000 0.0113 YC 2222.625484 1 1.0393 377 | 1/15 17 h-m-p 1.6000 8.0000 0.0044 Y 2222.625413 0 0.6695 409 | 1/15 18 h-m-p 1.1018 8.0000 0.0026 +C 2222.625383 0 4.2702 442 | 1/15 19 h-m-p 1.2068 8.0000 0.0094 ++ 2222.625095 m 8.0000 474 | 1/15 20 h-m-p 0.0670 0.5671 1.1177 +CC 2222.624210 1 0.2943 509 | 1/15 21 h-m-p 0.1782 0.8909 0.3356 ++ 2222.623367 m 0.8909 527 | 1/15 22 h-m-p -0.0000 -0.0000 7.4842 h-m-p: -6.11374968e-19 -3.05687484e-18 7.48421120e+00 2222.623367 .. | 1/15 23 h-m-p 0.0000 0.0046 3.6552 +CC 2222.622940 1 0.0001 577 | 1/15 24 h-m-p 0.0000 0.0036 4.6835 C 2222.622624 0 0.0001 595 | 1/15 25 h-m-p 0.0001 0.0270 3.6211 C 2222.622545 0 0.0000 613 | 1/15 26 h-m-p 0.0003 0.1302 1.4103 C 2222.622378 0 0.0002 631 | 1/15 27 h-m-p 0.0013 0.6588 0.3755 Y 2222.622365 0 0.0002 649 | 1/15 28 h-m-p 0.0016 0.8044 0.0855 -Y 2222.622364 0 0.0002 682 | 1/15 29 h-m-p 0.0076 3.8033 0.0558 -Y 2222.622364 0 0.0008 715 | 1/15 30 h-m-p 0.0024 1.2059 0.1510 C 2222.622361 0 0.0010 747 | 1/15 31 h-m-p 0.0034 1.7002 0.0725 -C 2222.622361 0 0.0003 780 | 1/15 32 h-m-p 0.0100 4.9787 0.0405 Y 2222.622360 0 0.0013 812 | 1/15 33 h-m-p 0.0079 3.9482 0.0575 -Y 2222.622360 0 0.0003 845 | 1/15 34 h-m-p 0.0071 3.5488 0.0052 +++++ 2222.622301 m 3.5488 880 | 2/15 35 h-m-p 0.1062 8.0000 0.1728 C 2222.622292 0 0.0229 912 | 2/15 36 h-m-p 0.2828 8.0000 0.0140 +C 2222.622232 0 1.0483 944 | 2/15 37 h-m-p 1.6000 8.0000 0.0002 Y 2222.622231 0 1.0102 975 | 2/15 38 h-m-p 1.6000 8.0000 0.0000 C 2222.622231 0 1.6683 1006 | 2/15 39 h-m-p 1.6000 8.0000 0.0000 ----Y 2222.622231 0 0.0016 1041 Out.. lnL = -2222.622231 1042 lfun, 4168 eigenQcodon, 28134 P(t) Time used: 0:34 Model 7: beta TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 178 0.039401 0.031915 0.005764 0.005620 0.040563 0.011811 0.052595 0.066116 0.359004 2.400969 0.603915 1.022819 ntime & nrate & np: 9 1 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 7.874073 np = 12 lnL0 = -2291.874121 Iterating by ming2 Initial: fx= 2291.874121 x= 0.03940 0.03192 0.00576 0.00562 0.04056 0.01181 0.05259 0.06612 0.35900 2.40097 0.60392 1.02282 1 h-m-p 0.0000 0.0002 301.2877 +YCCC 2289.552396 3 0.0001 23 | 0/12 2 h-m-p 0.0000 0.0002 162.7482 YCYCCC 2288.514185 5 0.0001 46 | 0/12 3 h-m-p 0.0001 0.0003 263.5444 +YYCCCC 2285.384236 5 0.0002 70 | 0/12 4 h-m-p 0.0000 0.0001 5135.0623 +CYYYCYYCCC 2251.017361 9 0.0001 100 | 0/12 5 h-m-p 0.0000 0.0001 1312.6662 CYCCC 2247.918330 4 0.0000 123 | 0/12 6 h-m-p 0.0001 0.0005 91.7020 CCCCC 2247.523903 4 0.0001 146 | 0/12 7 h-m-p 0.0002 0.0114 61.2211 ++CYCCCC 2239.515911 5 0.0059 173 | 0/12 8 h-m-p 0.0002 0.0010 628.4319 YCYCCC 2232.654531 5 0.0005 196 | 0/12 9 h-m-p 0.0003 0.0016 330.2256 YCC 2229.061501 2 0.0007 214 | 0/12 10 h-m-p 0.0002 0.0010 229.9808 CCCC 2228.027695 3 0.0003 235 | 0/12 11 h-m-p 0.0029 0.0143 8.6922 -YC 2228.011026 1 0.0003 252 | 0/12 12 h-m-p 0.0033 0.2109 0.8879 ++YCYCCC 2225.875689 5 0.1248 277 | 0/12 13 h-m-p 0.4183 6.0296 0.2649 CYCCC 2223.746670 4 0.5055 311 | 0/12 14 h-m-p 0.2392 7.8848 0.5597 YCCC 2223.517690 3 0.4459 343 | 0/12 15 h-m-p 0.8274 4.1372 0.2853 YCC 2223.168084 2 0.6284 373 | 0/12 16 h-m-p 1.5381 7.6904 0.0132 YC 2223.081786 1 0.9032 401 | 0/12 17 h-m-p 0.3739 8.0000 0.0319 +CYC 2223.029999 2 1.4315 432 | 0/12 18 h-m-p 1.6000 8.0000 0.0217 YC 2222.995306 1 1.2795 460 | 0/12 19 h-m-p 1.6000 8.0000 0.0128 YC 2222.956311 1 3.6768 488 | 0/12 20 h-m-p 1.6000 8.0000 0.0246 CC 2222.936498 1 1.9248 517 | 0/12 21 h-m-p 1.6000 8.0000 0.0169 YC 2222.928983 1 2.8001 545 | 0/12 22 h-m-p 1.6000 8.0000 0.0221 ++ 2222.909705 m 8.0000 572 | 0/12 23 h-m-p 1.6000 8.0000 0.0978 ++ 2222.784804 m 8.0000 599 | 0/12 24 h-m-p 1.0931 8.0000 0.7156 +CYC 2222.657221 2 4.5730 630 | 0/12 25 h-m-p 1.6000 8.0000 0.2946 CC 2222.637830 1 1.2795 659 | 0/12 26 h-m-p 1.5035 8.0000 0.2508 YC 2222.633551 1 2.6601 687 | 0/12 27 h-m-p 1.6000 8.0000 0.1856 YC 2222.630976 1 3.7231 715 | 0/12 28 h-m-p 1.6000 8.0000 0.1352 C 2222.630241 0 1.8807 742 | 0/12 29 h-m-p 1.6000 8.0000 0.0135 +YC 2222.629501 1 4.5443 771 | 0/12 30 h-m-p 0.5228 8.0000 0.1170 +Y 2222.629205 0 1.6405 799 | 0/12 31 h-m-p 1.6000 8.0000 0.0387 Y 2222.629194 0 1.1089 826 | 0/12 32 h-m-p 1.6000 8.0000 0.0013 Y 2222.629193 0 1.0620 853 | 0/12 33 h-m-p 1.3247 8.0000 0.0011 C 2222.629193 0 1.1699 880 | 0/12 34 h-m-p 1.6000 8.0000 0.0001 Y 2222.629193 0 0.8624 907 | 0/12 35 h-m-p 1.6000 8.0000 0.0000 Y 2222.629193 0 0.7937 934 | 0/12 36 h-m-p 1.6000 8.0000 0.0000 N 2222.629193 0 0.4000 961 | 0/12 37 h-m-p 1.6000 8.0000 0.0000 C 2222.629193 0 0.4000 988 | 0/12 38 h-m-p 0.1029 8.0000 0.0000 -----Y 2222.629193 0 0.0000 1020 Out.. lnL = -2222.629193 1021 lfun, 11231 eigenQcodon, 91890 P(t) Time used: 1:12 Model 8: beta&w>1 TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 178 initial w for M8:NSbetaw>1 reset. 0.039401 0.031915 0.005764 0.005620 0.040563 0.011811 0.052595 0.066116 0.359004 2.401393 0.900000 0.523761 1.873198 2.941449 ntime & nrate & np: 9 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.810624 np = 14 lnL0 = -2293.629482 Iterating by ming2 Initial: fx= 2293.629482 x= 0.03940 0.03192 0.00576 0.00562 0.04056 0.01181 0.05259 0.06612 0.35900 2.40139 0.90000 0.52376 1.87320 2.94145 1 h-m-p 0.0000 0.0003 557.4243 ++CCCC 2272.765495 3 0.0002 27 | 0/14 2 h-m-p 0.0000 0.0001 449.3431 +YCYC 2266.001348 3 0.0001 50 | 0/14 3 h-m-p 0.0000 0.0000 1654.3294 ++ 2263.463921 m 0.0000 67 | 1/14 4 h-m-p 0.0000 0.0005 225.5858 ++YYCCC 2258.046506 4 0.0003 92 | 1/14 5 h-m-p 0.0002 0.0008 205.0127 YCCCC 2254.623158 4 0.0003 116 | 1/14 6 h-m-p 0.0002 0.0012 348.7369 +YYYCC 2242.130833 4 0.0007 139 | 1/14 7 h-m-p 0.0001 0.0004 500.3228 CYCCC 2237.901000 4 0.0002 163 | 1/14 8 h-m-p 0.0002 0.0010 124.7143 YYCCCC 2236.990934 5 0.0002 188 | 1/14 9 h-m-p 0.0009 0.0045 23.5973 CC 2236.918725 1 0.0003 207 | 1/14 10 h-m-p 0.0003 0.0061 24.1368 CC 2236.838339 1 0.0004 226 | 1/14 11 h-m-p 0.0005 0.0109 20.3700 CC 2236.738967 1 0.0007 245 | 1/14 12 h-m-p 0.0002 0.0268 78.2890 +++CCYC 2227.273303 3 0.0195 271 | 1/14 13 h-m-p 0.0216 0.1081 3.1212 YCYCCC 2226.657369 5 0.0517 296 | 1/14 14 h-m-p 0.0868 1.3110 1.8608 +YYYYCCC 2224.733311 6 0.3489 322 | 1/14 15 h-m-p 0.1230 0.6149 1.4546 YCCCC 2223.329351 4 0.2648 346 | 1/14 16 h-m-p 0.9751 4.8754 0.2219 CYC 2222.922599 2 0.9214 366 | 1/14 17 h-m-p 1.6000 8.0000 0.0801 CYC 2222.827755 2 1.3749 399 | 1/14 18 h-m-p 1.6000 8.0000 0.0307 YC 2222.802473 1 1.1577 430 | 1/14 19 h-m-p 1.6000 8.0000 0.0197 CC 2222.795788 1 1.7697 462 | 1/14 20 h-m-p 1.3869 8.0000 0.0252 ++ 2222.781357 m 8.0000 492 | 1/14 21 h-m-p 1.6000 8.0000 0.1066 +CC 2222.743194 1 6.2002 525 | 1/14 22 h-m-p 1.3607 6.8035 0.2002 YC 2222.719263 1 2.4172 556 | 1/14 23 h-m-p 0.8811 4.4057 0.1718 ++ 2222.679889 m 4.4057 586 | 2/14 24 h-m-p 0.6981 8.0000 1.0372 +YCC 2222.635955 2 1.9726 620 | 2/14 25 h-m-p 1.6000 8.0000 0.2747 C 2222.630896 0 1.6902 637 | 2/14 26 h-m-p 1.6000 8.0000 0.2244 CC 2222.629630 1 2.4074 668 | 2/14 27 h-m-p 1.6000 8.0000 0.0928 C 2222.629443 0 1.6590 697 | 2/14 28 h-m-p 1.6000 8.0000 0.0153 Y 2222.629421 0 2.6116 726 | 2/14 29 h-m-p 1.6000 8.0000 0.0090 C 2222.629408 0 2.2357 755 | 2/14 30 h-m-p 1.6000 8.0000 0.0059 Y 2222.629408 0 1.2705 784 | 2/14 31 h-m-p 1.6000 8.0000 0.0002 C 2222.629408 0 1.5179 813 | 2/14 32 h-m-p 1.6000 8.0000 0.0001 C 2222.629408 0 0.6015 842 | 2/14 33 h-m-p 1.1620 8.0000 0.0001 C 2222.629408 0 0.2905 871 | 2/14 34 h-m-p 0.3398 8.0000 0.0001 --------C 2222.629408 0 0.0000 908 Out.. lnL = -2222.629408 909 lfun, 10908 eigenQcodon, 89991 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2249.870308 S = -2185.890236 -55.162597 Calculating f(w|X), posterior probabilities of site classes. did 10 / 181 patterns 1:49 did 20 / 181 patterns 1:49 did 30 / 181 patterns 1:49 did 40 / 181 patterns 1:50 did 50 / 181 patterns 1:50 did 60 / 181 patterns 1:50 did 70 / 181 patterns 1:50 did 80 / 181 patterns 1:50 did 90 / 181 patterns 1:50 did 100 / 181 patterns 1:51 did 110 / 181 patterns 1:51 did 120 / 181 patterns 1:51 did 130 / 181 patterns 1:51 did 140 / 181 patterns 1:51 did 150 / 181 patterns 1:52 did 160 / 181 patterns 1:52 did 170 / 181 patterns 1:52 did 180 / 181 patterns 1:52 did 181 / 181 patterns 1:52 Time used: 1:52 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=355 D_melanogaster_Zip99C-PC MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG D_sechellia_Zip99C-PC MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG D_simulans_Zip99C-PC MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG D_yakuba_Zip99C-PC MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG D_erecta_Zip99C-PC MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG D_elegans_Zip99C-PC MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG *:******* *:**** *::***** ************************ D_melanogaster_Zip99C-PC IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA D_sechellia_Zip99C-PC IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA D_simulans_Zip99C-PC IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA D_yakuba_Zip99C-PC IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA D_erecta_Zip99C-PC IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA D_elegans_Zip99C-PC IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA ******************:***:*************************** D_melanogaster_Zip99C-PC WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV D_sechellia_Zip99C-PC WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV D_simulans_Zip99C-PC WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV D_yakuba_Zip99C-PC WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV D_erecta_Zip99C-PC WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV D_elegans_Zip99C-PC WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV *****************************************:******** D_melanogaster_Zip99C-PC EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE D_sechellia_Zip99C-PC EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE D_simulans_Zip99C-PC EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE D_yakuba_Zip99C-PC EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE D_erecta_Zip99C-PC EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE D_elegans_Zip99C-PC EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE ************::*:* **************.*******:* ****:** D_melanogaster_Zip99C-PC QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH D_sechellia_Zip99C-PC QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH D_simulans_Zip99C-PC QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH D_yakuba_Zip99C-PC QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH D_erecta_Zip99C-PC QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH D_elegans_Zip99C-PC QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH ************************************************** D_melanogaster_Zip99C-PC EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART D_sechellia_Zip99C-PC EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART D_simulans_Zip99C-PC EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART D_yakuba_Zip99C-PC EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART D_erecta_Zip99C-PC EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART D_elegans_Zip99C-PC EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART ************************************************** D_melanogaster_Zip99C-PC SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT D_sechellia_Zip99C-PC SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT D_simulans_Zip99C-PC SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT D_yakuba_Zip99C-PC SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT D_erecta_Zip99C-PC SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT D_elegans_Zip99C-PC SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT ***************************************:********** D_melanogaster_Zip99C-PC MLFEH D_sechellia_Zip99C-PC MLFEH D_simulans_Zip99C-PC MLFEH D_yakuba_Zip99C-PC MLFEH D_erecta_Zip99C-PC MLFEH D_elegans_Zip99C-PC MLFEH *****
>D_melanogaster_Zip99C-PC ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTTGAGTACA CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTAATTGGACTGAGTGGC ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGATTCAAAACTCCTGCGAGTGCTTCTGAGTTTCG CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTTCACCTGTTGCCAGAAGCC TGGGAGGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTACTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT TTTCCGGATATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCAAAGGAAAGGAAGGAA CAGCCGAAGAAGGTGGCTGGTTATCTGAACCTCTTGGCCAACTCAATTGA CAATTTCACACACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GACACGGCATTCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAACTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGAGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACCGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATTA AGCAGCTGCTAGCACTGGTATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >D_sechellia_Zip99C-PC ATGGCCACGAACAGCAGCTTCTTCGATGCACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATTATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGATTCCAAACTCCTGCGAGTGCTTCTGAGTTTCG CAGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT TCTCCGGTTATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG CAGCCGAAGAAGGTGGCTGGCTATCTGAACCTTTTGGCCAACTCAATAGA CAATTTCACACACGGTCTGGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GACACGGTATCCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAGCTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGAGGTTCTGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >D_simulans_Zip99C-PC ATGGCCACGAACAGCAGCTTCTTCGATGCACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CGCCATGGGTTTTCTCCCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATTATCATTCCCACAGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGATTCAAAACTCCTGCGAGTGCTTCTGAGTTTCG CAGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAGGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATCTTCACGATCGTGGAGAAAATCT TCTCCGGTTATGCCAGCGCGGACGAGGAGAACCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGCGGCCAACTACCAGAGGG CGAAACCTCTGAGAGTTGTGGCGGCGCCTGCGACATCGAAGATGTAGGTA AAGTCTGTTTCCTACGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG CAGCCGAAGAAGGTGGCTGGCTATCTGAACCTTTTGGCCAACTCAATAGA CAATTTCACACACGGTCTGGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GACACGGTATCCTAGCCACTTTTGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTCGCAATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAGCTACTCACGGCGGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGAGGTTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >D_yakuba_Zip99C-PC ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTC CAACCTGATGGACCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CACCATGGGTATTCTCTCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAATGATCCTGCAGAATCAAAACTCCTGCGAGTGCTTCTCAGTTTCG CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATCTTCACAATCGTGGAGAAAATCT TCTCCGGCTATGCGAGCGCGGACGACGAGAATCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGCTGCGTCGACATGGCGGCCAGCTACCAGATGG CGAAACCTCCGAGAGCTGTGGCGGCGCCTGCGATATCGAAGATGTGGGTA AAGTCTGTTTCCTGCGCGAGCAGGAACAGAAGTCGAAGGAAAAGAAGGAG CAGCCGAAGAAAGTGGCTGGGTATCTGAACCTTTTGGCCAATTCAATTGA CAATTTCACCCACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GGCACGGAATCCTAGCGACATTCGCCATATTGCTTCATGAAATTCCGCAC GAGGTGGGGGATTTTGCAATCCTGCTTCGATCTGGATTCAGTCGCTGGGA CGCCGCGCGTGCGCAGCTCCTCACGGCGGGAGCTGGCTTGCTCGGTGCTC TGGTAGCCATCGGAGGCTCCGGCGTAACATCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATCA AGCAGCTGCTGGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >D_erecta_Zip99C-PC ATGACCACGAACAGCAGCTTCTTCGATGAACACATCGCCATGATATACTT CAACCTGGTGGACCAGTACATGCCCGCGTACTTCAAAAGCTTCGAGTACA CACCATGGGTTTTCTCTCTGCTGGGATCGGTGGTCATTGGACTGAGTGGC ATATTCCCGCTGATCATCATTCCCACGGAGGAGAAAATGGCTAAGGAGGG ATACAAAGATCCTGCAGAATCAAAACTCCTGCGAGTGCTTCTCAGTTTTG CGGTCGGCGGTCTGCTGGGCGATGTGTTCCTCCACCTGTTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCTTCTAGTCACCCATCCCTGCGCTCGGG CCTTTGGGTCCTTTCCGGCATACTGATTTTCACAATCGTGGAGAAAATCT TTTCCGGCTATGCCAGCGCGGACGACGAGAATCCTCAGCCCAAGTGCGTG GAGATAGCCAACTGCCTGTTGCGTCGACATGGAGGCCAACTACCAGAGGG CGAAACGTCCGAGAGTTGTGGCGGCGCCTGCGATATCGAAGATGTGGGTA AAGTCTGTTTCCTACGCGAGCGGGAACAAAAGTCCAAGGAAAAGAAGGAG CAGCCGAAGAAAGTGGCTGGGTATCTGAACCTCTTGGCCAACTCAATCGA CAATTTCACACACGGTCTAGCCGTGGCTGGATCCTTTTTGGTGTCCTTCA GGCACGGAATCCTAGCGACATTCGCCATATTGCTTCACGAAATTCCACAC GAGGTGGGCGATTTCGCAATCCTGCTTAGATCTGGGTTCAGTCGTTGGGA CGCCGCGCGTGCGCAACTTCTCACGGCTGGAGCTGGCCTGCTCGGTGCTC TGGTGGCCATCGGTGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATTATGCCGTTCACTGCCGGCGGCTTTCTGCACATTGCTCTGGT CACAGTATTACCTGATCTCTTGAAGGAGGAGGAGCGCAAGGAGTCCATTA AGCAGCTGCTAGCACTGATATTTGGCATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC >D_elegans_Zip99C-PC ATGACCACCAACAGCAGCTTCTTCGATGAACATTTCGCTATGATATACTC GAACATAATGGATCAGTACATGCCCGAGTACTTCAAAAGCTTCGAGTACA CGCCATGGGTCTTCTCTCTGCTGGGATCGGTGGTCATCGGTCTGAGTGGC ATATTCCCACTGATCATCATTCCAACGGAGGAAAAAATGGCAAAAGAAGG ATATAAAGATCCTGCGGAATCTAAACTCCTGCGAGTTCTCCTAAGTTTTG CAGTCGGTGGACTCCTGGGTGATGTGTTTCTTCACTTGCTGCCAGAAGCC TGGGAAGGCGATAATCAAGATCCATCTAGTCACCCATCGCTGCGGTCGGG TCTTTGGGTCCTCTCCGGCATACTCATCTTCACAATAGTGGAGAAAATCT TCTCCGGATATGCCAGCGCGGACGAGGAAAATCCTCAGCCCAAGTGCGTC GAGATAGCCAACTGCCTGCTGCGGCGACATGGAGGAAAAATGCCTGAAGG TGGGACGTCCGAGAGTTGTGGTGGTGCCTGCGATATTGAAGATGTGGACA AAGTGTGCTTTCTCCGCGAACGGGAACTGAAGTCGAAGGAGAAGAAGGAA CAGCCTAAGAAAGTGGCTGGCTATCTGAACCTCTTGGCCAACTCAATTGA CAATTTCACACATGGTCTAGCTGTAGCTGGATCCTTTTTGGTATCCTTCA GACATGGAATCCTGGCCACATTTGCCATATTGCTGCATGAAATTCCGCAC GAGGTAGGCGATTTTGCCATCCTGCTTCGATCCGGATTCAGTCGCTGGGA CGCCGCGCGGGCGCAGCTCCTGACGGCGGGAGCTGGCCTTCTGGGCGCTC TGGTGGCCATCGGAGGCTCCGGCGTAACGTCGGCCATGGAGGCACGTACT TCGTGGATCATGCCGTTCACCGCCGGCGGCTTTCTGCACATTGCCCTGGT CACAGTATTACCTGATCTCTTAAAGGAAGAGGAGCGGAAGGAGTCTATTA AGCAGCTGCTAGCACTGATATTTGGGATTGCGTTAATGGCCGTGATGACC ATGCTATTCGAACAC
>D_melanogaster_Zip99C-PC MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKERKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALVFGIALMAVMT MLFEH >D_sechellia_Zip99C-PC MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >D_simulans_Zip99C-PC MATNSSFFDAHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >D_yakuba_Zip99C-PC MTTNSSFFDEHIAMIYSNLMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYNDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPDGETSESCGGACDIEDVGKVCFLREQEQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >D_erecta_Zip99C-PC MTTNSSFFDEHIAMIYFNLVDQYMPAYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADDENPQPKCV EIANCLLRRHGGQLPEGETSESCGGACDIEDVGKVCFLREREQKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH >D_elegans_Zip99C-PC MTTNSSFFDEHFAMIYSNIMDQYMPEYFKSFEYTPWVFSLLGSVVIGLSG IFPLIIIPTEEKMAKEGYKDPAESKLLRVLLSFAVGGLLGDVFLHLLPEA WEGDNQDPSSHPSLRSGLWVLSGILIFTIVEKIFSGYASADEENPQPKCV EIANCLLRRHGGKMPEGGTSESCGGACDIEDVDKVCFLRERELKSKEKKE QPKKVAGYLNLLANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPH EVGDFAILLRSGFSRWDAARAQLLTAGAGLLGALVAIGGSGVTSAMEART SWIMPFTAGGFLHIALVTVLPDLLKEEERKESIKQLLALIFGIALMAVMT MLFEH
#NEXUS [ID: 2888769014] begin taxa; dimensions ntax=6; taxlabels D_melanogaster_Zip99C-PC D_sechellia_Zip99C-PC D_simulans_Zip99C-PC D_yakuba_Zip99C-PC D_erecta_Zip99C-PC D_elegans_Zip99C-PC ; end; begin trees; translate 1 D_melanogaster_Zip99C-PC, 2 D_sechellia_Zip99C-PC, 3 D_simulans_Zip99C-PC, 4 D_yakuba_Zip99C-PC, 5 D_erecta_Zip99C-PC, 6 D_elegans_Zip99C-PC ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.02813158,(2:0.005191261,3:0.003040928)0.996:0.0154475,((4:0.03158444,5:0.04013755)0.696:0.02049849,6:0.4083381)0.943:0.03207637); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.02813158,(2:0.005191261,3:0.003040928):0.0154475,((4:0.03158444,5:0.04013755):0.02049849,6:0.4083381):0.03207637); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2349.51 -2360.38 2 -2349.62 -2360.11 -------------------------------------- TOTAL -2349.56 -2360.25 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/443/Zip99C-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.598460 0.009453 0.419233 0.783002 0.589213 1308.81 1336.85 1.000 r(A<->C){all} 0.060198 0.000535 0.017425 0.105924 0.058069 636.63 936.88 1.000 r(A<->G){all} 0.302016 0.002879 0.202935 0.407400 0.299056 671.05 673.71 1.000 r(A<->T){all} 0.095279 0.001031 0.036036 0.159353 0.092172 806.25 859.89 1.000 r(C<->G){all} 0.070218 0.000517 0.028129 0.114298 0.068591 881.69 922.77 1.001 r(C<->T){all} 0.442857 0.003376 0.334826 0.559949 0.442739 643.71 753.74 1.000 r(G<->T){all} 0.029432 0.000349 0.000369 0.065507 0.026363 783.06 888.64 1.000 pi(A){all} 0.232778 0.000154 0.209900 0.257917 0.232473 1247.18 1263.37 1.000 pi(C){all} 0.265570 0.000164 0.239568 0.289702 0.265306 1107.26 1235.94 1.001 pi(G){all} 0.271292 0.000176 0.245437 0.297976 0.271464 1275.61 1307.67 1.002 pi(T){all} 0.230360 0.000160 0.205557 0.254634 0.230313 1217.72 1259.88 1.002 alpha{1,2} 0.034983 0.000500 0.000101 0.074905 0.032654 1333.08 1334.50 1.000 alpha{3} 2.975165 0.830374 1.460144 4.822226 2.854021 1376.44 1421.17 1.000 pinvar{all} 0.552452 0.001549 0.471232 0.625442 0.554531 1390.96 1439.25 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/443/Zip99C-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 355 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 6 4 4 4 5 8 | Ser TCT 2 3 2 3 3 4 | Tyr TAT 2 2 2 2 2 3 | Cys TGT 2 2 2 2 2 1 TTC 15 17 17 17 17 14 | TCC 10 10 10 9 9 7 | TAC 5 5 5 5 5 4 | TGC 3 3 3 3 3 4 Leu TTA 2 2 2 2 2 3 | TCA 3 1 2 2 2 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 6 6 6 6 6 4 | TCG 4 5 5 5 4 7 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 6 6 6 6 6 4 | Pro CCT 4 4 4 4 4 5 | His CAT 2 2 2 2 1 5 | Arg CGT 3 3 3 3 4 1 CTC 5 5 5 7 7 9 | CCC 3 3 3 3 3 2 | CAC 8 8 8 8 9 5 | CGC 4 4 4 4 3 2 CTA 7 6 6 4 6 4 | CCA 4 4 4 4 5 6 | Gln CAA 3 2 2 1 4 1 | CGA 3 3 3 3 2 3 CTG 21 22 22 22 20 22 | CCG 4 4 4 4 3 2 | CAG 6 7 7 8 4 5 | CGG 0 0 0 0 1 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 9 7 7 7 8 7 | Thr ACT 2 3 3 2 2 1 | Asn AAT 2 2 2 5 3 3 | Ser AGT 5 5 5 4 5 5 ATC 9 10 10 11 10 9 | ACC 4 2 2 4 2 4 | AAC 6 6 6 4 5 5 | AGC 4 4 4 5 4 4 ATA 5 7 7 6 6 8 | ACA 2 2 3 5 5 4 | Lys AAA 6 6 6 6 7 9 | Arg AGA 1 1 1 0 1 1 Met ATG 10 10 10 10 9 11 | ACG 6 6 5 3 5 5 | AAG 10 11 11 10 10 9 | AGG 1 0 0 1 1 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 0 1 1 | Ala GCT 6 6 6 6 7 6 | Asp GAT 9 9 9 10 9 10 | Gly GGT 5 7 7 4 5 8 GTC 3 5 5 5 5 6 | GCC 14 15 15 12 13 14 | GAC 5 5 5 5 5 4 | GGC 18 17 17 18 18 11 GTA 6 3 3 4 2 5 | GCA 4 6 6 4 4 4 | Glu GAA 9 8 7 10 10 15 | GGA 8 7 7 8 7 11 GTG 11 11 11 11 13 8 | GCG 6 5 5 8 7 6 | GAG 19 19 20 17 17 13 | GGG 1 1 1 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Zip99C-PC position 1: T:0.18310 C:0.23380 A:0.23099 G:0.35211 position 2: T:0.34366 C:0.21972 A:0.25915 G:0.17746 position 3: T:0.18592 C:0.32676 A:0.17746 G:0.30986 Average T:0.23756 C:0.26009 A:0.22254 G:0.27981 #2: D_sechellia_Zip99C-PC position 1: T:0.18310 C:0.23380 A:0.23099 G:0.35211 position 2: T:0.34366 C:0.22254 A:0.25915 G:0.17465 position 3: T:0.18592 C:0.33521 A:0.16338 G:0.31549 Average T:0.23756 C:0.26385 A:0.21784 G:0.28075 #3: D_simulans_Zip99C-PC position 1: T:0.18310 C:0.23380 A:0.23099 G:0.35211 position 2: T:0.34366 C:0.22254 A:0.25915 G:0.17465 position 3: T:0.18310 C:0.33521 A:0.16620 G:0.31549 Average T:0.23662 C:0.26385 A:0.21878 G:0.28075 #4: D_yakuba_Zip99C-PC position 1: T:0.18310 C:0.23380 A:0.23380 G:0.34930 position 2: T:0.34366 C:0.21972 A:0.26197 G:0.17465 position 3: T:0.18028 C:0.33803 A:0.16620 G:0.31549 Average T:0.23568 C:0.26385 A:0.22066 G:0.27981 #5: D_erecta_Zip99C-PC position 1: T:0.18310 C:0.23099 A:0.23380 G:0.35211 position 2: T:0.34648 C:0.21972 A:0.25634 G:0.17746 position 3: T:0.18873 C:0.33239 A:0.17746 G:0.30141 Average T:0.23944 C:0.26103 A:0.22254 G:0.27700 #6: D_elegans_Zip99C-PC position 1: T:0.18310 C:0.22817 A:0.23944 G:0.34930 position 2: T:0.34648 C:0.21972 A:0.25634 G:0.17746 position 3: T:0.20282 C:0.29296 A:0.21127 G:0.29296 Average T:0.24413 C:0.24695 A:0.23568 G:0.27324 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 31 | Ser S TCT 17 | Tyr Y TAT 13 | Cys C TGT 11 TTC 97 | TCC 55 | TAC 29 | TGC 19 Leu L TTA 13 | TCA 11 | *** * TAA 0 | *** * TGA 0 TTG 34 | TCG 30 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 34 | Pro P CCT 25 | His H CAT 14 | Arg R CGT 17 CTC 38 | CCC 17 | CAC 46 | CGC 21 CTA 33 | CCA 27 | Gln Q CAA 13 | CGA 17 CTG 129 | CCG 21 | CAG 37 | CGG 6 ------------------------------------------------------------------------------ Ile I ATT 45 | Thr T ACT 13 | Asn N AAT 17 | Ser S AGT 29 ATC 59 | ACC 18 | AAC 32 | AGC 25 ATA 39 | ACA 21 | Lys K AAA 40 | Arg R AGA 5 Met M ATG 60 | ACG 30 | AAG 61 | AGG 3 ------------------------------------------------------------------------------ Val V GTT 5 | Ala A GCT 37 | Asp D GAT 56 | Gly G GGT 36 GTC 29 | GCC 83 | GAC 29 | GGC 99 GTA 23 | GCA 28 | Glu E GAA 59 | GGA 48 GTG 65 | GCG 37 | GAG 105 | GGG 9 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.18310 C:0.23239 A:0.23333 G:0.35117 position 2: T:0.34460 C:0.22066 A:0.25869 G:0.17606 position 3: T:0.18779 C:0.32676 A:0.17700 G:0.30845 Average T:0.23850 C:0.25994 A:0.22300 G:0.27856 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Zip99C-PC D_sechellia_Zip99C-PC 0.0541 (0.0050 0.0926) D_simulans_Zip99C-PC 0.0596 (0.0050 0.0841)-1.0000 (0.0000 0.0153) D_yakuba_Zip99C-PC 0.0398 (0.0075 0.1891) 0.0469 (0.0075 0.1604) 0.0469 (0.0075 0.1604) D_erecta_Zip99C-PC 0.0577 (0.0101 0.1741) 0.0547 (0.0101 0.1839) 0.0547 (0.0101 0.1838) 0.0548 (0.0075 0.1373) D_elegans_Zip99C-PC 0.0283 (0.0151 0.5343) 0.0279 (0.0151 0.5425) 0.0275 (0.0151 0.5501) 0.0315 (0.0164 0.5213) 0.0293 (0.0158 0.5388) Model 0: one-ratio TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 178 lnL(ntime: 9 np: 11): -2223.045425 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.045311 0.031198 0.007558 0.004323 0.041740 0.025977 0.053893 0.069697 0.361716 2.391925 0.037672 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.64141 (1: 0.045311, (2: 0.007558, 3: 0.004323): 0.031198, ((4: 0.053893, 5: 0.069697): 0.025977, 6: 0.361716): 0.041740); (D_melanogaster_Zip99C-PC: 0.045311, (D_sechellia_Zip99C-PC: 0.007558, D_simulans_Zip99C-PC: 0.004323): 0.031198, ((D_yakuba_Zip99C-PC: 0.053893, D_erecta_Zip99C-PC: 0.069697): 0.025977, D_elegans_Zip99C-PC: 0.361716): 0.041740); Detailed output identifying parameters kappa (ts/tv) = 2.39193 omega (dN/dS) = 0.03767 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.045 769.2 295.8 0.0377 0.0019 0.0495 1.4 14.6 7..8 0.031 769.2 295.8 0.0377 0.0013 0.0341 1.0 10.1 8..2 0.008 769.2 295.8 0.0377 0.0003 0.0083 0.2 2.4 8..3 0.004 769.2 295.8 0.0377 0.0002 0.0047 0.1 1.4 7..9 0.042 769.2 295.8 0.0377 0.0017 0.0456 1.3 13.5 9..10 0.026 769.2 295.8 0.0377 0.0011 0.0284 0.8 8.4 10..4 0.054 769.2 295.8 0.0377 0.0022 0.0589 1.7 17.4 10..5 0.070 769.2 295.8 0.0377 0.0029 0.0762 2.2 22.5 9..6 0.362 769.2 295.8 0.0377 0.0149 0.3954 11.5 117.0 tree length for dN: 0.0264 tree length for dS: 0.7011 Time used: 0:04 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 178 lnL(ntime: 9 np: 12): -2222.793950 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.045372 0.031230 0.007566 0.004327 0.041809 0.026034 0.053990 0.069789 0.362729 2.408241 0.994121 0.033842 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.64285 (1: 0.045372, (2: 0.007566, 3: 0.004327): 0.031230, ((4: 0.053990, 5: 0.069789): 0.026034, 6: 0.362729): 0.041809); (D_melanogaster_Zip99C-PC: 0.045372, (D_sechellia_Zip99C-PC: 0.007566, D_simulans_Zip99C-PC: 0.004327): 0.031230, ((D_yakuba_Zip99C-PC: 0.053990, D_erecta_Zip99C-PC: 0.069789): 0.026034, D_elegans_Zip99C-PC: 0.362729): 0.041809); Detailed output identifying parameters kappa (ts/tv) = 2.40824 dN/dS (w) for site classes (K=2) p: 0.99412 0.00588 w: 0.03384 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.045 769.0 296.0 0.0395 0.0020 0.0494 1.5 14.6 7..8 0.031 769.0 296.0 0.0395 0.0013 0.0340 1.0 10.1 8..2 0.008 769.0 296.0 0.0395 0.0003 0.0082 0.3 2.4 8..3 0.004 769.0 296.0 0.0395 0.0002 0.0047 0.1 1.4 7..9 0.042 769.0 296.0 0.0395 0.0018 0.0455 1.4 13.5 9..10 0.026 769.0 296.0 0.0395 0.0011 0.0283 0.9 8.4 10..4 0.054 769.0 296.0 0.0395 0.0023 0.0587 1.8 17.4 10..5 0.070 769.0 296.0 0.0395 0.0030 0.0759 2.3 22.5 9..6 0.363 769.0 296.0 0.0395 0.0156 0.3945 12.0 116.8 Time used: 0:10 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 178 lnL(ntime: 9 np: 14): -2222.793950 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.045372 0.031230 0.007566 0.004327 0.041809 0.026034 0.053990 0.069789 0.362729 2.408239 0.994121 0.002802 0.033842 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.64285 (1: 0.045372, (2: 0.007566, 3: 0.004327): 0.031230, ((4: 0.053990, 5: 0.069789): 0.026034, 6: 0.362729): 0.041809); (D_melanogaster_Zip99C-PC: 0.045372, (D_sechellia_Zip99C-PC: 0.007566, D_simulans_Zip99C-PC: 0.004327): 0.031230, ((D_yakuba_Zip99C-PC: 0.053990, D_erecta_Zip99C-PC: 0.069789): 0.026034, D_elegans_Zip99C-PC: 0.362729): 0.041809); Detailed output identifying parameters kappa (ts/tv) = 2.40824 dN/dS (w) for site classes (K=3) p: 0.99412 0.00280 0.00308 w: 0.03384 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.045 769.0 296.0 0.0395 0.0020 0.0493 1.5 14.6 7..8 0.031 769.0 296.0 0.0395 0.0013 0.0340 1.0 10.1 8..2 0.008 769.0 296.0 0.0395 0.0003 0.0082 0.3 2.4 8..3 0.004 769.0 296.0 0.0395 0.0002 0.0047 0.1 1.4 7..9 0.042 769.0 296.0 0.0395 0.0018 0.0455 1.4 13.5 9..10 0.026 769.0 296.0 0.0395 0.0011 0.0283 0.9 8.4 10..4 0.054 769.0 296.0 0.0395 0.0023 0.0587 1.8 17.4 10..5 0.070 769.0 296.0 0.0395 0.0030 0.0759 2.3 22.5 9..6 0.363 769.0 296.0 0.0395 0.0156 0.3945 12.0 116.8 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zip99C-PC) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.811 0.100 0.031 0.016 0.010 0.008 0.007 0.006 0.006 0.005 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 0:23 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 178 lnL(ntime: 9 np: 15): -2222.622231 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.045351 0.031201 0.007563 0.004323 0.041867 0.025891 0.053933 0.069773 0.362547 2.400969 0.252597 0.383875 0.000001 0.000001 0.106385 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.64245 (1: 0.045351, (2: 0.007563, 3: 0.004323): 0.031201, ((4: 0.053933, 5: 0.069773): 0.025891, 6: 0.362547): 0.041867); (D_melanogaster_Zip99C-PC: 0.045351, (D_sechellia_Zip99C-PC: 0.007563, D_simulans_Zip99C-PC: 0.004323): 0.031201, ((D_yakuba_Zip99C-PC: 0.053933, D_erecta_Zip99C-PC: 0.069773): 0.025891, D_elegans_Zip99C-PC: 0.362547): 0.041867); Detailed output identifying parameters kappa (ts/tv) = 2.40097 dN/dS (w) for site classes (K=3) p: 0.25260 0.38388 0.36353 w: 0.00000 0.00000 0.10638 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.045 769.1 295.9 0.0387 0.0019 0.0494 1.5 14.6 7..8 0.031 769.1 295.9 0.0387 0.0013 0.0340 1.0 10.1 8..2 0.008 769.1 295.9 0.0387 0.0003 0.0082 0.2 2.4 8..3 0.004 769.1 295.9 0.0387 0.0002 0.0047 0.1 1.4 7..9 0.042 769.1 295.9 0.0387 0.0018 0.0456 1.4 13.5 9..10 0.026 769.1 295.9 0.0387 0.0011 0.0282 0.8 8.4 10..4 0.054 769.1 295.9 0.0387 0.0023 0.0588 1.7 17.4 10..5 0.070 769.1 295.9 0.0387 0.0029 0.0761 2.3 22.5 9..6 0.363 769.1 295.9 0.0387 0.0153 0.3952 11.8 116.9 Naive Empirical Bayes (NEB) analysis Time used: 0:34 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 178 lnL(ntime: 9 np: 12): -2222.629193 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.045353 0.031204 0.007563 0.004323 0.041862 0.025903 0.053938 0.069775 0.362580 2.401393 0.370129 8.608144 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.64250 (1: 0.045353, (2: 0.007563, 3: 0.004323): 0.031204, ((4: 0.053938, 5: 0.069775): 0.025903, 6: 0.362580): 0.041862); (D_melanogaster_Zip99C-PC: 0.045353, (D_sechellia_Zip99C-PC: 0.007563, D_simulans_Zip99C-PC: 0.004323): 0.031204, ((D_yakuba_Zip99C-PC: 0.053938, D_erecta_Zip99C-PC: 0.069775): 0.025903, D_elegans_Zip99C-PC: 0.362580): 0.041862); Detailed output identifying parameters kappa (ts/tv) = 2.40139 Parameters in M7 (beta): p = 0.37013 q = 8.60814 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00003 0.00052 0.00210 0.00530 0.01077 0.01941 0.03270 0.05357 0.08942 0.17323 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.045 769.1 295.9 0.0387 0.0019 0.0494 1.5 14.6 7..8 0.031 769.1 295.9 0.0387 0.0013 0.0340 1.0 10.1 8..2 0.008 769.1 295.9 0.0387 0.0003 0.0082 0.2 2.4 8..3 0.004 769.1 295.9 0.0387 0.0002 0.0047 0.1 1.4 7..9 0.042 769.1 295.9 0.0387 0.0018 0.0456 1.4 13.5 9..10 0.026 769.1 295.9 0.0387 0.0011 0.0282 0.8 8.4 10..4 0.054 769.1 295.9 0.0387 0.0023 0.0588 1.8 17.4 10..5 0.070 769.1 295.9 0.0387 0.0029 0.0761 2.3 22.5 9..6 0.363 769.1 295.9 0.0387 0.0153 0.3952 11.8 117.0 Time used: 1:12 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 178 lnL(ntime: 9 np: 14): -2222.629408 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.045353 0.031204 0.007563 0.004323 0.041862 0.025903 0.053938 0.069776 0.362580 2.401409 0.999990 0.370515 8.619079 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.64250 (1: 0.045353, (2: 0.007563, 3: 0.004323): 0.031204, ((4: 0.053938, 5: 0.069776): 0.025903, 6: 0.362580): 0.041862); (D_melanogaster_Zip99C-PC: 0.045353, (D_sechellia_Zip99C-PC: 0.007563, D_simulans_Zip99C-PC: 0.004323): 0.031204, ((D_yakuba_Zip99C-PC: 0.053938, D_erecta_Zip99C-PC: 0.069776): 0.025903, D_elegans_Zip99C-PC: 0.362580): 0.041862); Detailed output identifying parameters kappa (ts/tv) = 2.40141 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.37051 q = 8.61908 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00003 0.00053 0.00210 0.00531 0.01078 0.01942 0.03271 0.05357 0.08939 0.17312 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.045 769.1 295.9 0.0387 0.0019 0.0494 1.5 14.6 7..8 0.031 769.1 295.9 0.0387 0.0013 0.0340 1.0 10.1 8..2 0.008 769.1 295.9 0.0387 0.0003 0.0082 0.2 2.4 8..3 0.004 769.1 295.9 0.0387 0.0002 0.0047 0.1 1.4 7..9 0.042 769.1 295.9 0.0387 0.0018 0.0456 1.4 13.5 9..10 0.026 769.1 295.9 0.0387 0.0011 0.0282 0.8 8.4 10..4 0.054 769.1 295.9 0.0387 0.0023 0.0588 1.8 17.4 10..5 0.070 769.1 295.9 0.0387 0.0029 0.0761 2.3 22.5 9..6 0.363 769.1 295.9 0.0387 0.0153 0.3952 11.8 117.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zip99C-PC) Pr(w>1) post mean +- SE for w 191 Q 0.610 1.130 +- 0.673 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.048 0.218 0.727 ws: 0.927 0.049 0.010 0.004 0.002 0.002 0.001 0.001 0.001 0.001 Time used: 1:52
Model 1: NearlyNeutral -2222.79395 Model 2: PositiveSelection -2222.79395 Model 0: one-ratio -2223.045425 Model 3: discrete -2222.622231 Model 7: beta -2222.629193 Model 8: beta&w>1 -2222.629408 Model 0 vs 1 0.5029499999991458 Model 2 vs 1 0.0 Model 8 vs 7 4.2999999914172804E-4