--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 16:55:18 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip89B-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2806.50         -2815.86
2      -2806.71         -2815.64
--------------------------------------
TOTAL    -2806.60         -2815.76
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.203489    0.001322    0.143663    0.281073    0.199588   1262.08   1307.31    1.000
r(A<->C){all}   0.077292    0.000864    0.024459    0.137009    0.074693   1112.90   1113.90    1.000
r(A<->G){all}   0.406098    0.004247    0.284573    0.537894    0.403163    860.87   1011.36    1.000
r(A<->T){all}   0.074868    0.001084    0.016950    0.142284    0.071443    974.28    982.94    1.000
r(C<->G){all}   0.057069    0.000479    0.017173    0.101070    0.055354   1081.54   1092.55    1.000
r(C<->T){all}   0.325257    0.003596    0.209997    0.444509    0.322226    862.47    865.27    1.000
r(G<->T){all}   0.059417    0.000639    0.017678    0.111773    0.056248    957.28   1099.68    1.000
pi(A){all}      0.224096    0.000110    0.204007    0.244799    0.223758   1199.13   1236.26    1.000
pi(C){all}      0.295938    0.000130    0.272312    0.316819    0.296164   1189.43   1280.51    1.000
pi(G){all}      0.264399    0.000124    0.243173    0.285907    0.264073   1302.65   1354.45    1.000
pi(T){all}      0.215567    0.000109    0.195730    0.235809    0.215371   1501.00   1501.00    1.000
alpha{1,2}      0.049386    0.001265    0.000120    0.115710    0.044077   1402.98   1406.35    1.000
alpha{3}        2.188214    0.681599    0.876443    3.798849    2.074293   1489.79   1495.40    1.000
pinvar{all}     0.623514    0.003392    0.513393    0.731641    0.629904   1374.42   1395.02    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2636.186063
Model 2: PositiveSelection	-2636.186063
Model 0: one-ratio	-2639.765024
Model 3: discrete	-2636.161413
Model 7: beta	-2636.173217
Model 8: beta&w>1	-2636.170539


Model 0 vs 1	7.157921999999417

Model 2 vs 1	0.0

Model 8 vs 7	0.005355999999665073
>C1
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDLDDNDHDHDHDDDNDDDES
GVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKCLL
YFGGGVLLATTFLHLLPEVQEVVEELQECGIIGELTFPLAELLMCCGFFL
MYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTAPP
APLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGHSH
LPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVWFM
FGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGILI
NHGEETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFVGF
LVMFGLQQLTSIGGHGHSHSHSSCSTSEHTHNHQETETETRSASGHTHGH
QHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAo
>C2
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDHNDHDHNHDHDEDDESG
VLVAKVTAMVVLFCASAICGSLPFLLNRCYRWTENQTNARSAIVVKCLLY
FGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGFFLM
YFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTAPPA
PLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGHSHL
PVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVWFMF
GAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGILIN
HGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFVGFL
VMFGLQQLTSGGHSHSHSHSSCSSSDTHTHNHQETETETKSASGHTHGHE
HDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAoo
>C3
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDDNDHDHDHDHDHDEDDE
SGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKCL
LYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGFF
LMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTAP
PAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGHS
HLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVWF
MFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGIL
INHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFVG
FLVMFGLQQLTSGGHSHSHSHSSCSSSDTHTHNHQETETETRSASGHTHG
HEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA
>C4
MNQTQVNNFLKCFLQIDEPSSRWTSRHDGEDNDDNDHDHDHDHDHDEDDE
SGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKCL
LYFGGGVLLATTFLHLLPEVQEVVEVLQECGVIGKLTFPLAELLMCCGFF
LMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLMKPTEGNNTTPSAP
PAPLAGTAELGTLSVQNLLQNDLEQQKFATKQQQQVNGHGHSHGHGHGHS
HLPVIADDAAAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVWF
MFGAVSAHKLVLAFCVGVELIVARTRMLLAVIYVVTFAVVSPLGIGIGIL
INHGQETSGPSLISAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFVG
FLLMFGLQQLTSSGGHGHSHSHSSCSSSEHNHQEIETETRSASGHTHGHE
HDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEGHPKKDAoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=500 

C1              MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDLDDN--DHDHDHDDDNDDD
C2              MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDHN--DHDHNHDHD-EDD
C3              MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDDNDHDHDHDHDHD-EDD
C4              MNQTQVNNFLKCFLQIDEPSSRWTSRHDGEDNDDNDHDHDHDHDHD-EDD
                ********************.********** *.*  ****:**.* :**

C1              ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
C2              ESGVLVAKVTAMVVLFCASAICGSLPFLLNRCYRWTENQTNARSAIVVKC
C3              ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
C4              ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
                ************************:*************************

C1              LLYFGGGVLLATTFLHLLPEVQEVVEELQECGIIGELTFPLAELLMCCGF
C2              LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
C3              LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
C4              LLYFGGGVLLATTFLHLLPEVQEVVEVLQECGVIGKLTFPLAELLMCCGF
                ************************** **** :**:**************

C1              FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
C2              FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
C3              FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
C4              FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLMKPTEGNNTTPSA
                *************************************:****** ***:*

C1              PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
C2              PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
C3              PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
C4              PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKQQQQVNGHGHSHGHGHGH
                ******************************** ***.*************

C1              SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
C2              SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
C3              SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
C4              SHLPVIADDAAAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
                ********** ********************************.******

C1              FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
C2              FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
C3              FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
C4              FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVIYVVTFAVVSPLGIGIGI
                ********************************:**:**************

C1              LINHGEETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
C2              LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
C3              LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
C4              LINHGQETSGPSLISAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
                *****:*******:************************************

C1              GFLVMFGLQQLTSIGGHGHSHSHSSCSTS-EHTHNHQETETETRSASGHT
C2              GFLVMFGLQQLTS-GGHSHSHSHSSCSSSDTHTHNHQETETETKSASGHT
C3              GFLVMFGLQQLTS-GGHSHSHSHSSCSSSDTHTHNHQETETETRSASGHT
C4              GFLLMFGLQQLTSSGGHGHSHSHSSCSSS---EHNHQEIETETRSASGHT
                ***:********* ***.*********:*    ***** ****:******

C1              HGHQHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAo-
C2              HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAoo
C3              HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA--
C4              HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEGHPKKDAoo
                ***:*************************************.******  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  496 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  496 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6162]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [6162]--->[6138]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip89B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.272 Mb, Max= 30.629 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDLDDN--DHDHDHDDDNDDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECGIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGEETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTSIGGHGHSHSHSSCSTS-EHTHNHQETETETRSASGHT
HGHQHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAo-
>C2
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDHN--DHDHNHDHD-EDD
ESGVLVAKVTAMVVLFCASAICGSLPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTS-GGHSHSHSHSSCSSSDTHTHNHQETETETKSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAoo
>C3
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDDNDHDHDHDHDHD-EDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTS-GGHSHSHSHSSCSSSDTHTHNHQETETETRSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA--
>C4
MNQTQVNNFLKCFLQIDEPSSRWTSRHDGEDNDDNDHDHDHDHDHD-EDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEVLQECGVIGKLTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLMKPTEGNNTTPSA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKQQQQVNGHGHSHGHGHGH
SHLPVIADDAAAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVIYVVTFAVVSPLGIGIGI
LINHGQETSGPSLISAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLLMFGLQQLTSSGGHGHSHSHSSCSSS---EHNHQEIETETRSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEGHPKKDAoo

FORMAT of file /tmp/tmp3773651343639120743aln Not Supported[FATAL:T-COFFEE]
>C1
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDLDDN--DHDHDHDDDNDDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECGIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGEETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTSIGGHGHSHSHSSCSTS-EHTHNHQETETETRSASGHT
HGHQHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAo-
>C2
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDHN--DHDHNHDHD-EDD
ESGVLVAKVTAMVVLFCASAICGSLPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTS-GGHSHSHSHSSCSSSDTHTHNHQETETETKSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDAoo
>C3
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDDNDHDHDHDHDHD-EDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTS-GGHSHSHSHSSCSSSDTHTHNHQETETETRSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA--
>C4
MNQTQVNNFLKCFLQIDEPSSRWTSRHDGEDNDDNDHDHDHDHDHD-EDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEVLQECGVIGKLTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLMKPTEGNNTTPSA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKQQQQVNGHGHSHGHGHGH
SHLPVIADDAAAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVIYVVTFAVVSPLGIGIGI
LINHGQETSGPSLISAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLLMFGLQQLTSSGGHGHSHSHSSCSSS---EHNHQEIETETRSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEGHPKKDAoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:500 S:98 BS:500
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.17 C1	 C2	 97.17
TOP	    1    0	 97.17 C2	 C1	 97.17
BOT	    0    2	 97.97 C1	 C3	 97.97
TOP	    2    0	 97.97 C3	 C1	 97.97
BOT	    0    3	 95.13 C1	 C4	 95.13
TOP	    3    0	 95.13 C4	 C1	 95.13
BOT	    1    2	 99.19 C2	 C3	 99.19
TOP	    2    1	 99.19 C3	 C2	 99.19
BOT	    1    3	 94.93 C2	 C4	 94.93
TOP	    3    1	 94.93 C4	 C2	 94.93
BOT	    2    3	 95.74 C3	 C4	 95.74
TOP	    3    2	 95.74 C4	 C3	 95.74
AVG	 0	 C1	  *	 96.76
AVG	 1	 C2	  *	 97.10
AVG	 2	 C3	  *	 97.63
AVG	 3	 C4	  *	 95.27
TOT	 TOT	  *	 96.69
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAATCAAACGCAAGTAAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
C2              ATGAATCAAACGCAAGTGAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
C3              ATGAATCAAACGCAAGTGAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
C4              ATGAATCAAACGCAAGTGAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
                *****************.********************************

C1              TGAGCCGTCCAACCGTTGGACATCACGTCACGACGGGGAGGATCTCGATG
C2              TGAGCCGTCCAACCGTTGGACATCACGTCACGACGGGGAGGATCACGATC
C3              TGAGCCGTCCAACCGTTGGACATCACGTCACGACGGGGAGGATCACGATG
C4              TGAGCCGTCCAGCCGTTGGACATCACGTCACGACGGGGAGGATAACGATG
                ***********.*******************************.:**** 

C1              ATAAC------GACCATGATCATGATCATGACGACGACAACGACGACGAC
C2              ATAAC------GACCATGATCATAATCATGATCATGAC---GAGGACGAC
C3              ATAACGACCATGATCATGATCATGATCATGATCATGAC---GAGGACGAC
C4              ATAACGACCACGATCATGATCATGATCATGATCATGAC---GAAGACGAC
                *****      ** *********.*******  * ***   ** ******

C1              GAGAGTGGCGTTCTGGTTGCCAAGGTCACAGCCATGGTGGTGCTATTTTG
C2              GAGAGTGGCGTTCTGGTTGCCAAGGTCACAGCCATGGTGGTGCTATTTTG
C3              GAGAGTGGCGTTCTGGTTGCCAAGGTCACAGCCATGGTGGTGCTATTTTG
C4              GAGAGTGGCGTTCTGGTTGCGAAGGTCACAGCCATGGTGGTGCTATTCTG
                ******************** ************************** **

C1              CGCCAGCGCGATCTGCGGGTCCATTCCCTTCTTGCTTAACCGTTGCTATC
C2              CGCCAGCGCTATCTGCGGATCCCTTCCCTTCTTGCTCAACCGTTGCTATC
C3              CGCCAGCGCGATCTGCGGATCCATTCCCTTCTTGCTCAACCGTTGCTATC
C4              CGCCAGCGCAATCTGCGGATCCATTCCCTTTTTACTCAACCGCTGCTATC
                ********* ********.***.******* **.** ***** *******

C1              GCTGGACGGAAAACCAGACGAACGCACGATCCGCCATTGTGGTCAAATGC
C2              GCTGGACGGAAAACCAGACGAATGCACGATCCGCCATTGTGGTCAAGTGC
C3              GCTGGACGGAAAACCAAACGAATGCACGATCCGCCATTGTGGTCAAGTGC
C4              GCTGGACGGAAAACCAGACGAATGCGCGATCCGCCATTGTAGTGAAGTGC
                ****************.***** **.**************.** **.***

C1              CTGCTGTACTTTGGAGGCGGCGTCCTGCTAGCCACCACCTTTCTCCATCT
C2              CTGCTGTACTTTGGAGGCGGCGTCCTTCTGGCCACCACCTTTCTCCATCT
C3              CTGCTGTACTTTGGAGGAGGCGTCCTACTGGCCACCACCTTTCTCCATCT
C4              CTGCTGTATTTTGGAGGCGGCGTCCTGCTGGCCACCACCTTTCTCCATCT
                ******** ********.******** **.********************

C1              CTTGCCCGAAGTTCAGGAGGTCGTCGAAGAGCTGCAGGAGTGCGGCATCA
C2              CTTGCCCGAAGTTCAGGAGGTCGTCGAAGAGCTGCAGGAGTGCGAGATCA
C3              CTTGCCCGAAGTTCAGGAGGTCGTCGAAGAGCTGCAGGAGTGCGAGATCA
C4              CCTGCCCGAAGTTCAGGAAGTCGTGGAGGTGCTGCAGGAGTGCGGCGTCA
                * ****************.***** **.*:**************. .***

C1              TCGGAGAGCTCACTTTTCCGCTGGCCGAGCTTCTCATGTGCTGTGGCTTC
C2              TCGGGGAGCTCACTTTTCCGCTGGCCGAGCTGCTCATGTGCTGTGGCTTC
C3              TCGGGGAGCTCACTTTTCCGCTGGCCGAGCTGCTCATGTGCTGTGGCTTC
C4              TCGGGAAACTCACTTTTCCGCTGGCCGAGCTGCTCATGTGCTGCGGCTTC
                ****..*.*********************** *********** ******

C1              TTCCTCATGTACTTCATCGAGGAGGCCATGCACACGTATGTCCATCATCA
C2              TTCCTCATGTACTTCATCGAGGAGGCCATGCACACGTATGTCCATCATCA
C3              TTCCTCATGTACTTCATCGAGGAGGCCATGCACACATATGTCCATCATCA
C4              TTTCTCATGTACTTCATCGAGGAGGCAATGCACACGTATGTCCATCATCA
                ** ***********************.********.**************

C1              TCAGAAGGATGAGGCTGGCGCCGCTTTCGAGCGGGGTCACAGCATCCGAA
C2              TCAGAAGGATGAGGCTGGCGCCGCCTTCGAACGGGGTCACAGCATCCGAA
C3              TCAGAAGGATGAGGCTGGCGCCGCCTTCGAGCGGGGTCACAGCATCCGAA
C4              TCAGAAGGATGAGGCGGGCGCCGCCTTCGAGCGGGGTCATAGCATCCGGA
                *************** ******** *****.******** ********.*

C1              ACAGCCACCTGCTGAAACCCACCGAAGGCAACGCTACCACACCCACAGCC
C2              ACAGCCACCTGCTGAAACCCACCGAAGGCAATGCTACCACACCCACTGCC
C3              ACAGCCACCTGCTGAAACCCACCGAAGGCAACGCTACCACACCCACTGCC
C4              ACAGCCACCTGATGAAACCCACCGAAGGCAACAATACCACACCCTCTGCC
                ***********.******************* ..**********:*:***

C1              CCACCGGCGCCATTGGCTGGCACCGCTGAACTTGGAACACTATCGGTGCA
C2              CCGCCGGCGCCTTTGGCTGGCACCGCTGAACTTGGAACACTATCGGTGCA
C3              CCACCGGCGCCTTTGGCTGGCACCGCTGAACTTGGAACACTGTCGGTGCA
C4              CCACCGGCGCCATTGGCTGGCACCGCTGAGCTTGGAACACTCTCGGTGCA
                **.********:*****************.*********** ********

C1              GAATCTCCTGCAAAACGATCTGGAGCAGCAAAAGTTTGCTACCAAGCCAC
C2              GAATCTCCTGCAGAACGATCTGGAGCAGCAAAAGTTTGCTACCAAGCCAC
C3              GAATCTCCTGCAGAACGATCTGGAGCAGCAAAAGTTTGCTACCAAGCCAC
C4              AAATCTCCTACAGAACGATCTGGAGCAGCAAAAGTTTGCCACCAAGCAAC
                .********.**.************************** *******.**

C1              AGCAACAAGCTAATGGACACGGACACAGCCACGGGCATGGACATGGACAT
C2              AGCAACAAGCTAATGGACACGGACACAGCCATGGGCATGGACATGGACAT
C3              AGCAACAAGCTAATGGACACGGACACAGCCACGGGCATGGACATGGGCAT
C4              AGCAACAGGTTAATGGACACGGACACAGCCACGGGCATGGGCATGGACAT
                *******.* ********************* ********.*****.***

C1              AGCCATCTACCAGTAATCGCAGACGATGCCGATGCGGGGGACATGTTGGC
C2              AGCCATCTACCAGTAATCGCAGACGATGCCGATGCGGGGGACATGTTGGC
C3              AGCCACCTACCAGTAATCGCAGACGATGCCGATGCGGGGGACATGTTGGC
C4              AGCCATCTACCAGTCATTGCAGACGATGCCGCTGCGGGGGACATGCTGGC
                ***** ********.** *************.************* ****

C1              TTCATCTCTGCGCGGACTCTTCATCGTTTCCGCTCTGTCGCTGCACGAAC
C2              TTCATCTCTGCGAGGACTCTTCATCGTTTCCGCTCTGTCGCTGCACGAAC
C3              TTCATCTCTGCGAGGACTCTTCATCGTTTCCGCTCTGTCGCTGCACGAAC
C4              TTCATCCCTGCGAGGACTCTTCATTGTTTCCGCTCTTTCGCTGCACGAAC
                ****** *****.*********** *********** *************

C1              TCTTTGAGGGCATGGCCATTGGCCTAGAGAGCTCCGCCAGTTCGGTGTGG
C2              TCTTTGAGGGCATGGCCATTGGCCTGGAGGGTTCCGCCAGTTCGGTGTGG
C3              TCTTTGAGGGCATGGCCATTGGCCTGGAGGGTTCCGCCAGTTCGGTGTGG
C4              TCTTTGAGGGCATGGCCATTGGCCTAGAGAGCTCCGCCAGTTCGGTGTGG
                *************************.***.* ******************

C1              TTTATGTTCGGTGCCGTTTCCGCACACAAATTGGTCCTGGCCTTCTGCGT
C2              TTTATGTTCGGCGCCGTTTCCGCACACAAATTGGTCCTGGCCTTCTGCGT
C3              TTTATGTTCGGCGCCGTTTCCGCACACAAATTGGTCCTGGCCTTCTGCGT
C4              TTTATGTTCGGCGCCGTTTCCGCGCACAAATTGGTCCTGGCCTTCTGCGT
                *********** ***********.**************************

C1              GGGCGTCGAGCTGATCGTGGCCAGGACCCGGATGTTACTGGCCGTTCTCT
C2              GGGCGTCGAGCTGATCGTGGCCAGGACCCGGATGTTACTGGCCGTTCTCT
C3              GGGCGTCGAGCTGATCGTGGCCAGGACCCGGATGTTACTGGCCGTTCTCT
C4              GGGCGTCGAGCTGATCGTGGCCAGGACTCGGATGTTACTGGCCGTTATCT
                *************************** ******************.***

C1              ATGTGTTGACCTTTGCGGTGGTTAGCCCTCTGGGCATCGGAATCGGGATT
C2              ATGTGCTGACCTTTGCGGTGGTTAGCCCGCTGGGCATCGGAATCGGGATT
C3              ATGTGCTGACCTTTGCGGTGGTTAGCCCGCTGGGCATCGGAATCGGGATT
C4              ATGTGGTGACCTTCGCCGTGGTTAGCCCGCTTGGCATCGGCATCGGGATT
                ***** ******* ** *********** ** ********.*********

C1              TTGATAAATCACGGCGAAGAGACATCCGGACCCAGTCTGGTCTCCGCCAT
C2              TTGATAAATCACGGCCAGGAGACATCCGGACCCAGTTTGGTCTCCGCCAT
C3              TTGATAAATCACGGCCAGGAGACATCCGGACCCAGTCTGGTCTCCGCCAT
C4              TTGATAAATCACGGCCAGGAGACATCCGGACCCAGTCTGATCTCCGCCAT
                *************** *.****************** **.**********

C1              TCTGCAAGGATTCGCCTGCGGCACGCTCATATACGTGGTGTTCTTTGAGA
C2              TCTGCAGGGATTCGCCTGTGGCACGCTCATATACGTGGTGTTCTTCGAGA
C3              ACTGCAGGGATTCGCCTGTGGCACGCTCATATACGTGGTGTTCTTCGAGA
C4              TCTGCAGGGATTCGCCTGTGGCACGCTCATATACGTGGTGTTCTTCGAGA
                :*****.*********** ************************** ****

C1              TACTCTCGAAAAATCGATCCGGTCTGCGCGCCTATTTGGCCCTCTTCGTC
C2              TACTCTCGAAAAATCGATCTGGTCTTCGCGCCTATTTGGCCCTCTTCGTG
C3              TACTCTCGAAAAATCGATCTGGTCTGCGTGCCTATTTGGCCCTCTTCGTC
C4              TACTCTCGAAAAATCGATCCGGTCTGCGCGCCTATTTGGCCCTATTTGTC
                ******************* ***** ** **************.** ** 

C1              GGCTTCCTTGTCATGTTTGGCCTGCAGCAGTTGACTTCCATTGGCGGACA
C2              GGCTTCCTTGTCATGTTTGGCCTGCAGCAGCTGACTTCC---GGCGGACA
C3              GGCTTCCTTGTCATGTTTGGCCTGCAGCAGTTGACTTCC---GGCGGACA
C4              GGCTTCCTTTTGATGTTTGGCCTGCAGCAGTTGACTTCCAGTGGTGGACA
                ********* * ****************** ********   ** *****

C1              TGGTCATAGCCACAGCCACAGCAGTTGCTCCACGTCG---GAACACACAC
C2              TAGCCATAGCCACAGCCACAGCAGTTGCTCCTCGTCGGACACACACACAC
C3              TAGTCATAGCCACAGCCACAGCAGTTGCTCCTCGTCGGACACACACACAC
C4              TGGTCATAGCCACAGCCACAGCAGTTGCTCCTCGTCG---------GAAC
                *.* ***************************:*****         ..**

C1              ACAACCACCAAGAGACTGAGACTGAGACCAGGTCAGCATCGGGCCACACC
C2              ACAACCACCAAGAGACTGAGACTGAGACCAAGTCGGCATCGGGCCACACC
C3              ACAACCACCAAGAGACTGAGACTGAGACCAGGTCGGCATCGGGCCACACC
C4              ACAATCACCAAGAGATTGAGACTGAGACCAGGTCGGCATCGGGCCACACC
                **** ********** **************.***.***************

C1              CATGGCCACCAGCACGACCATGATCATCCACATCACCACAACCACGCTGA
C2              CATGGCCACGAGCACGACCATGATCATCCACACCACCACAACCACGCTGA
C3              CATGGCCACGAGCACGACCATGATCATCCACACCACCACAACCACGCTGA
C4              CATGGCCACGAGCATGACCATGATCATCCACACCACCACAACCACGCTGA
                ********* **** ***************** *****************

C1              GGAGCTGGCCACGGTTCACAACTATGAACAGCAGCTGCAGCTCTTGCGGC
C2              GGAGCTGGCCACGGTTCACAACTATGAACAGCAGCTGCAGCTCCTGCGGC
C3              GGAGCTGGCCACGGTTCACAACTATGAACAGCAGCTGCAGCTCTTGCGGC
C4              GGAGCTGGCCACAGTTCACAACTATGAACAGCAGCTGCAGCTCCTGCGGC
                ************.****************************** ******

C1              AGGTGACCCAAAAACTGCTTGAAGCCCACCCCAAGAAGGACGCC------
C2              AGGTGACCCAAAAACTGCTTGAAGCACACCCCAAGAAGGACGCC------
C3              AGGTGACCCAAAAACTGCTTGAAGCACACCCCAAGAAGGACGCC------
C4              AGGTGACCCAAAAACTGCTTGAAGGACACCCGAAGAAGGACGCC------
                ************************ .***** ************      



>C1
ATGAATCAAACGCAAGTAAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
TGAGCCGTCCAACCGTTGGACATCACGTCACGACGGGGAGGATCTCGATG
ATAAC------GACCATGATCATGATCATGACGACGACAACGACGACGAC
GAGAGTGGCGTTCTGGTTGCCAAGGTCACAGCCATGGTGGTGCTATTTTG
CGCCAGCGCGATCTGCGGGTCCATTCCCTTCTTGCTTAACCGTTGCTATC
GCTGGACGGAAAACCAGACGAACGCACGATCCGCCATTGTGGTCAAATGC
CTGCTGTACTTTGGAGGCGGCGTCCTGCTAGCCACCACCTTTCTCCATCT
CTTGCCCGAAGTTCAGGAGGTCGTCGAAGAGCTGCAGGAGTGCGGCATCA
TCGGAGAGCTCACTTTTCCGCTGGCCGAGCTTCTCATGTGCTGTGGCTTC
TTCCTCATGTACTTCATCGAGGAGGCCATGCACACGTATGTCCATCATCA
TCAGAAGGATGAGGCTGGCGCCGCTTTCGAGCGGGGTCACAGCATCCGAA
ACAGCCACCTGCTGAAACCCACCGAAGGCAACGCTACCACACCCACAGCC
CCACCGGCGCCATTGGCTGGCACCGCTGAACTTGGAACACTATCGGTGCA
GAATCTCCTGCAAAACGATCTGGAGCAGCAAAAGTTTGCTACCAAGCCAC
AGCAACAAGCTAATGGACACGGACACAGCCACGGGCATGGACATGGACAT
AGCCATCTACCAGTAATCGCAGACGATGCCGATGCGGGGGACATGTTGGC
TTCATCTCTGCGCGGACTCTTCATCGTTTCCGCTCTGTCGCTGCACGAAC
TCTTTGAGGGCATGGCCATTGGCCTAGAGAGCTCCGCCAGTTCGGTGTGG
TTTATGTTCGGTGCCGTTTCCGCACACAAATTGGTCCTGGCCTTCTGCGT
GGGCGTCGAGCTGATCGTGGCCAGGACCCGGATGTTACTGGCCGTTCTCT
ATGTGTTGACCTTTGCGGTGGTTAGCCCTCTGGGCATCGGAATCGGGATT
TTGATAAATCACGGCGAAGAGACATCCGGACCCAGTCTGGTCTCCGCCAT
TCTGCAAGGATTCGCCTGCGGCACGCTCATATACGTGGTGTTCTTTGAGA
TACTCTCGAAAAATCGATCCGGTCTGCGCGCCTATTTGGCCCTCTTCGTC
GGCTTCCTTGTCATGTTTGGCCTGCAGCAGTTGACTTCCATTGGCGGACA
TGGTCATAGCCACAGCCACAGCAGTTGCTCCACGTCG---GAACACACAC
ACAACCACCAAGAGACTGAGACTGAGACCAGGTCAGCATCGGGCCACACC
CATGGCCACCAGCACGACCATGATCATCCACATCACCACAACCACGCTGA
GGAGCTGGCCACGGTTCACAACTATGAACAGCAGCTGCAGCTCTTGCGGC
AGGTGACCCAAAAACTGCTTGAAGCCCACCCCAAGAAGGACGCC------
>C2
ATGAATCAAACGCAAGTGAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
TGAGCCGTCCAACCGTTGGACATCACGTCACGACGGGGAGGATCACGATC
ATAAC------GACCATGATCATAATCATGATCATGAC---GAGGACGAC
GAGAGTGGCGTTCTGGTTGCCAAGGTCACAGCCATGGTGGTGCTATTTTG
CGCCAGCGCTATCTGCGGATCCCTTCCCTTCTTGCTCAACCGTTGCTATC
GCTGGACGGAAAACCAGACGAATGCACGATCCGCCATTGTGGTCAAGTGC
CTGCTGTACTTTGGAGGCGGCGTCCTTCTGGCCACCACCTTTCTCCATCT
CTTGCCCGAAGTTCAGGAGGTCGTCGAAGAGCTGCAGGAGTGCGAGATCA
TCGGGGAGCTCACTTTTCCGCTGGCCGAGCTGCTCATGTGCTGTGGCTTC
TTCCTCATGTACTTCATCGAGGAGGCCATGCACACGTATGTCCATCATCA
TCAGAAGGATGAGGCTGGCGCCGCCTTCGAACGGGGTCACAGCATCCGAA
ACAGCCACCTGCTGAAACCCACCGAAGGCAATGCTACCACACCCACTGCC
CCGCCGGCGCCTTTGGCTGGCACCGCTGAACTTGGAACACTATCGGTGCA
GAATCTCCTGCAGAACGATCTGGAGCAGCAAAAGTTTGCTACCAAGCCAC
AGCAACAAGCTAATGGACACGGACACAGCCATGGGCATGGACATGGACAT
AGCCATCTACCAGTAATCGCAGACGATGCCGATGCGGGGGACATGTTGGC
TTCATCTCTGCGAGGACTCTTCATCGTTTCCGCTCTGTCGCTGCACGAAC
TCTTTGAGGGCATGGCCATTGGCCTGGAGGGTTCCGCCAGTTCGGTGTGG
TTTATGTTCGGCGCCGTTTCCGCACACAAATTGGTCCTGGCCTTCTGCGT
GGGCGTCGAGCTGATCGTGGCCAGGACCCGGATGTTACTGGCCGTTCTCT
ATGTGCTGACCTTTGCGGTGGTTAGCCCGCTGGGCATCGGAATCGGGATT
TTGATAAATCACGGCCAGGAGACATCCGGACCCAGTTTGGTCTCCGCCAT
TCTGCAGGGATTCGCCTGTGGCACGCTCATATACGTGGTGTTCTTCGAGA
TACTCTCGAAAAATCGATCTGGTCTTCGCGCCTATTTGGCCCTCTTCGTG
GGCTTCCTTGTCATGTTTGGCCTGCAGCAGCTGACTTCC---GGCGGACA
TAGCCATAGCCACAGCCACAGCAGTTGCTCCTCGTCGGACACACACACAC
ACAACCACCAAGAGACTGAGACTGAGACCAAGTCGGCATCGGGCCACACC
CATGGCCACGAGCACGACCATGATCATCCACACCACCACAACCACGCTGA
GGAGCTGGCCACGGTTCACAACTATGAACAGCAGCTGCAGCTCCTGCGGC
AGGTGACCCAAAAACTGCTTGAAGCACACCCCAAGAAGGACGCC------
>C3
ATGAATCAAACGCAAGTGAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
TGAGCCGTCCAACCGTTGGACATCACGTCACGACGGGGAGGATCACGATG
ATAACGACCATGATCATGATCATGATCATGATCATGAC---GAGGACGAC
GAGAGTGGCGTTCTGGTTGCCAAGGTCACAGCCATGGTGGTGCTATTTTG
CGCCAGCGCGATCTGCGGATCCATTCCCTTCTTGCTCAACCGTTGCTATC
GCTGGACGGAAAACCAAACGAATGCACGATCCGCCATTGTGGTCAAGTGC
CTGCTGTACTTTGGAGGAGGCGTCCTACTGGCCACCACCTTTCTCCATCT
CTTGCCCGAAGTTCAGGAGGTCGTCGAAGAGCTGCAGGAGTGCGAGATCA
TCGGGGAGCTCACTTTTCCGCTGGCCGAGCTGCTCATGTGCTGTGGCTTC
TTCCTCATGTACTTCATCGAGGAGGCCATGCACACATATGTCCATCATCA
TCAGAAGGATGAGGCTGGCGCCGCCTTCGAGCGGGGTCACAGCATCCGAA
ACAGCCACCTGCTGAAACCCACCGAAGGCAACGCTACCACACCCACTGCC
CCACCGGCGCCTTTGGCTGGCACCGCTGAACTTGGAACACTGTCGGTGCA
GAATCTCCTGCAGAACGATCTGGAGCAGCAAAAGTTTGCTACCAAGCCAC
AGCAACAAGCTAATGGACACGGACACAGCCACGGGCATGGACATGGGCAT
AGCCACCTACCAGTAATCGCAGACGATGCCGATGCGGGGGACATGTTGGC
TTCATCTCTGCGAGGACTCTTCATCGTTTCCGCTCTGTCGCTGCACGAAC
TCTTTGAGGGCATGGCCATTGGCCTGGAGGGTTCCGCCAGTTCGGTGTGG
TTTATGTTCGGCGCCGTTTCCGCACACAAATTGGTCCTGGCCTTCTGCGT
GGGCGTCGAGCTGATCGTGGCCAGGACCCGGATGTTACTGGCCGTTCTCT
ATGTGCTGACCTTTGCGGTGGTTAGCCCGCTGGGCATCGGAATCGGGATT
TTGATAAATCACGGCCAGGAGACATCCGGACCCAGTCTGGTCTCCGCCAT
ACTGCAGGGATTCGCCTGTGGCACGCTCATATACGTGGTGTTCTTCGAGA
TACTCTCGAAAAATCGATCTGGTCTGCGTGCCTATTTGGCCCTCTTCGTC
GGCTTCCTTGTCATGTTTGGCCTGCAGCAGTTGACTTCC---GGCGGACA
TAGTCATAGCCACAGCCACAGCAGTTGCTCCTCGTCGGACACACACACAC
ACAACCACCAAGAGACTGAGACTGAGACCAGGTCGGCATCGGGCCACACC
CATGGCCACGAGCACGACCATGATCATCCACACCACCACAACCACGCTGA
GGAGCTGGCCACGGTTCACAACTATGAACAGCAGCTGCAGCTCTTGCGGC
AGGTGACCCAAAAACTGCTTGAAGCACACCCCAAGAAGGACGCC------
>C4
ATGAATCAAACGCAAGTGAATAATTTCCTCAAGTGCTTCCTGCAAATCGA
TGAGCCGTCCAGCCGTTGGACATCACGTCACGACGGGGAGGATAACGATG
ATAACGACCACGATCATGATCATGATCATGATCATGAC---GAAGACGAC
GAGAGTGGCGTTCTGGTTGCGAAGGTCACAGCCATGGTGGTGCTATTCTG
CGCCAGCGCAATCTGCGGATCCATTCCCTTTTTACTCAACCGCTGCTATC
GCTGGACGGAAAACCAGACGAATGCGCGATCCGCCATTGTAGTGAAGTGC
CTGCTGTATTTTGGAGGCGGCGTCCTGCTGGCCACCACCTTTCTCCATCT
CCTGCCCGAAGTTCAGGAAGTCGTGGAGGTGCTGCAGGAGTGCGGCGTCA
TCGGGAAACTCACTTTTCCGCTGGCCGAGCTGCTCATGTGCTGCGGCTTC
TTTCTCATGTACTTCATCGAGGAGGCAATGCACACGTATGTCCATCATCA
TCAGAAGGATGAGGCGGGCGCCGCCTTCGAGCGGGGTCATAGCATCCGGA
ACAGCCACCTGATGAAACCCACCGAAGGCAACAATACCACACCCTCTGCC
CCACCGGCGCCATTGGCTGGCACCGCTGAGCTTGGAACACTCTCGGTGCA
AAATCTCCTACAGAACGATCTGGAGCAGCAAAAGTTTGCCACCAAGCAAC
AGCAACAGGTTAATGGACACGGACACAGCCACGGGCATGGGCATGGACAT
AGCCATCTACCAGTCATTGCAGACGATGCCGCTGCGGGGGACATGCTGGC
TTCATCCCTGCGAGGACTCTTCATTGTTTCCGCTCTTTCGCTGCACGAAC
TCTTTGAGGGCATGGCCATTGGCCTAGAGAGCTCCGCCAGTTCGGTGTGG
TTTATGTTCGGCGCCGTTTCCGCGCACAAATTGGTCCTGGCCTTCTGCGT
GGGCGTCGAGCTGATCGTGGCCAGGACTCGGATGTTACTGGCCGTTATCT
ATGTGGTGACCTTCGCCGTGGTTAGCCCGCTTGGCATCGGCATCGGGATT
TTGATAAATCACGGCCAGGAGACATCCGGACCCAGTCTGATCTCCGCCAT
TCTGCAGGGATTCGCCTGTGGCACGCTCATATACGTGGTGTTCTTCGAGA
TACTCTCGAAAAATCGATCCGGTCTGCGCGCCTATTTGGCCCTATTTGTC
GGCTTCCTTTTGATGTTTGGCCTGCAGCAGTTGACTTCCAGTGGTGGACA
TGGTCATAGCCACAGCCACAGCAGTTGCTCCTCGTCG---------GAAC
ACAATCACCAAGAGATTGAGACTGAGACCAGGTCGGCATCGGGCCACACC
CATGGCCACGAGCATGACCATGATCATCCACACCACCACAACCACGCTGA
GGAGCTGGCCACAGTTCACAACTATGAACAGCAGCTGCAGCTCCTGCGGC
AGGTGACCCAAAAACTGCTTGAAGGACACCCGAAGAAGGACGCC------
>C1
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDLDDNooDHDHDHDDDNDDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECGIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGEETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTSIGGHGHSHSHSSCSTSoEHTHNHQETETETRSASGHT
HGHQHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA
>C2
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDHNooDHDHNHDHDoEDD
ESGVLVAKVTAMVVLFCASAICGSLPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTSoGGHSHSHSHSSCSSSDTHTHNHQETETETKSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA
>C3
MNQTQVNNFLKCFLQIDEPSNRWTSRHDGEDHDDNDHDHDHDHDHDoEDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEELQECEIIGELTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGH
SHLPVIADDADAGDMLASSLRGLFIVSALSLHELFEGMAIGLEGSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGI
LINHGQETSGPSLVSAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLVMFGLQQLTSoGGHSHSHSHSSCSSSDTHTHNHQETETETRSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEAHPKKDA
>C4
MNQTQVNNFLKCFLQIDEPSSRWTSRHDGEDNDDNDHDHDHDHDHDoEDD
ESGVLVAKVTAMVVLFCASAICGSIPFLLNRCYRWTENQTNARSAIVVKC
LLYFGGGVLLATTFLHLLPEVQEVVEVLQECGVIGKLTFPLAELLMCCGF
FLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLMKPTEGNNTTPSA
PPAPLAGTAELGTLSVQNLLQNDLEQQKFATKQQQQVNGHGHSHGHGHGH
SHLPVIADDAAAGDMLASSLRGLFIVSALSLHELFEGMAIGLESSASSVW
FMFGAVSAHKLVLAFCVGVELIVARTRMLLAVIYVVTFAVVSPLGIGIGI
LINHGQETSGPSLISAILQGFACGTLIYVVFFEILSKNRSGLRAYLALFV
GFLLMFGLQQLTSSGGHGHSHSHSSCSSSoooEHNHQEIETETRSASGHT
HGHEHDHDHPHHHNHAEELATVHNYEQQLQLLRQVTQKLLEGHPKKDA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 1500 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481302301
      Setting output file names to "/opt/ADOPS/443/Zip89B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 353807329
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 2247652104
      Seed = 8103256
      Swapseed = 1481302301
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 30 unique site patterns
      Division 2 has 20 unique site patterns
      Division 3 has 50 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3243.689300 -- -26.620141
         Chain 2 -- -3243.689300 -- -26.620141
         Chain 3 -- -3265.615003 -- -26.620141
         Chain 4 -- -3265.510595 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3265.510595 -- -26.620141
         Chain 2 -- -3243.689300 -- -26.620141
         Chain 3 -- -3243.689300 -- -26.620141
         Chain 4 -- -3265.615003 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3243.689] (-3243.689) (-3265.615) (-3265.511) * [-3265.511] (-3243.689) (-3243.689) (-3265.615) 
        500 -- [-2844.176] (-2852.268) (-2851.152) (-2840.930) * (-2857.113) (-2859.675) (-2858.167) [-2837.472] -- 0:00:00
       1000 -- (-2835.179) (-2841.352) [-2844.646] (-2836.356) * (-2845.968) (-2845.307) (-2841.991) [-2837.963] -- 0:00:00
       1500 -- [-2825.767] (-2837.602) (-2837.913) (-2822.745) * (-2831.604) (-2834.677) (-2838.777) [-2834.575] -- 0:00:00
       2000 -- [-2822.661] (-2832.031) (-2834.605) (-2826.563) * (-2835.783) (-2829.255) (-2830.650) [-2824.311] -- 0:00:00
       2500 -- [-2814.938] (-2832.882) (-2833.270) (-2821.081) * (-2824.390) (-2825.719) (-2825.529) [-2817.304] -- 0:06:39
       3000 -- [-2814.777] (-2818.745) (-2828.897) (-2814.966) * (-2820.595) (-2816.763) (-2819.883) [-2814.612] -- 0:05:32
       3500 -- [-2807.392] (-2817.423) (-2817.593) (-2809.908) * (-2816.858) [-2813.412] (-2818.770) (-2821.550) -- 0:04:44
       4000 -- (-2813.824) (-2812.273) [-2809.871] (-2810.919) * (-2818.019) [-2810.931] (-2814.402) (-2812.912) -- 0:04:09
       4500 -- (-2809.947) [-2813.435] (-2806.948) (-2810.258) * (-2819.064) [-2805.943] (-2810.341) (-2810.571) -- 0:03:41
       5000 -- [-2808.881] (-2811.689) (-2808.574) (-2809.867) * (-2818.049) [-2812.164] (-2811.721) (-2812.020) -- 0:03:19

      Average standard deviation of split frequencies: 0.235702

       5500 -- (-2810.168) [-2807.023] (-2808.525) (-2809.273) * [-2807.666] (-2807.310) (-2808.617) (-2804.805) -- 0:03:00
       6000 -- [-2810.109] (-2819.233) (-2809.691) (-2804.257) * [-2809.313] (-2812.743) (-2816.109) (-2804.589) -- 0:02:45
       6500 -- [-2808.862] (-2813.472) (-2815.333) (-2810.092) * (-2807.019) (-2811.183) (-2817.332) [-2809.208] -- 0:02:32
       7000 -- [-2807.260] (-2815.052) (-2811.623) (-2811.105) * (-2805.910) (-2814.962) (-2814.753) [-2813.337] -- 0:02:21
       7500 -- (-2808.347) [-2810.266] (-2809.654) (-2812.413) * (-2809.307) (-2812.785) (-2812.062) [-2817.118] -- 0:02:12
       8000 -- (-2814.368) (-2816.059) (-2817.199) [-2807.193] * (-2808.446) (-2808.957) (-2809.222) [-2808.922] -- 0:02:04
       8500 -- [-2816.001] (-2810.435) (-2816.317) (-2809.261) * [-2807.788] (-2808.213) (-2807.794) (-2809.401) -- 0:03:53
       9000 -- [-2809.694] (-2813.136) (-2819.670) (-2809.986) * (-2806.991) (-2809.060) (-2816.272) [-2808.692] -- 0:03:40
       9500 -- (-2812.849) (-2807.242) (-2810.439) [-2808.386] * (-2807.635) (-2812.054) (-2813.772) [-2805.194] -- 0:03:28
      10000 -- (-2809.734) (-2807.667) [-2809.747] (-2807.613) * [-2808.447] (-2813.784) (-2810.887) (-2813.088) -- 0:03:18

      Average standard deviation of split frequencies: 0.147314

      10500 -- [-2811.860] (-2807.128) (-2807.839) (-2808.500) * (-2809.500) [-2814.844] (-2809.082) (-2804.008) -- 0:03:08
      11000 -- (-2811.378) [-2806.883] (-2806.014) (-2808.604) * (-2810.910) (-2811.341) [-2808.568] (-2808.220) -- 0:02:59
      11500 -- (-2810.306) [-2807.341] (-2810.387) (-2819.529) * (-2808.759) (-2808.188) (-2808.451) [-2807.554] -- 0:02:51
      12000 -- (-2807.044) (-2804.586) (-2814.402) [-2817.924] * [-2810.915] (-2804.867) (-2809.857) (-2814.130) -- 0:02:44
      12500 -- (-2809.785) (-2806.031) [-2810.248] (-2818.289) * [-2811.030] (-2804.923) (-2809.005) (-2814.602) -- 0:02:38
      13000 -- [-2812.369] (-2809.183) (-2809.787) (-2816.610) * (-2816.530) [-2809.492] (-2807.459) (-2808.590) -- 0:02:31
      13500 -- (-2808.840) [-2808.416] (-2809.134) (-2818.180) * (-2813.380) [-2810.101] (-2811.008) (-2812.932) -- 0:02:26
      14000 -- (-2811.174) [-2811.649] (-2813.461) (-2817.863) * [-2812.454] (-2810.258) (-2809.547) (-2810.161) -- 0:02:20
      14500 -- (-2812.069) (-2815.280) (-2808.310) [-2814.016] * (-2812.378) (-2812.701) (-2811.969) [-2808.358] -- 0:03:23
      15000 -- [-2808.951] (-2818.431) (-2809.879) (-2810.039) * [-2809.865] (-2808.147) (-2813.405) (-2816.611) -- 0:03:17

      Average standard deviation of split frequencies: 0.098209

      15500 -- (-2822.749) (-2813.522) [-2806.777] (-2806.805) * (-2805.382) [-2817.448] (-2810.624) (-2810.008) -- 0:03:10
      16000 -- (-2805.587) [-2809.974] (-2813.436) (-2816.308) * (-2808.605) (-2807.010) (-2808.353) [-2808.274] -- 0:03:04
      16500 -- (-2809.584) (-2809.615) [-2810.162] (-2813.449) * [-2805.342] (-2815.359) (-2810.922) (-2809.286) -- 0:02:58
      17000 -- [-2808.464] (-2810.888) (-2806.518) (-2809.115) * (-2806.162) (-2816.062) (-2812.675) [-2809.023] -- 0:02:53
      17500 -- (-2805.444) (-2807.511) (-2812.401) [-2808.405] * [-2809.848] (-2812.378) (-2804.246) (-2806.212) -- 0:02:48
      18000 -- (-2805.958) [-2817.169] (-2806.064) (-2810.033) * (-2808.716) (-2812.433) [-2804.449] (-2812.408) -- 0:02:43
      18500 -- (-2809.379) [-2809.847] (-2808.323) (-2813.802) * (-2812.629) (-2814.321) (-2810.590) [-2811.940] -- 0:02:39
      19000 -- (-2806.407) (-2810.243) [-2802.761] (-2812.756) * (-2806.534) [-2814.645] (-2810.938) (-2815.288) -- 0:02:34
      19500 -- [-2812.040] (-2803.895) (-2807.365) (-2809.266) * (-2803.900) (-2811.529) [-2807.555] (-2815.773) -- 0:02:30
      20000 -- (-2816.422) (-2808.767) (-2807.466) [-2807.834] * [-2808.290] (-2809.236) (-2811.845) (-2820.309) -- 0:02:27

      Average standard deviation of split frequencies: 0.060826

      20500 -- [-2813.480] (-2808.842) (-2816.845) (-2815.016) * (-2805.971) (-2815.843) [-2815.972] (-2810.885) -- 0:03:11
      21000 -- (-2814.515) (-2812.475) [-2805.967] (-2812.270) * (-2811.182) [-2813.071] (-2810.302) (-2808.121) -- 0:03:06
      21500 -- (-2812.983) (-2813.365) (-2814.249) [-2808.854] * (-2812.569) [-2807.329] (-2807.019) (-2810.048) -- 0:03:02
      22000 -- (-2806.585) [-2811.454] (-2817.248) (-2812.434) * (-2807.133) [-2808.954] (-2807.827) (-2806.446) -- 0:02:57
      22500 -- (-2811.235) [-2816.144] (-2807.473) (-2811.887) * (-2809.333) (-2814.765) [-2815.147] (-2809.862) -- 0:02:53
      23000 -- (-2808.071) (-2812.286) [-2808.033] (-2810.904) * (-2808.990) (-2806.206) [-2812.190] (-2815.795) -- 0:02:49
      23500 -- (-2813.274) (-2816.250) (-2810.799) [-2807.032] * (-2809.288) (-2804.864) (-2817.554) [-2811.291] -- 0:02:46
      24000 -- (-2815.760) (-2813.440) (-2811.746) [-2808.686] * (-2811.083) (-2807.064) (-2808.674) [-2805.124] -- 0:02:42
      24500 -- (-2809.839) (-2811.815) [-2807.608] (-2816.493) * [-2813.408] (-2812.900) (-2811.983) (-2807.181) -- 0:02:39
      25000 -- (-2811.192) (-2810.687) [-2807.524] (-2812.251) * (-2809.246) [-2807.767] (-2809.174) (-2806.562) -- 0:02:36

      Average standard deviation of split frequencies: 0.048349

      25500 -- [-2806.715] (-2807.228) (-2810.835) (-2819.383) * (-2808.676) (-2809.944) [-2806.335] (-2803.986) -- 0:02:32
      26000 -- (-2812.278) (-2807.282) [-2812.034] (-2816.476) * (-2804.917) (-2811.417) (-2806.031) [-2804.852] -- 0:02:29
      26500 -- [-2810.291] (-2810.336) (-2814.908) (-2812.994) * (-2818.891) (-2819.210) (-2808.590) [-2807.551] -- 0:03:03
      27000 -- (-2804.618) [-2806.653] (-2810.397) (-2812.336) * (-2809.650) (-2814.612) (-2808.133) [-2808.353] -- 0:03:00
      27500 -- [-2809.666] (-2808.538) (-2813.945) (-2805.976) * [-2806.303] (-2819.277) (-2812.944) (-2813.078) -- 0:02:56
      28000 -- (-2806.683) (-2810.480) [-2806.449] (-2809.278) * (-2808.586) (-2809.485) [-2806.774] (-2813.755) -- 0:02:53
      28500 -- (-2815.632) [-2804.793] (-2813.804) (-2807.548) * (-2810.028) (-2806.818) (-2808.563) [-2810.020] -- 0:02:50
      29000 -- (-2808.360) (-2807.990) (-2807.980) [-2808.393] * (-2811.447) (-2806.035) (-2803.703) [-2809.839] -- 0:02:47
      29500 -- (-2811.268) [-2805.573] (-2806.372) (-2819.640) * (-2809.731) (-2812.831) (-2808.946) [-2814.370] -- 0:02:44
      30000 -- (-2817.357) (-2807.449) [-2810.423] (-2812.248) * [-2808.116] (-2813.827) (-2813.636) (-2814.935) -- 0:02:41

      Average standard deviation of split frequencies: 0.040992

      30500 -- (-2818.126) [-2814.471] (-2808.245) (-2810.643) * (-2811.037) (-2816.514) (-2807.850) [-2809.832] -- 0:02:38
      31000 -- (-2813.404) [-2806.830] (-2809.154) (-2809.737) * [-2810.247] (-2811.555) (-2807.193) (-2810.203) -- 0:02:36
      31500 -- (-2811.496) [-2807.372] (-2813.430) (-2809.036) * (-2806.020) (-2810.603) (-2808.438) [-2812.474] -- 0:02:33
      32000 -- [-2809.685] (-2806.764) (-2811.344) (-2809.382) * (-2809.022) (-2819.571) (-2808.192) [-2811.660] -- 0:02:31
      32500 -- (-2810.930) (-2824.609) (-2815.490) [-2807.375] * (-2810.959) (-2811.004) (-2807.421) [-2805.349] -- 0:02:58
      33000 -- (-2809.688) (-2815.687) (-2806.357) [-2809.862] * (-2811.449) (-2803.513) (-2812.289) [-2804.879] -- 0:02:55
      33500 -- (-2815.064) (-2822.795) [-2807.440] (-2811.350) * [-2812.235] (-2809.816) (-2807.444) (-2812.981) -- 0:02:53
      34000 -- [-2811.224] (-2812.658) (-2805.375) (-2811.553) * [-2816.570] (-2813.620) (-2807.758) (-2810.006) -- 0:02:50
      34500 -- (-2814.714) [-2813.437] (-2808.060) (-2812.952) * (-2816.465) (-2809.080) [-2812.638] (-2807.668) -- 0:02:47
      35000 -- (-2813.225) (-2811.626) [-2807.284] (-2809.360) * [-2809.927] (-2807.012) (-2817.886) (-2815.143) -- 0:02:45

      Average standard deviation of split frequencies: 0.034919

      35500 -- [-2815.109] (-2808.808) (-2810.602) (-2806.817) * [-2807.206] (-2810.568) (-2805.399) (-2811.052) -- 0:02:43
      36000 -- [-2809.388] (-2816.649) (-2815.276) (-2814.564) * [-2812.269] (-2819.013) (-2804.100) (-2805.031) -- 0:02:40
      36500 -- [-2808.618] (-2810.170) (-2819.121) (-2809.424) * [-2813.542] (-2807.973) (-2810.021) (-2809.975) -- 0:02:38
      37000 -- [-2808.593] (-2807.935) (-2814.754) (-2808.535) * [-2805.330] (-2806.988) (-2809.698) (-2808.714) -- 0:02:36
      37500 -- [-2813.733] (-2807.421) (-2812.968) (-2815.539) * (-2810.886) [-2811.741] (-2815.506) (-2812.767) -- 0:02:34
      38000 -- (-2810.781) [-2807.945] (-2809.083) (-2807.033) * (-2806.891) [-2809.021] (-2810.990) (-2810.585) -- 0:02:31
      38500 -- (-2817.627) [-2808.461] (-2816.952) (-2810.628) * [-2812.076] (-2819.446) (-2815.175) (-2813.203) -- 0:02:54
      39000 -- (-2816.774) (-2813.810) (-2813.262) [-2808.785] * (-2807.888) (-2812.209) [-2811.089] (-2807.068) -- 0:02:52
      39500 -- [-2811.555] (-2814.530) (-2811.326) (-2815.727) * (-2813.631) (-2808.450) (-2809.144) [-2810.595] -- 0:02:50
      40000 -- [-2813.259] (-2807.441) (-2812.524) (-2808.201) * [-2807.518] (-2811.151) (-2809.469) (-2807.403) -- 0:02:48

      Average standard deviation of split frequencies: 0.054096

      40500 -- [-2805.994] (-2808.424) (-2805.348) (-2816.411) * (-2808.444) (-2806.922) (-2814.645) [-2807.037] -- 0:02:45
      41000 -- (-2816.242) (-2809.770) (-2807.798) [-2808.912] * [-2804.621] (-2810.002) (-2812.436) (-2813.184) -- 0:02:43
      41500 -- (-2811.808) (-2809.306) (-2814.619) [-2809.332] * (-2810.339) (-2806.443) [-2814.778] (-2811.726) -- 0:02:41
      42000 -- (-2811.584) (-2808.162) (-2813.556) [-2810.857] * (-2805.690) [-2812.063] (-2822.720) (-2808.589) -- 0:02:39
      42500 -- (-2815.134) (-2808.339) (-2810.430) [-2807.078] * (-2816.290) [-2809.802] (-2810.415) (-2809.741) -- 0:02:37
      43000 -- (-2816.888) (-2812.529) (-2813.090) [-2814.429] * [-2812.234] (-2814.184) (-2813.148) (-2816.551) -- 0:02:35
      43500 -- (-2820.479) [-2808.139] (-2805.559) (-2818.658) * [-2807.301] (-2811.113) (-2809.328) (-2812.596) -- 0:02:33
      44000 -- [-2811.088] (-2810.349) (-2808.833) (-2813.105) * [-2815.693] (-2807.531) (-2815.271) (-2812.198) -- 0:02:53
      44500 -- (-2813.924) (-2804.091) (-2809.412) [-2809.175] * (-2810.297) (-2815.943) [-2811.044] (-2811.651) -- 0:02:51
      45000 -- [-2807.354] (-2808.006) (-2813.213) (-2817.317) * [-2809.389] (-2813.864) (-2810.714) (-2818.784) -- 0:02:49

      Average standard deviation of split frequencies: 0.061488

      45500 -- (-2808.648) [-2809.118] (-2808.172) (-2811.763) * (-2807.540) [-2806.258] (-2808.259) (-2809.292) -- 0:02:47
      46000 -- [-2812.231] (-2806.850) (-2813.240) (-2810.831) * (-2806.770) (-2816.185) (-2807.978) [-2812.512] -- 0:02:45
      46500 -- (-2811.914) [-2807.837] (-2808.013) (-2810.136) * (-2813.141) (-2815.598) (-2806.216) [-2809.027] -- 0:02:44
      47000 -- [-2813.007] (-2808.481) (-2815.444) (-2816.752) * [-2806.503] (-2807.595) (-2811.288) (-2805.112) -- 0:02:42
      47500 -- (-2811.267) [-2809.327] (-2812.979) (-2810.371) * [-2811.343] (-2809.923) (-2813.864) (-2809.029) -- 0:02:40
      48000 -- [-2811.752] (-2811.003) (-2814.640) (-2808.707) * [-2807.271] (-2812.692) (-2822.092) (-2808.477) -- 0:02:38
      48500 -- [-2807.398] (-2805.980) (-2813.607) (-2819.190) * (-2813.957) (-2810.498) (-2813.596) [-2811.867] -- 0:02:36
      49000 -- (-2811.894) (-2810.140) (-2805.686) [-2806.337] * (-2808.878) (-2810.493) [-2814.319] (-2810.646) -- 0:02:35
      49500 -- [-2812.953] (-2806.697) (-2805.918) (-2809.305) * [-2811.035] (-2812.087) (-2819.969) (-2808.694) -- 0:02:33
      50000 -- (-2810.489) (-2812.873) (-2812.564) [-2809.301] * (-2810.338) [-2809.565] (-2819.969) (-2813.446) -- 0:02:32

      Average standard deviation of split frequencies: 0.049622

      50500 -- [-2809.274] (-2815.656) (-2811.374) (-2808.709) * (-2809.817) (-2808.934) (-2809.867) [-2804.788] -- 0:02:49
      51000 -- [-2813.591] (-2805.883) (-2810.159) (-2811.539) * (-2820.298) (-2806.626) (-2807.954) [-2808.953] -- 0:02:47
      51500 -- (-2810.855) [-2806.977] (-2807.491) (-2818.045) * (-2817.597) [-2808.603] (-2807.733) (-2806.897) -- 0:02:45
      52000 -- (-2817.509) (-2808.735) [-2808.646] (-2813.610) * (-2810.348) [-2810.399] (-2810.626) (-2811.889) -- 0:02:44
      52500 -- [-2809.026] (-2810.794) (-2810.172) (-2805.398) * [-2808.251] (-2815.940) (-2810.888) (-2813.564) -- 0:02:42
      53000 -- (-2810.609) [-2807.465] (-2812.441) (-2808.479) * (-2805.432) (-2805.623) [-2808.647] (-2812.377) -- 0:02:40
      53500 -- (-2804.223) [-2809.981] (-2812.914) (-2808.893) * (-2807.692) [-2811.422] (-2810.178) (-2811.257) -- 0:02:39
      54000 -- (-2812.999) [-2810.358] (-2813.480) (-2807.823) * (-2802.246) [-2811.069] (-2813.275) (-2812.293) -- 0:02:37
      54500 -- (-2810.759) (-2810.581) [-2809.913] (-2810.590) * (-2808.397) (-2816.045) [-2806.047] (-2807.451) -- 0:02:36
      55000 -- (-2812.251) (-2805.004) [-2810.029] (-2813.244) * (-2806.159) (-2811.346) [-2804.393] (-2807.023) -- 0:02:34

      Average standard deviation of split frequencies: 0.072955

      55500 -- (-2809.465) (-2812.810) (-2810.180) [-2809.667] * (-2811.494) (-2814.532) (-2812.947) [-2805.889] -- 0:02:33
      56000 -- [-2809.881] (-2808.958) (-2808.686) (-2811.099) * (-2810.777) [-2813.646] (-2809.981) (-2809.083) -- 0:02:48
      56500 -- (-2809.649) [-2812.261] (-2804.909) (-2811.538) * [-2806.399] (-2806.641) (-2808.921) (-2809.997) -- 0:02:46
      57000 -- (-2811.643) [-2807.212] (-2807.842) (-2811.702) * [-2806.374] (-2809.966) (-2815.727) (-2809.674) -- 0:02:45
      57500 -- (-2811.982) (-2810.930) (-2807.096) [-2809.965] * [-2808.789] (-2814.487) (-2811.382) (-2807.007) -- 0:02:43
      58000 -- (-2807.293) (-2814.676) (-2817.487) [-2807.928] * [-2810.139] (-2810.079) (-2811.812) (-2808.125) -- 0:02:42
      58500 -- (-2807.195) [-2814.674] (-2809.795) (-2805.735) * (-2809.880) (-2810.482) (-2815.100) [-2806.637] -- 0:02:40
      59000 -- (-2809.485) (-2812.048) [-2808.559] (-2807.464) * (-2805.764) [-2809.856] (-2813.570) (-2808.482) -- 0:02:39
      59500 -- [-2808.080] (-2809.892) (-2807.332) (-2812.661) * (-2809.368) [-2810.134] (-2814.066) (-2810.719) -- 0:02:38
      60000 -- (-2808.851) (-2808.909) [-2809.554] (-2806.203) * [-2807.980] (-2813.471) (-2808.769) (-2816.475) -- 0:02:36

      Average standard deviation of split frequencies: 0.082884

      60500 -- (-2810.683) [-2806.169] (-2814.274) (-2805.793) * [-2811.007] (-2817.908) (-2806.201) (-2811.513) -- 0:02:35
      61000 -- (-2817.117) [-2812.537] (-2817.032) (-2812.628) * (-2808.315) [-2807.420] (-2816.282) (-2810.494) -- 0:02:33
      61500 -- (-2809.951) [-2813.462] (-2814.420) (-2807.102) * (-2809.561) (-2810.385) [-2808.638] (-2816.136) -- 0:02:32
      62000 -- (-2808.289) (-2811.889) (-2823.213) [-2807.386] * (-2809.555) [-2813.342] (-2810.370) (-2811.782) -- 0:02:46
      62500 -- [-2809.256] (-2808.641) (-2813.778) (-2817.819) * (-2813.710) [-2806.251] (-2812.919) (-2820.041) -- 0:02:45
      63000 -- (-2808.395) [-2815.182] (-2812.399) (-2810.449) * [-2811.629] (-2807.925) (-2812.170) (-2807.516) -- 0:02:43
      63500 -- [-2808.469] (-2817.040) (-2816.251) (-2810.001) * (-2809.135) [-2808.143] (-2817.841) (-2810.058) -- 0:02:42
      64000 -- (-2813.115) (-2817.603) (-2823.203) [-2811.188] * (-2810.367) [-2809.831] (-2813.628) (-2809.600) -- 0:02:40
      64500 -- (-2812.916) (-2812.337) (-2813.471) [-2804.611] * (-2810.278) (-2811.708) [-2809.053] (-2806.410) -- 0:02:39
      65000 -- [-2809.474] (-2814.646) (-2815.496) (-2807.765) * (-2811.857) (-2811.539) [-2811.676] (-2806.108) -- 0:02:38

      Average standard deviation of split frequencies: 0.071425

      65500 -- [-2814.391] (-2813.484) (-2815.346) (-2810.558) * (-2807.600) [-2811.880] (-2807.354) (-2811.795) -- 0:02:36
      66000 -- (-2809.101) (-2815.349) (-2808.703) [-2811.327] * (-2808.856) [-2806.459] (-2816.835) (-2816.376) -- 0:02:35
      66500 -- [-2811.558] (-2808.098) (-2807.452) (-2812.383) * (-2805.930) (-2809.522) (-2807.844) [-2810.164] -- 0:02:34
      67000 -- [-2809.788] (-2807.736) (-2813.833) (-2814.029) * [-2812.651] (-2812.434) (-2808.502) (-2811.848) -- 0:02:33
      67500 -- (-2811.325) (-2804.881) (-2815.218) [-2814.505] * (-2810.539) (-2816.665) [-2808.267] (-2810.605) -- 0:02:31
      68000 -- (-2805.165) [-2817.526] (-2811.719) (-2813.325) * (-2809.749) [-2811.894] (-2809.249) (-2814.250) -- 0:02:44
      68500 -- (-2809.834) [-2809.253] (-2813.667) (-2812.848) * (-2806.277) (-2812.302) [-2806.060] (-2815.441) -- 0:02:43
      69000 -- (-2813.470) (-2812.932) (-2805.734) [-2806.510] * (-2809.657) [-2805.922] (-2808.740) (-2810.921) -- 0:02:41
      69500 -- (-2815.392) (-2811.607) [-2807.988] (-2809.887) * (-2806.170) [-2805.729] (-2806.475) (-2808.186) -- 0:02:40
      70000 -- (-2811.491) [-2814.392] (-2805.701) (-2808.198) * (-2812.329) (-2803.882) (-2812.394) [-2808.161] -- 0:02:39

      Average standard deviation of split frequencies: 0.057814

      70500 -- (-2812.493) (-2807.945) [-2809.062] (-2807.604) * (-2807.400) (-2807.813) (-2813.770) [-2807.385] -- 0:02:38
      71000 -- (-2814.909) (-2809.629) (-2809.432) [-2807.736] * [-2808.731] (-2803.192) (-2811.951) (-2812.926) -- 0:02:37
      71500 -- (-2808.521) (-2812.956) (-2814.213) [-2804.931] * (-2813.318) [-2805.223] (-2812.963) (-2810.274) -- 0:02:35
      72000 -- (-2811.405) (-2813.581) (-2808.209) [-2809.808] * (-2806.344) [-2807.588] (-2814.243) (-2811.983) -- 0:02:34
      72500 -- [-2812.519] (-2814.180) (-2815.420) (-2808.313) * (-2809.022) (-2809.071) (-2811.190) [-2808.503] -- 0:02:33
      73000 -- (-2808.080) [-2812.031] (-2810.303) (-2808.640) * (-2806.503) (-2817.221) [-2810.141] (-2815.101) -- 0:02:32
      73500 -- (-2809.342) (-2811.588) (-2812.117) [-2818.129] * (-2805.335) (-2811.491) (-2806.581) [-2810.142] -- 0:02:31
      74000 -- (-2813.113) (-2812.032) [-2810.057] (-2811.662) * [-2813.047] (-2806.995) (-2812.705) (-2808.538) -- 0:02:30
      74500 -- (-2810.525) (-2809.724) (-2809.809) [-2808.912] * (-2810.309) [-2810.359] (-2812.577) (-2810.742) -- 0:02:41
      75000 -- (-2811.426) (-2812.144) [-2808.549] (-2806.819) * (-2809.685) [-2808.819] (-2808.692) (-2805.807) -- 0:02:40

      Average standard deviation of split frequencies: 0.062027

      75500 -- (-2807.551) (-2807.601) (-2807.077) [-2805.564] * (-2810.952) [-2809.477] (-2818.227) (-2814.210) -- 0:02:39
      76000 -- (-2808.887) (-2810.576) [-2804.830] (-2810.756) * (-2807.997) (-2813.778) [-2811.335] (-2818.936) -- 0:02:38
      76500 -- [-2814.336] (-2816.975) (-2809.338) (-2810.133) * (-2811.431) [-2811.932] (-2811.498) (-2807.788) -- 0:02:36
      77000 -- [-2805.616] (-2814.939) (-2808.241) (-2813.564) * (-2812.552) (-2811.222) [-2808.496] (-2805.893) -- 0:02:35
      77500 -- (-2807.176) (-2812.062) [-2810.117] (-2806.953) * (-2813.615) (-2807.294) [-2807.816] (-2813.244) -- 0:02:34
      78000 -- (-2808.478) (-2808.929) (-2807.335) [-2804.893] * [-2811.963] (-2807.092) (-2815.734) (-2811.980) -- 0:02:33
      78500 -- (-2811.909) [-2808.890] (-2809.016) (-2810.622) * (-2810.623) (-2812.283) (-2812.687) [-2808.745] -- 0:02:32
      79000 -- (-2817.541) [-2809.728] (-2806.204) (-2813.926) * [-2809.414] (-2807.092) (-2814.333) (-2812.080) -- 0:02:31
      79500 -- (-2806.211) (-2804.938) (-2804.008) [-2812.738] * (-2808.198) (-2818.258) [-2809.470] (-2817.614) -- 0:02:30
      80000 -- [-2808.972] (-2811.838) (-2817.765) (-2806.697) * (-2811.414) (-2813.456) [-2815.833] (-2812.565) -- 0:02:29

      Average standard deviation of split frequencies: 0.062334

      80500 -- [-2812.027] (-2812.659) (-2810.378) (-2810.772) * (-2804.860) (-2809.172) [-2809.719] (-2812.524) -- 0:02:39
      81000 -- (-2811.146) [-2819.264] (-2812.592) (-2806.667) * (-2810.487) (-2810.704) [-2808.515] (-2809.424) -- 0:02:38
      81500 -- (-2816.518) (-2809.614) [-2808.488] (-2809.457) * (-2809.425) (-2810.255) [-2805.241] (-2807.172) -- 0:02:37
      82000 -- (-2818.258) (-2813.746) (-2806.940) [-2810.591] * (-2806.241) (-2811.760) (-2806.741) [-2812.341] -- 0:02:36
      82500 -- [-2810.582] (-2810.044) (-2810.329) (-2810.588) * (-2807.636) (-2808.557) [-2806.214] (-2815.208) -- 0:02:35
      83000 -- (-2812.005) [-2810.406] (-2804.605) (-2814.246) * (-2810.594) (-2810.003) [-2807.900] (-2807.227) -- 0:02:34
      83500 -- (-2806.884) (-2812.020) (-2811.585) [-2806.799] * (-2809.878) (-2807.932) [-2809.129] (-2807.372) -- 0:02:33
      84000 -- [-2807.491] (-2813.108) (-2808.234) (-2808.790) * (-2815.102) [-2805.751] (-2813.982) (-2810.251) -- 0:02:32
      84500 -- (-2813.009) (-2807.524) (-2807.159) [-2810.237] * [-2809.014] (-2807.220) (-2804.076) (-2811.894) -- 0:02:31
      85000 -- [-2806.250] (-2809.010) (-2812.843) (-2806.374) * (-2807.652) (-2812.181) (-2810.701) [-2806.533] -- 0:02:30

      Average standard deviation of split frequencies: 0.065777

      85500 -- (-2808.179) [-2810.586] (-2809.857) (-2807.743) * [-2808.192] (-2814.861) (-2814.317) (-2810.446) -- 0:02:29
      86000 -- [-2811.980] (-2811.326) (-2815.661) (-2815.993) * (-2808.545) (-2814.323) [-2810.517] (-2817.008) -- 0:02:39
      86500 -- (-2810.749) [-2815.055] (-2812.406) (-2813.093) * (-2811.748) (-2808.141) (-2814.409) [-2813.802] -- 0:02:38
      87000 -- (-2809.873) [-2810.749] (-2810.126) (-2813.666) * (-2809.378) (-2815.590) [-2810.875] (-2811.124) -- 0:02:37
      87500 -- (-2812.533) (-2805.823) (-2811.198) [-2809.975] * [-2807.140] (-2811.302) (-2813.151) (-2814.157) -- 0:02:36
      88000 -- (-2807.674) (-2813.815) [-2808.768] (-2810.985) * [-2808.318] (-2807.944) (-2814.634) (-2814.192) -- 0:02:35
      88500 -- (-2811.530) [-2814.081] (-2810.123) (-2811.560) * (-2809.814) [-2807.031] (-2817.141) (-2810.677) -- 0:02:34
      89000 -- (-2814.151) [-2813.523] (-2810.786) (-2814.264) * (-2807.869) (-2808.724) [-2809.439] (-2808.144) -- 0:02:33
      89500 -- (-2810.702) (-2811.860) [-2808.482] (-2805.938) * (-2811.704) (-2809.004) [-2810.636] (-2811.788) -- 0:02:32
      90000 -- (-2806.345) (-2809.843) [-2813.140] (-2809.534) * (-2808.364) [-2805.716] (-2811.954) (-2810.174) -- 0:02:31

      Average standard deviation of split frequencies: 0.069324

      90500 -- (-2806.249) (-2812.667) (-2806.023) [-2814.239] * (-2809.388) (-2806.520) [-2808.014] (-2813.508) -- 0:02:30
      91000 -- [-2808.336] (-2813.047) (-2808.788) (-2816.339) * [-2808.371] (-2808.454) (-2809.614) (-2817.179) -- 0:02:29
      91500 -- [-2810.422] (-2807.882) (-2809.312) (-2814.635) * [-2810.309] (-2819.700) (-2810.073) (-2811.450) -- 0:02:28
      92000 -- [-2812.132] (-2813.390) (-2817.197) (-2806.810) * (-2807.283) (-2817.449) [-2810.950] (-2810.956) -- 0:02:37
      92500 -- [-2808.338] (-2813.639) (-2806.854) (-2811.998) * [-2816.583] (-2809.143) (-2813.536) (-2810.497) -- 0:02:36
      93000 -- [-2805.473] (-2809.280) (-2815.114) (-2816.624) * (-2815.356) [-2810.939] (-2815.651) (-2811.897) -- 0:02:36
      93500 -- (-2811.440) (-2807.982) (-2813.815) [-2810.370] * [-2809.594] (-2811.135) (-2810.329) (-2812.458) -- 0:02:35
      94000 -- (-2812.569) (-2807.598) (-2811.954) [-2805.515] * (-2814.121) (-2816.326) (-2807.948) [-2808.546] -- 0:02:34
      94500 -- (-2808.494) (-2812.967) (-2813.201) [-2813.334] * [-2810.956] (-2809.624) (-2808.283) (-2811.676) -- 0:02:33
      95000 -- (-2809.503) [-2809.176] (-2811.843) (-2813.329) * (-2808.236) [-2813.242] (-2813.656) (-2814.068) -- 0:02:32

      Average standard deviation of split frequencies: 0.065473

      95500 -- (-2809.881) (-2814.766) (-2808.240) [-2804.609] * (-2811.141) (-2815.991) (-2806.089) [-2810.283] -- 0:02:31
      96000 -- [-2811.612] (-2818.285) (-2806.217) (-2807.510) * (-2808.836) (-2810.813) (-2815.415) [-2815.288] -- 0:02:30
      96500 -- [-2808.027] (-2809.739) (-2807.956) (-2807.838) * [-2813.138] (-2808.445) (-2813.005) (-2814.643) -- 0:02:29
      97000 -- (-2810.109) (-2809.148) (-2808.764) [-2814.292] * [-2809.251] (-2821.030) (-2809.700) (-2811.497) -- 0:02:28
      97500 -- (-2812.518) (-2808.762) [-2808.241] (-2811.659) * [-2810.460] (-2811.256) (-2824.727) (-2809.433) -- 0:02:28
      98000 -- (-2810.390) (-2811.481) [-2811.905] (-2820.602) * (-2810.257) (-2808.956) (-2809.921) [-2807.832] -- 0:02:36
      98500 -- (-2811.702) (-2809.949) (-2807.847) [-2809.676] * (-2806.028) (-2817.115) (-2816.906) [-2809.191] -- 0:02:35
      99000 -- (-2817.248) [-2804.461] (-2806.601) (-2810.916) * [-2805.438] (-2813.904) (-2815.357) (-2813.435) -- 0:02:34
      99500 -- (-2817.543) [-2807.804] (-2817.293) (-2811.197) * (-2809.845) (-2811.753) (-2813.252) [-2816.118] -- 0:02:33
      100000 -- [-2808.476] (-2804.791) (-2814.555) (-2807.463) * (-2814.365) [-2809.270] (-2811.612) (-2810.673) -- 0:02:33

      Average standard deviation of split frequencies: 0.049950

      100500 -- (-2814.895) (-2811.382) (-2819.150) [-2805.468] * (-2812.953) [-2806.294] (-2810.367) (-2811.196) -- 0:02:32
      101000 -- [-2809.350] (-2811.320) (-2813.922) (-2808.370) * (-2813.704) (-2812.084) (-2814.147) [-2811.762] -- 0:02:31
      101500 -- (-2809.379) (-2811.885) [-2810.027] (-2806.570) * (-2813.194) (-2813.501) [-2812.459] (-2814.342) -- 0:02:30
      102000 -- (-2815.489) (-2811.605) [-2808.408] (-2810.757) * [-2811.004] (-2814.129) (-2810.517) (-2815.982) -- 0:02:29
      102500 -- (-2813.449) [-2808.269] (-2811.758) (-2808.443) * (-2812.433) (-2812.395) (-2808.418) [-2810.096] -- 0:02:28
      103000 -- (-2812.686) (-2811.480) (-2807.328) [-2807.865] * (-2810.485) [-2813.129] (-2810.312) (-2813.845) -- 0:02:28
      103500 -- (-2807.372) [-2808.304] (-2811.917) (-2808.949) * [-2815.044] (-2810.291) (-2809.831) (-2815.070) -- 0:02:27
      104000 -- (-2812.666) (-2806.854) [-2810.426] (-2807.191) * (-2811.872) [-2812.777] (-2807.134) (-2812.814) -- 0:02:26
      104500 -- (-2808.907) (-2807.268) [-2814.166] (-2807.010) * (-2815.398) [-2805.986] (-2810.248) (-2811.223) -- 0:02:34
      105000 -- [-2812.099] (-2808.371) (-2811.175) (-2806.729) * (-2811.776) (-2806.512) (-2811.101) [-2807.885] -- 0:02:33

      Average standard deviation of split frequencies: 0.047437

      105500 -- (-2815.526) (-2812.008) (-2813.125) [-2814.493] * (-2814.044) (-2817.596) (-2815.939) [-2809.135] -- 0:02:32
      106000 -- (-2817.011) [-2813.013] (-2815.213) (-2821.939) * (-2808.049) (-2812.932) [-2813.566] (-2808.652) -- 0:02:31
      106500 -- [-2811.630] (-2811.146) (-2819.693) (-2816.568) * (-2808.084) (-2817.139) (-2811.291) [-2809.305] -- 0:02:31
      107000 -- (-2809.214) (-2814.075) [-2815.517] (-2821.401) * (-2807.105) [-2813.165] (-2812.877) (-2810.150) -- 0:02:30
      107500 -- [-2810.808] (-2812.400) (-2815.962) (-2809.636) * (-2807.628) (-2812.839) [-2813.610] (-2809.925) -- 0:02:29
      108000 -- (-2814.298) [-2805.839] (-2815.894) (-2812.320) * (-2809.586) (-2810.469) [-2811.154] (-2812.137) -- 0:02:28
      108500 -- (-2810.526) [-2807.838] (-2812.348) (-2807.676) * (-2812.781) (-2811.443) [-2806.524] (-2811.791) -- 0:02:27
      109000 -- (-2810.561) [-2807.667] (-2814.147) (-2808.129) * (-2812.790) [-2810.859] (-2815.093) (-2809.413) -- 0:02:27
      109500 -- (-2816.391) (-2807.981) [-2807.183] (-2807.817) * (-2809.491) (-2807.126) [-2808.342] (-2816.827) -- 0:02:26
      110000 -- (-2822.588) [-2811.906] (-2809.165) (-2808.562) * (-2813.489) [-2811.680] (-2814.915) (-2806.239) -- 0:02:33

      Average standard deviation of split frequencies: 0.048986

      110500 -- (-2810.961) [-2803.030] (-2808.540) (-2808.500) * [-2808.404] (-2810.822) (-2808.653) (-2807.577) -- 0:02:32
      111000 -- (-2808.624) (-2811.590) (-2811.546) [-2811.069] * (-2814.386) (-2813.527) (-2812.182) [-2805.824] -- 0:02:32
      111500 -- [-2808.359] (-2811.112) (-2808.199) (-2813.271) * (-2813.420) [-2809.871] (-2809.395) (-2808.544) -- 0:02:31
      112000 -- (-2808.458) (-2809.404) [-2804.890] (-2812.317) * (-2810.690) (-2811.145) [-2810.363] (-2813.262) -- 0:02:30
      112500 -- (-2806.115) (-2805.053) (-2816.133) [-2806.560] * (-2805.631) (-2809.315) [-2814.324] (-2811.919) -- 0:02:29
      113000 -- (-2814.605) [-2805.825] (-2809.886) (-2804.515) * [-2805.254] (-2810.578) (-2814.947) (-2809.520) -- 0:02:29
      113500 -- (-2819.576) (-2807.583) [-2816.196] (-2809.398) * (-2807.251) (-2804.920) (-2819.043) [-2811.647] -- 0:02:28
      114000 -- (-2808.741) (-2815.276) (-2814.835) [-2807.279] * (-2811.852) (-2813.620) [-2812.200] (-2811.791) -- 0:02:27
      114500 -- (-2809.884) [-2814.895] (-2810.886) (-2810.993) * [-2814.057] (-2806.732) (-2810.142) (-2813.403) -- 0:02:26
      115000 -- (-2817.599) [-2805.143] (-2810.007) (-2812.781) * (-2814.044) [-2809.208] (-2812.592) (-2815.551) -- 0:02:26

      Average standard deviation of split frequencies: 0.032511

      115500 -- (-2808.904) [-2808.653] (-2804.799) (-2819.730) * (-2805.789) [-2809.384] (-2808.861) (-2816.065) -- 0:02:25
      116000 -- [-2807.883] (-2809.053) (-2813.792) (-2805.244) * (-2808.964) (-2810.591) (-2809.872) [-2816.518] -- 0:02:24
      116500 -- (-2810.999) [-2810.260] (-2810.872) (-2811.509) * (-2807.534) (-2812.805) (-2805.699) [-2804.944] -- 0:02:31
      117000 -- [-2816.110] (-2815.927) (-2808.895) (-2810.132) * (-2806.650) (-2812.237) [-2812.745] (-2816.255) -- 0:02:30
      117500 -- (-2814.007) (-2811.477) [-2806.625] (-2809.629) * [-2814.741] (-2811.088) (-2813.517) (-2806.918) -- 0:02:30
      118000 -- (-2808.188) (-2811.679) (-2809.084) [-2813.267] * (-2809.205) (-2807.081) [-2809.413] (-2810.259) -- 0:02:29
      118500 -- [-2807.792] (-2810.767) (-2807.176) (-2813.625) * [-2808.373] (-2809.702) (-2810.246) (-2811.115) -- 0:02:28
      119000 -- (-2814.252) [-2807.553] (-2805.480) (-2806.381) * (-2814.327) (-2815.490) [-2808.401] (-2807.595) -- 0:02:28
      119500 -- [-2811.368] (-2811.844) (-2810.520) (-2812.652) * [-2812.703] (-2811.517) (-2817.081) (-2808.261) -- 0:02:27
      120000 -- (-2811.451) [-2814.086] (-2810.302) (-2815.840) * (-2808.320) (-2812.788) (-2807.525) [-2810.461] -- 0:02:26

      Average standard deviation of split frequencies: 0.029300

      120500 -- (-2811.491) [-2808.405] (-2811.333) (-2813.166) * (-2806.972) [-2809.130] (-2809.763) (-2809.036) -- 0:02:25
      121000 -- (-2807.894) (-2807.064) [-2807.861] (-2807.679) * (-2811.462) [-2808.682] (-2808.550) (-2807.254) -- 0:02:25
      121500 -- [-2813.698] (-2807.481) (-2808.693) (-2809.214) * [-2807.441] (-2812.731) (-2817.851) (-2808.147) -- 0:02:24
      122000 -- (-2809.795) (-2807.273) [-2807.761] (-2815.279) * (-2813.137) (-2814.423) (-2805.390) [-2807.141] -- 0:02:23
      122500 -- (-2804.539) (-2811.330) [-2812.366] (-2812.308) * [-2812.436] (-2813.770) (-2809.972) (-2811.172) -- 0:02:30
      123000 -- (-2809.617) [-2807.318] (-2810.945) (-2812.520) * (-2809.810) (-2814.327) [-2805.515] (-2810.499) -- 0:02:29
      123500 -- (-2809.238) (-2815.656) [-2810.226] (-2810.063) * [-2809.658] (-2812.621) (-2807.173) (-2811.977) -- 0:02:29
      124000 -- (-2810.589) [-2811.087] (-2813.302) (-2806.484) * [-2806.668] (-2811.607) (-2810.211) (-2804.365) -- 0:02:28
      124500 -- (-2813.901) (-2814.577) [-2809.533] (-2812.439) * [-2811.936] (-2806.802) (-2808.952) (-2813.141) -- 0:02:27
      125000 -- (-2811.011) (-2818.120) [-2809.407] (-2811.618) * [-2814.802] (-2806.613) (-2819.038) (-2806.063) -- 0:02:27

      Average standard deviation of split frequencies: 0.028060

      125500 -- (-2805.508) [-2808.796] (-2812.135) (-2813.922) * (-2812.481) [-2812.909] (-2812.497) (-2812.286) -- 0:02:26
      126000 -- [-2816.380] (-2808.928) (-2810.934) (-2812.879) * (-2808.753) (-2809.676) [-2807.757] (-2807.677) -- 0:02:25
      126500 -- (-2805.275) [-2810.959] (-2808.998) (-2809.137) * (-2808.379) (-2810.426) [-2810.132] (-2814.258) -- 0:02:25
      127000 -- (-2807.641) (-2810.150) (-2806.197) [-2818.551] * [-2810.204] (-2812.150) (-2816.254) (-2808.412) -- 0:02:24
      127500 -- (-2807.017) (-2809.165) [-2813.659] (-2806.611) * (-2812.813) [-2807.247] (-2811.502) (-2812.621) -- 0:02:23
      128000 -- [-2807.442] (-2815.225) (-2807.962) (-2815.375) * (-2806.071) [-2814.687] (-2814.508) (-2814.587) -- 0:02:23
      128500 -- [-2805.661] (-2809.697) (-2807.615) (-2810.980) * (-2809.569) [-2807.668] (-2808.531) (-2808.924) -- 0:02:29
      129000 -- (-2814.660) (-2806.364) [-2810.257] (-2807.600) * (-2815.146) [-2811.419] (-2813.637) (-2815.724) -- 0:02:28
      129500 -- (-2808.864) [-2812.970] (-2810.603) (-2813.289) * (-2808.900) (-2809.581) [-2813.844] (-2806.390) -- 0:02:27
      130000 -- (-2808.923) (-2805.789) (-2808.943) [-2808.356] * [-2813.755] (-2812.255) (-2808.836) (-2807.135) -- 0:02:27

      Average standard deviation of split frequencies: 0.021646

      130500 -- [-2806.924] (-2814.065) (-2809.655) (-2809.547) * (-2808.049) (-2807.329) [-2813.291] (-2808.737) -- 0:02:26
      131000 -- (-2805.724) (-2813.359) (-2810.861) [-2808.276] * (-2814.793) (-2808.870) (-2813.712) [-2808.478] -- 0:02:25
      131500 -- (-2812.843) (-2810.873) [-2806.084] (-2814.068) * (-2812.327) (-2811.676) [-2813.596] (-2813.167) -- 0:02:25
      132000 -- (-2809.294) (-2806.912) [-2805.420] (-2816.448) * (-2818.754) [-2804.992] (-2814.413) (-2809.152) -- 0:02:24
      132500 -- [-2809.676] (-2815.158) (-2807.270) (-2817.570) * (-2804.537) (-2808.264) [-2818.561] (-2805.369) -- 0:02:24
      133000 -- (-2808.473) (-2815.726) [-2811.330] (-2811.928) * (-2812.765) (-2809.613) [-2816.231] (-2807.155) -- 0:02:23
      133500 -- (-2812.248) (-2819.985) (-2812.813) [-2811.807] * (-2818.080) (-2807.524) (-2824.535) [-2807.376] -- 0:02:22
      134000 -- (-2812.746) (-2805.965) [-2806.463] (-2810.265) * [-2811.604] (-2806.645) (-2818.947) (-2811.104) -- 0:02:22
      134500 -- (-2811.282) (-2812.136) (-2811.095) [-2811.722] * (-2813.357) (-2810.634) (-2817.348) [-2810.399] -- 0:02:28
      135000 -- (-2808.218) (-2805.672) [-2812.516] (-2810.598) * (-2811.974) (-2808.536) (-2813.737) [-2807.009] -- 0:02:27

      Average standard deviation of split frequencies: 0.019064

      135500 -- (-2813.225) [-2805.509] (-2812.939) (-2814.229) * (-2810.660) (-2806.462) [-2812.490] (-2809.006) -- 0:02:26
      136000 -- (-2814.405) (-2813.570) (-2808.277) [-2809.344] * (-2805.633) (-2807.476) [-2809.781] (-2809.222) -- 0:02:26
      136500 -- [-2808.029] (-2810.345) (-2806.560) (-2809.633) * [-2807.172] (-2810.883) (-2817.084) (-2812.633) -- 0:02:25
      137000 -- (-2809.506) (-2809.498) [-2808.767] (-2809.981) * (-2813.558) (-2819.374) [-2804.491] (-2811.421) -- 0:02:24
      137500 -- (-2805.481) (-2812.067) [-2809.136] (-2808.919) * (-2808.348) [-2809.244] (-2808.616) (-2805.761) -- 0:02:24
      138000 -- (-2809.134) (-2809.546) [-2809.348] (-2810.341) * (-2807.422) [-2805.916] (-2804.010) (-2809.749) -- 0:02:23
      138500 -- [-2808.519] (-2810.586) (-2812.794) (-2808.495) * (-2813.663) (-2807.024) (-2809.917) [-2810.508] -- 0:02:23
      139000 -- [-2808.995] (-2812.700) (-2805.273) (-2806.788) * (-2809.026) (-2807.764) [-2807.410] (-2812.448) -- 0:02:22
      139500 -- (-2814.098) (-2813.941) [-2809.847] (-2817.187) * (-2810.675) (-2809.345) (-2808.750) [-2807.599] -- 0:02:21
      140000 -- (-2810.243) [-2808.896] (-2808.992) (-2817.114) * (-2811.468) [-2807.724] (-2808.565) (-2806.703) -- 0:02:21

      Average standard deviation of split frequencies: 0.018432

      140500 -- (-2809.870) (-2808.896) [-2806.583] (-2812.711) * (-2810.140) [-2809.168] (-2812.436) (-2803.646) -- 0:02:26
      141000 -- (-2811.381) (-2810.199) [-2805.524] (-2811.009) * (-2809.200) (-2808.931) [-2805.922] (-2809.382) -- 0:02:26
      141500 -- (-2806.963) (-2805.461) [-2810.578] (-2814.662) * (-2812.762) (-2804.803) (-2808.671) [-2808.416] -- 0:02:25
      142000 -- (-2813.613) (-2808.463) (-2804.804) [-2808.248] * (-2808.476) (-2805.531) [-2809.768] (-2809.156) -- 0:02:25
      142500 -- (-2811.693) (-2811.138) [-2807.189] (-2809.197) * (-2819.588) (-2805.245) [-2810.925] (-2807.662) -- 0:02:24
      143000 -- (-2806.385) [-2810.906] (-2807.554) (-2815.147) * (-2812.713) (-2809.949) [-2811.566] (-2808.201) -- 0:02:23
      143500 -- (-2808.426) (-2807.102) [-2809.460] (-2807.837) * [-2808.715] (-2812.417) (-2808.586) (-2817.191) -- 0:02:23
      144000 -- (-2819.400) (-2809.250) (-2812.749) [-2811.053] * (-2812.460) [-2812.861] (-2809.364) (-2810.428) -- 0:02:22
      144500 -- [-2806.529] (-2811.359) (-2809.614) (-2807.490) * [-2811.541] (-2817.598) (-2810.358) (-2805.750) -- 0:02:22
      145000 -- (-2811.752) (-2807.488) (-2807.167) [-2813.916] * (-2814.290) [-2811.598] (-2810.844) (-2810.593) -- 0:02:21

      Average standard deviation of split frequencies: 0.010763

      145500 -- [-2807.029] (-2805.597) (-2809.775) (-2815.507) * [-2816.672] (-2810.863) (-2813.667) (-2808.316) -- 0:02:20
      146000 -- (-2817.665) (-2807.094) (-2816.758) [-2812.304] * (-2809.582) (-2813.283) (-2810.904) [-2805.476] -- 0:02:20
      146500 -- (-2812.066) (-2813.320) [-2811.911] (-2809.324) * (-2808.026) [-2807.013] (-2809.390) (-2811.748) -- 0:02:25
      147000 -- (-2808.202) (-2812.348) (-2813.841) [-2811.382] * (-2806.873) (-2812.453) (-2817.221) [-2811.658] -- 0:02:25
      147500 -- [-2803.191] (-2805.711) (-2810.483) (-2808.776) * [-2810.480] (-2811.069) (-2812.615) (-2810.992) -- 0:02:24
      148000 -- (-2809.598) (-2807.902) [-2809.948] (-2806.961) * (-2813.559) [-2812.724] (-2810.318) (-2809.853) -- 0:02:23
      148500 -- (-2812.814) (-2810.564) (-2807.149) [-2808.129] * (-2812.193) (-2813.212) (-2819.463) [-2807.755] -- 0:02:23
      149000 -- (-2812.532) [-2805.618] (-2811.816) (-2810.218) * (-2810.079) (-2806.367) (-2807.215) [-2811.640] -- 0:02:22
      149500 -- (-2812.826) (-2810.785) [-2807.517] (-2808.103) * (-2808.604) (-2807.083) [-2808.848] (-2809.125) -- 0:02:22
      150000 -- (-2814.799) [-2807.608] (-2812.058) (-2808.743) * (-2808.913) [-2807.120] (-2808.241) (-2816.009) -- 0:02:21

      Average standard deviation of split frequencies: 0.002086

      150500 -- [-2811.182] (-2813.408) (-2809.088) (-2812.722) * (-2807.913) (-2806.715) [-2810.245] (-2810.990) -- 0:02:21
      151000 -- (-2823.107) (-2810.856) [-2811.084] (-2814.068) * (-2806.232) [-2809.880] (-2812.280) (-2811.288) -- 0:02:20
      151500 -- (-2810.711) (-2814.970) (-2815.424) [-2804.549] * [-2809.994] (-2808.383) (-2808.269) (-2816.433) -- 0:02:20
      152000 -- (-2806.194) (-2812.243) (-2810.652) [-2808.962] * (-2814.394) (-2807.071) [-2810.404] (-2817.216) -- 0:02:19
      152500 -- (-2809.897) [-2810.627] (-2808.356) (-2810.982) * (-2813.342) (-2811.571) [-2810.237] (-2815.967) -- 0:02:24
      153000 -- (-2810.723) (-2816.494) [-2805.998] (-2809.767) * (-2812.055) [-2805.407] (-2808.712) (-2812.915) -- 0:02:23
      153500 -- (-2806.055) (-2815.798) (-2807.041) [-2804.963] * (-2812.861) [-2806.293] (-2812.335) (-2819.257) -- 0:02:23
      154000 -- [-2806.841] (-2809.801) (-2804.006) (-2809.111) * [-2809.175] (-2807.809) (-2815.373) (-2814.768) -- 0:02:22
      154500 -- [-2808.193] (-2814.097) (-2809.040) (-2816.148) * [-2803.770] (-2807.799) (-2805.321) (-2820.067) -- 0:02:22
      155000 -- (-2807.366) (-2810.072) [-2808.488] (-2803.139) * (-2811.965) (-2806.207) [-2806.937] (-2816.289) -- 0:02:21

      Average standard deviation of split frequencies: 0.007555

      155500 -- (-2808.835) (-2815.093) (-2812.577) [-2808.192] * (-2809.170) (-2810.319) [-2815.010] (-2817.984) -- 0:02:21
      156000 -- (-2808.395) (-2805.611) [-2811.626] (-2811.865) * (-2811.213) [-2804.991] (-2816.418) (-2811.386) -- 0:02:20
      156500 -- (-2817.245) (-2807.772) (-2816.145) [-2813.060] * (-2814.059) (-2807.156) (-2812.821) [-2808.835] -- 0:02:20
      157000 -- (-2813.051) (-2816.083) (-2809.822) [-2808.052] * [-2805.861] (-2807.304) (-2810.821) (-2813.290) -- 0:02:19
      157500 -- (-2806.475) [-2804.863] (-2807.515) (-2811.675) * (-2805.948) (-2811.802) [-2813.047] (-2811.034) -- 0:02:19
      158000 -- [-2807.572] (-2809.132) (-2813.327) (-2805.233) * (-2808.361) (-2810.030) (-2810.434) [-2808.971] -- 0:02:18
      158500 -- [-2808.291] (-2810.895) (-2813.314) (-2815.418) * (-2809.924) (-2813.604) (-2809.851) [-2808.025] -- 0:02:23
      159000 -- (-2805.672) [-2809.597] (-2813.877) (-2819.272) * (-2810.179) (-2815.570) (-2815.007) [-2805.662] -- 0:02:22
      159500 -- [-2807.776] (-2809.427) (-2821.645) (-2810.042) * (-2810.417) (-2814.955) (-2807.654) [-2808.093] -- 0:02:22
      160000 -- [-2808.806] (-2808.823) (-2808.872) (-2807.134) * [-2816.142] (-2810.265) (-2804.267) (-2811.770) -- 0:02:21

      Average standard deviation of split frequencies: 0.005868

      160500 -- (-2811.664) (-2806.345) [-2808.644] (-2812.049) * (-2811.327) (-2807.489) (-2811.409) [-2805.929] -- 0:02:21
      161000 -- (-2819.047) (-2810.965) [-2807.401] (-2812.819) * (-2811.151) [-2805.073] (-2813.438) (-2811.084) -- 0:02:20
      161500 -- (-2810.590) [-2813.688] (-2809.311) (-2808.086) * [-2806.767] (-2810.993) (-2811.667) (-2807.798) -- 0:02:20
      162000 -- (-2819.122) (-2812.900) [-2808.725] (-2811.737) * (-2809.399) [-2807.686] (-2807.654) (-2806.312) -- 0:02:19
      162500 -- (-2826.456) [-2805.349] (-2813.089) (-2807.886) * (-2818.261) (-2806.930) (-2806.818) [-2816.009] -- 0:02:19
      163000 -- (-2816.816) (-2809.653) (-2811.694) [-2811.576] * (-2810.300) (-2812.397) (-2812.913) [-2809.270] -- 0:02:18
      163500 -- (-2811.288) [-2809.144] (-2806.312) (-2808.475) * (-2814.101) [-2809.163] (-2811.324) (-2807.202) -- 0:02:18
      164000 -- [-2805.296] (-2808.020) (-2811.653) (-2808.127) * [-2807.840] (-2822.094) (-2810.433) (-2814.485) -- 0:02:17
      164500 -- (-2807.523) (-2809.748) (-2811.555) [-2808.322] * (-2808.629) (-2816.248) [-2804.341] (-2815.509) -- 0:02:22
      165000 -- (-2810.783) [-2814.443] (-2815.479) (-2811.038) * (-2808.804) (-2812.793) [-2806.081] (-2812.439) -- 0:02:21

      Average standard deviation of split frequencies: 0.009466

      165500 -- (-2809.518) (-2806.706) (-2811.475) [-2807.675] * (-2804.221) [-2816.571] (-2807.246) (-2812.358) -- 0:02:21
      166000 -- (-2810.626) (-2806.539) [-2806.887] (-2818.709) * [-2807.415] (-2811.447) (-2806.301) (-2820.855) -- 0:02:20
      166500 -- (-2817.182) (-2812.461) (-2812.138) [-2809.320] * (-2808.694) (-2804.583) [-2807.265] (-2813.367) -- 0:02:20
      167000 -- [-2813.663] (-2820.444) (-2810.937) (-2812.730) * (-2817.270) (-2810.467) [-2807.889] (-2810.260) -- 0:02:19
      167500 -- (-2811.308) (-2807.193) (-2812.518) [-2809.376] * [-2811.508] (-2812.572) (-2812.867) (-2811.371) -- 0:02:19
      168000 -- [-2807.623] (-2807.052) (-2808.904) (-2808.835) * [-2810.533] (-2812.152) (-2816.405) (-2817.023) -- 0:02:18
      168500 -- (-2806.864) (-2808.048) [-2806.463] (-2807.264) * (-2806.405) (-2809.357) [-2810.271] (-2813.220) -- 0:02:18
      169000 -- (-2807.834) [-2811.286] (-2812.733) (-2813.286) * (-2807.717) (-2817.556) (-2808.294) [-2807.088] -- 0:02:17
      169500 -- [-2808.450] (-2811.506) (-2812.261) (-2809.563) * (-2813.844) (-2816.757) (-2804.386) [-2809.373] -- 0:02:17
      170000 -- (-2811.095) (-2810.082) [-2815.100] (-2812.205) * (-2812.418) [-2809.533] (-2807.508) (-2812.395) -- 0:02:16

      Average standard deviation of split frequencies: 0.007366

      170500 -- (-2807.302) (-2805.740) [-2805.536] (-2814.370) * (-2812.661) (-2812.269) [-2812.419] (-2807.916) -- 0:02:21
      171000 -- [-2809.021] (-2809.298) (-2818.942) (-2806.674) * (-2812.896) (-2806.327) (-2810.393) [-2810.934] -- 0:02:20
      171500 -- (-2804.882) (-2811.303) (-2819.807) [-2809.733] * (-2807.168) [-2813.094] (-2809.976) (-2808.216) -- 0:02:20
      172000 -- (-2809.976) (-2809.114) (-2813.818) [-2811.731] * (-2810.033) (-2815.004) (-2815.489) [-2810.110] -- 0:02:19
      172500 -- (-2808.137) (-2815.584) (-2809.372) [-2808.927] * (-2811.631) [-2816.340] (-2807.002) (-2807.148) -- 0:02:19
      173000 -- (-2814.779) [-2807.636] (-2810.423) (-2812.514) * (-2809.513) (-2812.401) [-2806.136] (-2807.148) -- 0:02:18
      173500 -- (-2810.756) [-2808.126] (-2819.350) (-2816.634) * [-2812.449] (-2816.091) (-2807.518) (-2814.216) -- 0:02:18
      174000 -- (-2817.108) [-2809.782] (-2809.650) (-2814.795) * (-2809.505) [-2817.397] (-2806.627) (-2810.434) -- 0:02:17
      174500 -- [-2819.034] (-2808.086) (-2807.520) (-2805.823) * (-2813.249) [-2810.013] (-2807.303) (-2808.354) -- 0:02:17
      175000 -- (-2815.200) (-2810.373) (-2809.778) [-2816.919] * (-2808.128) (-2811.489) (-2810.365) [-2805.167] -- 0:02:16

      Average standard deviation of split frequencies: 0.005357

      175500 -- (-2805.430) (-2814.127) [-2806.597] (-2806.650) * (-2815.551) (-2809.405) (-2812.395) [-2806.698] -- 0:02:16
      176000 -- (-2817.625) (-2809.292) (-2813.868) [-2806.398] * (-2806.733) (-2809.557) (-2813.607) [-2808.037] -- 0:02:20
      176500 -- (-2822.662) (-2814.574) [-2807.950] (-2807.110) * [-2807.828] (-2805.260) (-2811.456) (-2809.367) -- 0:02:19
      177000 -- (-2815.302) (-2812.572) (-2807.286) [-2803.359] * [-2805.690] (-2809.386) (-2812.255) (-2807.829) -- 0:02:19
      177500 -- (-2820.575) (-2814.105) (-2805.250) [-2806.752] * (-2811.576) (-2811.753) (-2810.533) [-2813.609] -- 0:02:19
      178000 -- (-2814.982) [-2809.097] (-2808.821) (-2807.593) * [-2810.616] (-2811.750) (-2809.334) (-2805.010) -- 0:02:18
      178500 -- (-2813.396) (-2815.849) [-2810.661] (-2809.719) * (-2812.637) (-2807.009) [-2808.935] (-2806.166) -- 0:02:18
      179000 -- (-2813.772) [-2813.435] (-2807.326) (-2807.053) * (-2816.181) (-2816.376) [-2812.979] (-2813.934) -- 0:02:17
      179500 -- [-2813.071] (-2813.845) (-2812.743) (-2806.827) * (-2815.676) (-2805.573) (-2809.191) [-2812.808] -- 0:02:17
      180000 -- [-2810.394] (-2818.586) (-2805.589) (-2807.422) * (-2810.294) (-2814.592) (-2808.489) [-2807.943] -- 0:02:16

      Average standard deviation of split frequencies: 0.001740

      180500 -- (-2811.556) [-2808.116] (-2817.191) (-2807.119) * (-2810.038) (-2823.463) [-2810.925] (-2807.623) -- 0:02:16
      181000 -- [-2808.091] (-2814.242) (-2815.773) (-2815.331) * [-2807.168] (-2812.367) (-2809.754) (-2813.174) -- 0:02:15
      181500 -- (-2811.226) (-2815.708) [-2813.179] (-2818.511) * [-2804.603] (-2809.926) (-2809.609) (-2818.232) -- 0:02:15
      182000 -- (-2808.519) [-2805.831] (-2810.561) (-2810.095) * (-2812.950) [-2806.959] (-2808.038) (-2814.273) -- 0:02:19
      182500 -- (-2813.553) [-2807.550] (-2812.017) (-2809.336) * [-2811.142] (-2811.432) (-2807.274) (-2813.319) -- 0:02:18
      183000 -- (-2805.678) (-2813.757) [-2806.586] (-2814.274) * (-2813.287) (-2810.833) [-2809.363] (-2813.093) -- 0:02:18
      183500 -- (-2817.953) [-2815.333] (-2807.495) (-2809.449) * (-2822.210) [-2808.993] (-2811.983) (-2809.315) -- 0:02:17
      184000 -- (-2816.733) (-2818.066) (-2808.597) [-2812.454] * (-2817.558) [-2805.179] (-2810.329) (-2805.732) -- 0:02:17
      184500 -- (-2809.035) [-2804.439] (-2819.198) (-2813.046) * (-2813.924) (-2805.286) (-2813.823) [-2807.729] -- 0:02:17
      185000 -- [-2811.869] (-2809.655) (-2815.976) (-2818.332) * (-2811.652) [-2813.997] (-2813.786) (-2806.300) -- 0:02:16

      Average standard deviation of split frequencies: 0.005069

      185500 -- (-2810.366) (-2814.984) (-2806.382) [-2808.823] * (-2807.499) (-2807.822) [-2817.218] (-2808.105) -- 0:02:16
      186000 -- [-2806.987] (-2810.296) (-2816.139) (-2807.650) * (-2808.255) (-2817.395) (-2811.832) [-2808.197] -- 0:02:15
      186500 -- [-2807.784] (-2810.968) (-2810.981) (-2810.060) * [-2811.294] (-2811.976) (-2811.762) (-2807.143) -- 0:02:15
      187000 -- (-2803.290) [-2813.411] (-2813.116) (-2810.831) * (-2817.256) [-2810.238] (-2814.407) (-2804.735) -- 0:02:14
      187500 -- (-2808.935) (-2808.860) (-2812.356) [-2810.625] * (-2806.639) (-2810.759) [-2807.881] (-2808.034) -- 0:02:14
      188000 -- (-2808.950) [-2812.879] (-2809.885) (-2815.035) * (-2812.219) (-2817.261) (-2812.979) [-2812.594] -- 0:02:18
      188500 -- (-2808.459) (-2812.007) (-2819.179) [-2807.175] * (-2808.271) (-2810.927) [-2813.167] (-2809.363) -- 0:02:17
      189000 -- [-2810.462] (-2816.659) (-2812.096) (-2815.028) * (-2807.897) (-2809.900) [-2810.430] (-2806.900) -- 0:02:17
      189500 -- (-2809.852) (-2809.887) (-2818.958) [-2811.713] * [-2806.698] (-2809.458) (-2809.799) (-2813.184) -- 0:02:16
      190000 -- (-2815.813) (-2807.894) (-2811.071) [-2807.149] * (-2811.109) [-2805.749] (-2810.287) (-2807.355) -- 0:02:16

      Average standard deviation of split frequencies: 0.004945

      190500 -- (-2812.039) (-2807.435) [-2805.853] (-2807.760) * [-2814.654] (-2805.219) (-2813.735) (-2809.421) -- 0:02:15
      191000 -- [-2807.586] (-2810.339) (-2807.573) (-2807.436) * (-2812.918) [-2817.886] (-2816.197) (-2809.045) -- 0:02:15
      191500 -- (-2808.947) [-2809.626] (-2807.848) (-2808.961) * [-2807.955] (-2817.701) (-2812.523) (-2810.672) -- 0:02:15
      192000 -- (-2810.623) (-2807.292) (-2816.683) [-2806.813] * (-2806.685) (-2810.655) (-2815.480) [-2809.906] -- 0:02:14
      192500 -- (-2809.519) [-2808.694] (-2804.819) (-2808.250) * (-2814.002) (-2816.677) (-2809.199) [-2805.293] -- 0:02:14
      193000 -- (-2809.818) (-2806.796) [-2805.430] (-2813.155) * (-2806.949) [-2816.050] (-2816.784) (-2807.495) -- 0:02:13
      193500 -- (-2809.033) [-2808.222] (-2809.441) (-2818.002) * [-2809.260] (-2812.577) (-2809.567) (-2805.541) -- 0:02:13
      194000 -- (-2807.940) (-2816.716) (-2809.825) [-2807.803] * [-2807.711] (-2807.486) (-2817.708) (-2805.391) -- 0:02:17
      194500 -- [-2807.610] (-2808.419) (-2815.549) (-2807.332) * (-2805.829) (-2812.372) (-2818.557) [-2808.443] -- 0:02:16
      195000 -- (-2810.284) (-2805.756) [-2806.617] (-2813.231) * (-2811.348) [-2810.748] (-2815.114) (-2810.989) -- 0:02:16

      Average standard deviation of split frequencies: 0.003207

      195500 -- [-2808.964] (-2814.398) (-2811.198) (-2811.305) * [-2811.615] (-2813.054) (-2812.050) (-2806.946) -- 0:02:15
      196000 -- [-2808.916] (-2808.576) (-2812.008) (-2806.609) * (-2813.561) (-2815.284) [-2802.988] (-2805.852) -- 0:02:15
      196500 -- (-2813.749) (-2811.331) [-2812.661] (-2820.389) * (-2814.418) (-2813.934) [-2804.018] (-2813.545) -- 0:02:14
      197000 -- (-2826.119) (-2808.644) [-2806.586] (-2807.416) * (-2805.935) (-2807.124) (-2813.835) [-2811.670] -- 0:02:14
      197500 -- (-2811.926) (-2808.771) (-2815.239) [-2809.173] * [-2806.592] (-2808.305) (-2810.532) (-2810.651) -- 0:02:14
      198000 -- (-2809.134) [-2806.345] (-2811.934) (-2806.533) * (-2811.954) [-2809.382] (-2807.608) (-2813.610) -- 0:02:13
      198500 -- (-2813.565) (-2808.264) (-2816.107) [-2805.971] * (-2807.143) (-2806.375) (-2809.374) [-2806.193] -- 0:02:13
      199000 -- [-2811.414] (-2807.106) (-2817.458) (-2812.414) * (-2809.453) [-2812.629] (-2807.805) (-2806.975) -- 0:02:12
      199500 -- (-2805.912) (-2807.687) (-2820.265) [-2806.141] * (-2807.386) (-2809.792) [-2806.756] (-2810.877) -- 0:02:12
      200000 -- (-2809.465) (-2813.020) (-2807.123) [-2809.897] * (-2812.297) [-2806.010] (-2816.189) (-2808.527) -- 0:02:16

      Average standard deviation of split frequencies: 0.006265

      200500 -- (-2811.820) (-2813.367) [-2816.344] (-2811.922) * (-2811.278) (-2806.630) [-2816.377] (-2809.948) -- 0:02:15
      201000 -- (-2812.652) [-2808.677] (-2809.266) (-2809.798) * (-2811.491) (-2808.182) (-2809.861) [-2810.474] -- 0:02:15
      201500 -- (-2814.225) (-2810.734) [-2810.340] (-2811.653) * (-2811.133) [-2807.156] (-2816.265) (-2811.085) -- 0:02:14
      202000 -- [-2809.896] (-2808.834) (-2813.721) (-2810.061) * [-2810.523] (-2806.172) (-2817.245) (-2818.488) -- 0:02:14
      202500 -- (-2815.828) (-2804.557) (-2814.233) [-2805.906] * [-2809.833] (-2807.089) (-2812.861) (-2808.629) -- 0:02:13
      203000 -- (-2806.588) [-2810.830] (-2805.633) (-2810.216) * (-2814.828) [-2809.058] (-2809.477) (-2808.348) -- 0:02:13
      203500 -- (-2810.311) (-2810.326) [-2811.782] (-2813.256) * [-2816.936] (-2810.711) (-2815.081) (-2811.112) -- 0:02:13
      204000 -- [-2809.276] (-2807.120) (-2810.064) (-2810.744) * (-2807.006) (-2811.781) (-2805.919) [-2808.670] -- 0:02:12
      204500 -- (-2805.968) (-2815.206) (-2816.309) [-2814.848] * (-2807.303) (-2812.261) (-2811.670) [-2810.464] -- 0:02:12
      205000 -- [-2818.537] (-2810.228) (-2808.362) (-2806.247) * (-2810.767) (-2812.486) [-2804.315] (-2806.766) -- 0:02:11

      Average standard deviation of split frequencies: 0.009153

      205500 -- [-2810.204] (-2812.389) (-2812.921) (-2814.364) * (-2811.924) (-2813.729) (-2807.282) [-2807.052] -- 0:02:11
      206000 -- [-2809.823] (-2806.333) (-2812.228) (-2812.145) * (-2806.182) (-2806.834) [-2803.132] (-2814.423) -- 0:02:14
      206500 -- (-2811.960) (-2815.000) (-2809.301) [-2810.606] * (-2808.704) (-2818.263) [-2810.045] (-2810.534) -- 0:02:14
      207000 -- (-2810.936) (-2812.112) [-2808.223] (-2806.268) * (-2809.844) (-2814.466) [-2806.859] (-2811.043) -- 0:02:14
      207500 -- [-2816.858] (-2812.851) (-2808.371) (-2813.326) * (-2808.725) (-2808.407) (-2805.801) [-2810.966] -- 0:02:13
      208000 -- (-2810.495) (-2814.881) [-2809.057] (-2806.296) * (-2805.096) (-2810.716) (-2807.344) [-2806.307] -- 0:02:13
      208500 -- [-2813.496] (-2816.070) (-2808.151) (-2815.076) * (-2812.348) [-2810.120] (-2813.297) (-2811.729) -- 0:02:12
      209000 -- (-2809.121) [-2809.717] (-2816.215) (-2810.102) * (-2810.831) (-2813.646) (-2809.475) [-2809.710] -- 0:02:12
      209500 -- (-2811.652) (-2807.576) [-2808.460] (-2808.757) * (-2810.120) (-2811.589) (-2813.426) [-2804.666] -- 0:02:12
      210000 -- [-2809.438] (-2807.359) (-2815.351) (-2811.822) * (-2808.629) (-2807.561) (-2811.571) [-2805.169] -- 0:02:11

      Average standard deviation of split frequencies: 0.011934

      210500 -- (-2808.792) [-2810.178] (-2811.147) (-2813.315) * [-2810.518] (-2809.604) (-2817.672) (-2805.015) -- 0:02:11
      211000 -- (-2814.106) (-2810.919) [-2812.471] (-2809.740) * [-2806.791] (-2808.128) (-2815.170) (-2808.285) -- 0:02:10
      211500 -- (-2815.500) (-2810.936) [-2809.734] (-2807.289) * (-2809.154) (-2813.676) (-2811.987) [-2810.709] -- 0:02:10
      212000 -- (-2812.203) (-2814.902) (-2814.793) [-2809.009] * (-2809.338) [-2805.196] (-2815.641) (-2817.556) -- 0:02:13
      212500 -- (-2814.251) (-2816.397) [-2805.865] (-2813.754) * (-2806.012) [-2805.441] (-2812.330) (-2815.187) -- 0:02:13
      213000 -- (-2815.262) (-2809.031) (-2809.731) [-2810.495] * (-2806.528) (-2806.283) [-2803.895] (-2821.359) -- 0:02:13
      213500 -- (-2809.097) (-2814.046) (-2809.463) [-2809.534] * (-2807.380) [-2806.500] (-2808.099) (-2819.959) -- 0:02:12
      214000 -- (-2804.273) [-2816.029] (-2809.161) (-2818.024) * (-2809.453) (-2809.702) (-2813.647) [-2814.822] -- 0:02:12
      214500 -- (-2808.942) [-2807.821] (-2815.250) (-2814.641) * [-2808.246] (-2812.198) (-2809.332) (-2816.661) -- 0:02:11
      215000 -- [-2809.996] (-2808.270) (-2813.668) (-2808.485) * (-2812.187) [-2809.697] (-2810.060) (-2822.236) -- 0:02:11

      Average standard deviation of split frequencies: 0.011640

      215500 -- (-2806.806) [-2807.754] (-2811.564) (-2806.436) * (-2809.109) (-2808.455) [-2809.271] (-2814.466) -- 0:02:11
      216000 -- (-2806.036) (-2811.767) (-2816.321) [-2805.887] * (-2817.864) (-2811.514) (-2808.316) [-2804.745] -- 0:02:10
      216500 -- (-2807.647) (-2808.385) (-2811.749) [-2807.796] * (-2809.601) (-2814.234) [-2813.664] (-2811.045) -- 0:02:10
      217000 -- (-2810.209) [-2807.102] (-2813.623) (-2807.100) * [-2808.728] (-2811.077) (-2809.603) (-2807.673) -- 0:02:09
      217500 -- (-2808.760) [-2811.557] (-2808.519) (-2812.783) * [-2815.886] (-2811.727) (-2807.648) (-2807.943) -- 0:02:09
      218000 -- (-2806.223) (-2807.924) (-2818.868) [-2813.844] * [-2812.601] (-2813.300) (-2810.388) (-2808.974) -- 0:02:12
      218500 -- (-2804.917) [-2806.607] (-2805.408) (-2803.999) * (-2811.817) [-2809.253] (-2807.477) (-2813.972) -- 0:02:12
      219000 -- (-2810.449) (-2810.916) (-2805.979) [-2806.432] * [-2811.886] (-2806.776) (-2811.296) (-2809.495) -- 0:02:11
      219500 -- [-2809.390] (-2808.247) (-2808.478) (-2816.746) * (-2807.638) (-2811.389) [-2807.590] (-2814.257) -- 0:02:11
      220000 -- (-2810.443) (-2818.814) (-2811.513) [-2806.953] * (-2809.904) (-2809.017) [-2807.584] (-2808.862) -- 0:02:11

      Average standard deviation of split frequencies: 0.008545

      220500 -- (-2812.095) (-2808.590) (-2812.738) [-2804.514] * (-2806.952) (-2810.620) (-2807.201) [-2805.906] -- 0:02:10
      221000 -- (-2806.122) (-2809.297) [-2810.019] (-2810.918) * [-2809.800] (-2810.039) (-2806.761) (-2808.234) -- 0:02:10
      221500 -- (-2809.386) (-2809.354) [-2809.932] (-2812.290) * (-2805.836) [-2806.247] (-2809.588) (-2808.352) -- 0:02:10
      222000 -- (-2811.824) (-2810.424) (-2813.774) [-2810.836] * (-2809.962) (-2810.032) (-2811.615) [-2811.785] -- 0:02:09
      222500 -- (-2809.232) (-2806.928) (-2809.640) [-2808.825] * (-2812.551) (-2808.373) [-2802.467] (-2805.545) -- 0:02:09
      223000 -- (-2808.053) (-2809.984) (-2806.302) [-2803.083] * (-2810.673) (-2814.354) [-2815.073] (-2804.767) -- 0:02:08
      223500 -- (-2807.942) (-2806.309) (-2806.994) [-2810.915] * (-2806.660) (-2812.447) [-2822.835] (-2808.433) -- 0:02:08
      224000 -- [-2809.902] (-2809.923) (-2821.327) (-2809.575) * (-2811.784) (-2814.056) [-2818.217] (-2807.042) -- 0:02:11
      224500 -- [-2810.660] (-2810.904) (-2811.834) (-2812.571) * (-2805.838) [-2808.992] (-2810.138) (-2807.579) -- 0:02:11
      225000 -- [-2807.001] (-2807.538) (-2816.584) (-2815.868) * (-2810.331) [-2809.144] (-2806.340) (-2806.224) -- 0:02:10

      Average standard deviation of split frequencies: 0.011125

      225500 -- (-2815.082) [-2806.790] (-2809.726) (-2810.353) * (-2810.535) (-2804.994) (-2815.250) [-2808.990] -- 0:02:10
      226000 -- (-2819.522) (-2810.108) (-2807.333) [-2806.349] * (-2807.892) (-2811.708) (-2812.004) [-2810.617] -- 0:02:10
      226500 -- (-2817.883) (-2814.619) [-2807.900] (-2815.736) * (-2813.228) [-2808.312] (-2807.394) (-2805.757) -- 0:02:09
      227000 -- (-2814.624) (-2816.181) [-2811.178] (-2813.503) * (-2805.177) (-2812.492) [-2804.438] (-2811.619) -- 0:02:09
      227500 -- (-2807.707) [-2813.398] (-2808.948) (-2817.937) * [-2807.882] (-2815.725) (-2807.158) (-2810.637) -- 0:02:09
      228000 -- (-2813.836) (-2810.838) [-2811.060] (-2818.008) * (-2806.091) [-2809.360] (-2807.727) (-2805.810) -- 0:02:08
      228500 -- (-2812.356) (-2811.199) [-2806.322] (-2812.505) * (-2810.179) (-2816.760) (-2807.413) [-2809.822] -- 0:02:08
      229000 -- [-2814.308] (-2812.670) (-2809.496) (-2806.993) * (-2813.574) [-2814.094] (-2810.918) (-2806.349) -- 0:02:07
      229500 -- (-2807.828) (-2809.885) (-2815.523) [-2808.078] * (-2811.903) (-2811.615) (-2812.580) [-2814.919] -- 0:02:07
      230000 -- (-2808.721) (-2802.826) (-2811.951) [-2808.665] * (-2809.455) (-2813.484) [-2814.472] (-2812.677) -- 0:02:10

      Average standard deviation of split frequencies: 0.006812

      230500 -- (-2810.171) [-2807.282] (-2809.611) (-2810.264) * (-2812.879) (-2811.470) (-2811.974) [-2804.543] -- 0:02:10
      231000 -- (-2809.255) (-2808.080) [-2808.504] (-2810.322) * (-2820.860) [-2810.129] (-2812.248) (-2808.803) -- 0:02:09
      231500 -- (-2806.350) (-2814.984) [-2814.851] (-2807.620) * (-2811.588) [-2807.798] (-2815.023) (-2807.955) -- 0:02:09
      232000 -- (-2809.303) (-2810.270) [-2809.175] (-2813.234) * (-2813.026) [-2806.433] (-2815.160) (-2813.020) -- 0:02:09
      232500 -- (-2812.278) [-2808.246] (-2812.308) (-2808.410) * (-2804.005) [-2811.111] (-2817.777) (-2808.610) -- 0:02:08
      233000 -- (-2809.774) (-2811.669) [-2806.125] (-2818.598) * (-2809.405) [-2806.920] (-2813.380) (-2812.847) -- 0:02:08
      233500 -- (-2804.457) [-2811.761] (-2809.158) (-2810.250) * (-2818.452) [-2810.322] (-2812.907) (-2811.975) -- 0:02:08
      234000 -- (-2813.038) [-2809.730] (-2811.485) (-2817.038) * (-2815.081) [-2809.680] (-2810.624) (-2813.896) -- 0:02:07
      234500 -- (-2814.366) (-2816.409) [-2812.841] (-2823.045) * (-2811.939) [-2813.112] (-2813.405) (-2805.797) -- 0:02:07
      235000 -- [-2807.448] (-2809.315) (-2806.367) (-2814.603) * (-2812.087) [-2811.628] (-2810.850) (-2809.671) -- 0:02:06

      Average standard deviation of split frequencies: 0.010653

      235500 -- [-2811.872] (-2812.964) (-2808.445) (-2807.226) * [-2808.003] (-2811.183) (-2810.201) (-2810.194) -- 0:02:06
      236000 -- (-2808.544) [-2806.783] (-2813.110) (-2809.251) * (-2809.386) [-2806.111] (-2805.698) (-2808.089) -- 0:02:09
      236500 -- (-2812.433) [-2811.899] (-2810.815) (-2811.893) * (-2811.060) [-2810.718] (-2805.592) (-2811.901) -- 0:02:09
      237000 -- (-2812.963) [-2810.447] (-2812.734) (-2810.663) * (-2808.627) (-2812.843) [-2809.998] (-2811.253) -- 0:02:08
      237500 -- (-2813.857) (-2813.936) [-2807.127] (-2807.556) * (-2811.789) [-2808.341] (-2807.239) (-2814.755) -- 0:02:08
      238000 -- (-2809.127) (-2814.710) (-2805.004) [-2808.710] * [-2807.936] (-2807.625) (-2815.458) (-2817.643) -- 0:02:08
      238500 -- (-2812.069) [-2812.001] (-2807.033) (-2816.345) * (-2809.276) [-2805.667] (-2810.597) (-2807.978) -- 0:02:07
      239000 -- (-2813.311) (-2810.805) [-2807.509] (-2807.039) * (-2814.791) (-2807.219) [-2808.229] (-2806.906) -- 0:02:07
      239500 -- (-2810.721) [-2812.026] (-2810.180) (-2819.664) * (-2810.742) (-2806.496) [-2809.705] (-2810.916) -- 0:02:07
      240000 -- (-2815.603) (-2809.733) [-2816.889] (-2808.996) * [-2808.088] (-2805.586) (-2809.313) (-2808.360) -- 0:02:06

      Average standard deviation of split frequencies: 0.014364

      240500 -- (-2808.764) (-2805.084) (-2816.445) [-2811.459] * (-2810.049) [-2806.756] (-2808.605) (-2803.518) -- 0:02:06
      241000 -- (-2816.451) (-2807.112) (-2808.103) [-2810.440] * [-2813.336] (-2812.818) (-2811.872) (-2811.449) -- 0:02:05
      241500 -- (-2806.995) (-2806.175) (-2816.189) [-2810.264] * (-2810.737) [-2804.628] (-2812.504) (-2807.851) -- 0:02:05
      242000 -- (-2806.963) [-2811.292] (-2804.464) (-2810.192) * (-2810.213) (-2814.238) [-2809.504] (-2806.276) -- 0:02:08
      242500 -- [-2809.270] (-2806.370) (-2810.128) (-2813.713) * [-2814.679] (-2811.893) (-2815.104) (-2811.041) -- 0:02:08
      243000 -- (-2810.159) (-2809.870) [-2814.119] (-2809.834) * [-2810.401] (-2811.716) (-2808.963) (-2805.703) -- 0:02:07
      243500 -- (-2813.336) (-2812.759) [-2812.601] (-2820.159) * (-2810.943) (-2809.148) [-2806.924] (-2811.519) -- 0:02:07
      244000 -- (-2806.475) [-2810.068] (-2811.374) (-2819.561) * (-2808.525) [-2808.906] (-2809.290) (-2812.195) -- 0:02:07
      244500 -- [-2807.184] (-2814.610) (-2809.298) (-2811.813) * (-2805.670) (-2810.802) [-2809.647] (-2810.822) -- 0:02:06
      245000 -- [-2807.541] (-2807.344) (-2815.667) (-2809.947) * (-2809.835) [-2805.750] (-2807.154) (-2805.712) -- 0:02:06

      Average standard deviation of split frequencies: 0.012775

      245500 -- [-2806.749] (-2807.574) (-2816.115) (-2813.182) * (-2809.489) (-2814.680) [-2808.146] (-2807.441) -- 0:02:06
      246000 -- (-2805.428) (-2806.914) (-2807.721) [-2812.712] * (-2812.275) (-2809.907) [-2808.548] (-2811.310) -- 0:02:05
      246500 -- (-2807.907) (-2819.429) [-2807.430] (-2812.055) * [-2809.117] (-2811.901) (-2813.072) (-2810.309) -- 0:02:05
      247000 -- (-2806.984) [-2805.057] (-2810.014) (-2809.770) * (-2806.624) (-2814.389) (-2813.500) [-2808.044] -- 0:02:04
      247500 -- (-2817.490) (-2809.478) [-2813.092] (-2811.115) * (-2814.746) [-2810.269] (-2815.570) (-2809.995) -- 0:02:04
      248000 -- (-2813.141) (-2809.465) [-2811.059] (-2808.666) * (-2810.242) (-2808.997) (-2812.486) [-2814.136] -- 0:02:07
      248500 -- (-2815.470) (-2808.960) (-2810.233) [-2809.538] * (-2811.013) (-2811.948) (-2806.054) [-2808.214] -- 0:02:07
      249000 -- (-2812.175) [-2808.287] (-2804.606) (-2809.041) * (-2811.189) [-2812.403] (-2812.546) (-2808.312) -- 0:02:06
      249500 -- (-2811.273) [-2808.654] (-2814.204) (-2808.034) * (-2815.476) [-2815.323] (-2818.497) (-2812.158) -- 0:02:06
      250000 -- (-2813.525) [-2803.941] (-2807.329) (-2805.745) * [-2813.388] (-2807.852) (-2809.118) (-2813.041) -- 0:02:06

      Average standard deviation of split frequencies: 0.011284

      250500 -- [-2808.713] (-2808.188) (-2809.805) (-2809.518) * [-2808.932] (-2813.853) (-2810.248) (-2815.839) -- 0:02:05
      251000 -- (-2814.782) (-2808.467) (-2819.744) [-2806.102] * (-2810.725) (-2804.896) [-2809.064] (-2809.938) -- 0:02:05
      251500 -- [-2816.296] (-2815.548) (-2810.036) (-2810.548) * (-2810.626) (-2809.260) [-2810.837] (-2809.120) -- 0:02:04
      252000 -- (-2814.765) [-2810.444] (-2814.224) (-2811.560) * [-2809.402] (-2811.453) (-2809.986) (-2810.883) -- 0:02:04
      252500 -- (-2809.911) (-2814.238) [-2811.590] (-2815.474) * (-2809.452) (-2806.011) [-2811.010] (-2809.100) -- 0:02:04
      253000 -- (-2814.059) [-2816.072] (-2809.802) (-2812.359) * (-2810.566) (-2808.678) [-2809.174] (-2807.300) -- 0:02:04
      253500 -- (-2811.064) (-2813.153) [-2810.510] (-2808.489) * [-2804.784] (-2810.047) (-2807.172) (-2816.385) -- 0:02:03
      254000 -- (-2808.496) (-2806.355) [-2805.000] (-2821.166) * [-2808.453] (-2810.009) (-2807.839) (-2816.355) -- 0:02:06
      254500 -- (-2812.227) (-2813.326) [-2809.550] (-2811.276) * (-2816.581) (-2807.367) (-2811.087) [-2812.915] -- 0:02:05
      255000 -- (-2809.702) (-2808.533) (-2810.868) [-2807.136] * (-2815.583) (-2806.243) (-2811.713) [-2813.821] -- 0:02:05

      Average standard deviation of split frequencies: 0.009821

      255500 -- (-2807.601) [-2805.838] (-2816.648) (-2809.759) * [-2811.349] (-2807.411) (-2808.129) (-2812.214) -- 0:02:05
      256000 -- (-2810.757) (-2810.961) (-2811.138) [-2805.917] * (-2812.180) (-2807.942) [-2807.375] (-2810.659) -- 0:02:04
      256500 -- (-2814.639) (-2811.010) (-2808.737) [-2809.627] * (-2811.500) [-2807.917] (-2812.955) (-2809.210) -- 0:02:04
      257000 -- (-2808.065) [-2821.690] (-2808.523) (-2811.700) * (-2812.047) (-2814.297) (-2810.352) [-2805.470] -- 0:02:04
      257500 -- [-2809.638] (-2810.136) (-2813.803) (-2805.748) * (-2810.412) (-2813.488) (-2804.648) [-2805.989] -- 0:02:03
      258000 -- (-2814.603) [-2806.953] (-2811.409) (-2809.284) * (-2809.761) (-2806.512) [-2805.974] (-2812.159) -- 0:02:03
      258500 -- (-2817.833) [-2808.158] (-2807.049) (-2807.205) * (-2805.859) (-2809.118) [-2804.391] (-2806.993) -- 0:02:03
      259000 -- (-2811.824) (-2810.660) [-2805.131] (-2811.548) * [-2813.419] (-2809.099) (-2808.299) (-2811.897) -- 0:02:03
      259500 -- (-2813.178) [-2808.568] (-2807.139) (-2809.536) * (-2815.700) (-2812.009) (-2812.061) [-2806.123] -- 0:02:05
      260000 -- (-2810.426) (-2810.039) (-2812.136) [-2810.098] * (-2817.785) [-2806.908] (-2809.109) (-2816.421) -- 0:02:05

      Average standard deviation of split frequencies: 0.010851

      260500 -- (-2811.665) (-2807.613) (-2808.424) [-2808.898] * (-2816.419) [-2806.720] (-2808.689) (-2812.877) -- 0:02:04
      261000 -- (-2808.465) (-2814.061) [-2806.626] (-2810.762) * (-2813.813) (-2810.120) (-2810.884) [-2806.607] -- 0:02:04
      261500 -- (-2810.669) [-2804.832] (-2812.044) (-2808.330) * (-2808.879) [-2807.942] (-2809.889) (-2819.759) -- 0:02:04
      262000 -- (-2807.801) (-2810.023) (-2815.490) [-2805.220] * [-2808.604] (-2807.483) (-2814.946) (-2805.857) -- 0:02:03
      262500 -- (-2812.599) [-2810.492] (-2816.785) (-2807.060) * (-2810.599) (-2808.442) [-2810.954] (-2822.657) -- 0:02:03
      263000 -- (-2810.970) (-2812.531) (-2824.001) [-2808.582] * [-2806.380] (-2808.713) (-2810.918) (-2818.232) -- 0:02:03
      263500 -- [-2808.756] (-2808.025) (-2821.276) (-2806.301) * [-2806.876] (-2810.550) (-2814.427) (-2809.574) -- 0:02:02
      264000 -- (-2807.867) (-2809.969) [-2815.870] (-2804.700) * (-2807.444) (-2807.209) [-2808.383] (-2805.347) -- 0:02:02
      264500 -- (-2817.413) (-2809.630) (-2809.047) [-2816.546] * (-2808.937) (-2807.801) (-2811.835) [-2806.804] -- 0:02:02
      265000 -- (-2815.240) (-2804.799) (-2810.214) [-2807.645] * (-2811.728) (-2811.838) (-2809.406) [-2806.712] -- 0:02:02

      Average standard deviation of split frequencies: 0.010633

      265500 -- [-2811.474] (-2806.405) (-2809.835) (-2811.340) * (-2812.324) (-2816.317) (-2812.544) [-2809.747] -- 0:02:04
      266000 -- (-2812.587) (-2814.553) [-2810.387] (-2814.941) * (-2812.889) [-2810.507] (-2810.456) (-2810.255) -- 0:02:04
      266500 -- (-2809.986) [-2807.634] (-2815.310) (-2809.218) * (-2814.541) (-2808.846) (-2805.837) [-2814.152] -- 0:02:03
      267000 -- (-2813.853) [-2811.774] (-2809.016) (-2806.730) * (-2809.933) [-2809.052] (-2807.716) (-2807.378) -- 0:02:03
      267500 -- (-2809.450) (-2812.299) [-2810.222] (-2811.266) * (-2811.709) (-2814.220) [-2810.457] (-2810.702) -- 0:02:03
      268000 -- [-2812.731] (-2810.096) (-2807.790) (-2808.630) * (-2810.828) [-2815.957] (-2812.197) (-2813.812) -- 0:02:02
      268500 -- (-2813.218) [-2818.051] (-2811.387) (-2803.751) * (-2821.465) (-2813.420) [-2808.459] (-2821.504) -- 0:02:02
      269000 -- (-2815.121) (-2811.459) (-2806.489) [-2807.555] * [-2807.528] (-2812.294) (-2808.195) (-2819.754) -- 0:02:02
      269500 -- [-2803.843] (-2812.070) (-2813.804) (-2814.885) * (-2808.605) (-2811.904) (-2805.691) [-2809.847] -- 0:02:01
      270000 -- [-2804.676] (-2805.577) (-2805.533) (-2811.445) * [-2808.455] (-2806.700) (-2809.618) (-2811.906) -- 0:02:01

      Average standard deviation of split frequencies: 0.011611

      270500 -- [-2806.386] (-2817.569) (-2808.166) (-2810.823) * (-2807.794) (-2810.562) (-2813.523) [-2810.140] -- 0:02:01
      271000 -- [-2811.441] (-2811.299) (-2810.594) (-2814.990) * (-2813.866) (-2806.755) (-2816.560) [-2811.372] -- 0:02:01
      271500 -- [-2806.749] (-2813.077) (-2807.504) (-2808.112) * (-2814.048) (-2812.578) [-2805.586] (-2813.350) -- 0:02:03
      272000 -- [-2806.679] (-2813.532) (-2812.808) (-2812.780) * (-2812.969) (-2807.096) (-2806.575) [-2814.027] -- 0:02:03
      272500 -- [-2811.120] (-2811.622) (-2811.896) (-2814.991) * (-2809.239) [-2809.267] (-2811.605) (-2809.408) -- 0:02:02
      273000 -- [-2806.661] (-2807.954) (-2809.961) (-2808.553) * (-2811.258) (-2809.648) (-2807.568) [-2812.538] -- 0:02:02
      273500 -- (-2813.961) [-2809.540] (-2808.622) (-2809.609) * [-2809.553] (-2805.822) (-2811.572) (-2813.450) -- 0:02:02
      274000 -- [-2813.570] (-2811.268) (-2812.287) (-2811.030) * [-2810.249] (-2811.529) (-2812.180) (-2824.313) -- 0:02:01
      274500 -- (-2811.199) (-2808.950) (-2811.625) [-2814.833] * (-2810.852) (-2811.997) [-2807.127] (-2807.187) -- 0:02:01
      275000 -- (-2809.468) (-2821.090) [-2815.535] (-2812.819) * [-2809.097] (-2806.920) (-2806.430) (-2813.024) -- 0:02:01

      Average standard deviation of split frequencies: 0.011387

      275500 -- (-2807.577) [-2809.679] (-2811.417) (-2810.215) * (-2805.371) (-2811.648) (-2809.882) [-2808.995] -- 0:02:00
      276000 -- [-2807.072] (-2813.864) (-2815.563) (-2810.941) * (-2804.203) [-2805.374] (-2815.804) (-2804.990) -- 0:02:00
      276500 -- (-2808.554) (-2815.240) (-2808.130) [-2805.506] * (-2811.391) [-2806.164] (-2811.487) (-2810.132) -- 0:02:00
      277000 -- (-2817.403) (-2810.465) (-2809.237) [-2804.727] * (-2809.586) [-2808.825] (-2807.003) (-2810.693) -- 0:02:00
      277500 -- (-2810.139) [-2805.158] (-2807.316) (-2811.228) * (-2809.923) [-2809.931] (-2809.020) (-2813.940) -- 0:02:02
      278000 -- [-2809.876] (-2807.520) (-2808.763) (-2812.907) * [-2807.586] (-2816.548) (-2808.697) (-2805.471) -- 0:02:02
      278500 -- (-2812.315) (-2811.329) (-2808.497) [-2806.845] * [-2804.556] (-2820.606) (-2813.735) (-2809.567) -- 0:02:01
      279000 -- [-2814.674] (-2812.144) (-2807.251) (-2807.548) * (-2810.346) (-2814.252) [-2812.991] (-2820.768) -- 0:02:01
      279500 -- [-2806.383] (-2814.767) (-2807.766) (-2810.608) * [-2811.110] (-2815.443) (-2807.372) (-2812.238) -- 0:02:01
      280000 -- (-2810.964) (-2821.228) (-2815.387) [-2808.471] * (-2820.370) [-2810.778] (-2806.995) (-2812.531) -- 0:02:00

      Average standard deviation of split frequencies: 0.008958

      280500 -- (-2808.264) (-2816.351) (-2812.422) [-2806.509] * (-2806.975) (-2811.826) (-2807.182) [-2811.195] -- 0:02:00
      281000 -- (-2808.948) [-2805.539] (-2818.142) (-2813.790) * (-2816.002) (-2804.933) [-2805.579] (-2807.395) -- 0:02:00
      281500 -- (-2809.438) (-2806.621) (-2815.753) [-2808.024] * (-2814.284) [-2805.262] (-2808.155) (-2807.650) -- 0:01:59
      282000 -- (-2812.721) [-2808.501] (-2808.205) (-2806.830) * (-2810.725) [-2806.349] (-2805.098) (-2806.002) -- 0:01:59
      282500 -- [-2807.081] (-2810.576) (-2810.503) (-2813.991) * [-2806.065] (-2810.887) (-2811.932) (-2812.005) -- 0:01:59
      283000 -- (-2810.130) (-2806.094) (-2806.442) [-2809.396] * (-2810.821) (-2819.346) (-2812.359) [-2815.335] -- 0:01:59
      283500 -- (-2810.151) (-2808.030) (-2805.200) [-2807.436] * (-2811.383) (-2812.562) (-2813.270) [-2811.885] -- 0:02:01
      284000 -- (-2811.954) (-2812.665) [-2811.110] (-2809.017) * [-2811.089] (-2814.394) (-2808.823) (-2809.760) -- 0:02:01
      284500 -- (-2815.006) (-2808.942) (-2806.663) [-2814.777] * (-2810.231) (-2804.911) (-2810.848) [-2811.495] -- 0:02:00
      285000 -- (-2805.548) (-2815.411) (-2809.506) [-2807.333] * (-2807.546) (-2809.020) [-2810.293] (-2810.870) -- 0:02:00

      Average standard deviation of split frequencies: 0.007692

      285500 -- (-2813.170) (-2814.161) [-2812.912] (-2813.646) * (-2804.961) (-2811.548) (-2811.725) [-2806.909] -- 0:02:00
      286000 -- (-2808.333) [-2813.623] (-2808.049) (-2820.808) * (-2808.998) (-2807.302) (-2811.214) [-2806.975] -- 0:01:59
      286500 -- (-2811.523) (-2809.390) [-2810.456] (-2813.840) * (-2808.736) (-2811.240) (-2812.204) [-2808.682] -- 0:01:59
      287000 -- (-2809.293) (-2810.227) (-2808.537) [-2808.333] * [-2807.073] (-2811.260) (-2806.036) (-2807.405) -- 0:01:59
      287500 -- (-2809.690) (-2811.477) [-2810.903] (-2808.727) * (-2814.976) (-2807.352) (-2813.715) [-2810.237] -- 0:01:58
      288000 -- (-2807.774) [-2806.308] (-2808.975) (-2812.452) * (-2810.299) (-2808.876) (-2811.903) [-2808.594] -- 0:01:58
      288500 -- (-2807.467) [-2808.352] (-2807.616) (-2809.061) * [-2813.367] (-2816.622) (-2807.980) (-2810.574) -- 0:01:58
      289000 -- (-2807.678) (-2816.186) [-2811.429] (-2805.113) * (-2807.600) (-2815.233) (-2811.924) [-2809.424] -- 0:02:00
      289500 -- [-2810.784] (-2814.053) (-2809.360) (-2809.234) * (-2820.235) (-2812.026) [-2809.427] (-2811.566) -- 0:02:00
      290000 -- (-2808.973) [-2812.680] (-2808.165) (-2812.188) * (-2811.334) (-2807.355) [-2812.937] (-2815.203) -- 0:01:59

      Average standard deviation of split frequencies: 0.007568

      290500 -- (-2806.589) (-2808.545) (-2812.450) [-2805.300] * (-2810.647) (-2810.378) [-2813.872] (-2807.171) -- 0:01:59
      291000 -- (-2810.613) (-2814.457) [-2806.757] (-2810.972) * (-2810.190) [-2814.900] (-2808.453) (-2816.504) -- 0:01:59
      291500 -- (-2808.432) [-2809.919] (-2808.887) (-2808.634) * (-2812.911) (-2812.142) [-2810.646] (-2812.972) -- 0:01:59
      292000 -- (-2808.518) (-2810.279) (-2809.037) [-2810.572] * (-2810.481) (-2821.479) (-2809.171) [-2804.495] -- 0:01:58
      292500 -- (-2810.190) (-2814.369) (-2813.016) [-2809.469] * [-2815.140] (-2814.721) (-2807.987) (-2807.989) -- 0:01:58
      293000 -- (-2810.562) (-2810.002) [-2814.770] (-2807.471) * (-2809.336) (-2812.650) (-2812.551) [-2812.101] -- 0:01:58
      293500 -- [-2813.607] (-2815.496) (-2809.153) (-2810.679) * (-2807.824) (-2814.525) [-2810.474] (-2809.225) -- 0:01:57
      294000 -- (-2815.514) (-2809.199) [-2809.009] (-2815.002) * (-2806.895) (-2819.185) [-2809.404] (-2813.099) -- 0:01:57
      294500 -- (-2813.711) (-2807.214) (-2810.080) [-2812.018] * [-2806.887] (-2814.213) (-2809.206) (-2819.462) -- 0:01:57
      295000 -- [-2814.068] (-2811.028) (-2813.806) (-2810.550) * (-2809.380) (-2808.747) [-2812.781] (-2815.249) -- 0:01:59

      Average standard deviation of split frequencies: 0.008494

      295500 -- [-2809.519] (-2813.224) (-2807.713) (-2808.527) * (-2816.726) (-2808.726) (-2809.646) [-2811.647] -- 0:01:59
      296000 -- (-2812.079) (-2811.432) (-2810.147) [-2808.233] * (-2815.176) (-2807.675) [-2811.651] (-2807.355) -- 0:01:58
      296500 -- (-2806.481) [-2806.638] (-2808.955) (-2809.251) * (-2818.461) (-2804.217) (-2807.590) [-2810.151] -- 0:01:58
      297000 -- [-2810.036] (-2812.797) (-2810.091) (-2810.511) * (-2808.908) (-2808.198) [-2807.860] (-2808.678) -- 0:01:58
      297500 -- (-2809.747) (-2810.498) (-2814.718) [-2806.394] * (-2809.048) (-2805.441) [-2811.347] (-2807.074) -- 0:01:58
      298000 -- (-2808.328) [-2807.793] (-2810.811) (-2806.786) * (-2806.988) (-2805.602) [-2806.270] (-2823.547) -- 0:01:57
      298500 -- (-2809.444) [-2809.476] (-2811.434) (-2809.975) * (-2808.673) [-2806.140] (-2806.141) (-2806.795) -- 0:01:57
      299000 -- (-2812.408) (-2813.330) (-2808.454) [-2812.063] * (-2811.655) [-2815.161] (-2810.811) (-2809.536) -- 0:01:57
      299500 -- (-2806.348) (-2808.282) (-2819.571) [-2811.052] * [-2807.448] (-2812.361) (-2808.164) (-2807.834) -- 0:01:56
      300000 -- (-2806.049) (-2813.124) (-2810.942) [-2814.262] * (-2810.457) (-2805.089) [-2805.881] (-2810.024) -- 0:01:56

      Average standard deviation of split frequencies: 0.006271

      300500 -- (-2810.001) (-2807.901) (-2815.821) [-2813.486] * (-2812.287) (-2810.194) [-2813.090] (-2817.902) -- 0:01:56
      301000 -- (-2806.980) [-2813.598] (-2808.075) (-2814.632) * [-2808.192] (-2809.577) (-2816.354) (-2807.857) -- 0:01:58
      301500 -- (-2808.186) (-2811.784) (-2812.849) [-2809.966] * [-2810.144] (-2816.509) (-2819.975) (-2807.177) -- 0:01:58
      302000 -- (-2810.894) (-2812.717) (-2807.105) [-2805.418] * (-2812.049) (-2816.512) [-2811.071] (-2808.961) -- 0:01:57
      302500 -- (-2809.289) [-2804.272] (-2811.336) (-2808.645) * (-2813.527) (-2809.483) [-2807.654] (-2807.393) -- 0:01:57
      303000 -- [-2809.487] (-2808.790) (-2810.604) (-2808.994) * (-2814.613) (-2810.942) (-2810.531) [-2810.181] -- 0:01:57
      303500 -- (-2803.858) [-2808.612] (-2809.331) (-2806.672) * [-2811.923] (-2810.469) (-2807.235) (-2809.431) -- 0:01:57
      304000 -- [-2806.824] (-2810.000) (-2812.873) (-2806.894) * (-2812.910) (-2819.960) (-2812.432) [-2808.012] -- 0:01:56
      304500 -- (-2808.909) (-2817.340) [-2808.721] (-2810.247) * (-2809.563) [-2809.105] (-2808.919) (-2810.878) -- 0:01:56
      305000 -- (-2811.363) (-2811.700) [-2806.743] (-2814.851) * (-2810.733) (-2812.806) [-2814.253] (-2808.755) -- 0:01:56

      Average standard deviation of split frequencies: 0.007189

      305500 -- [-2812.569] (-2809.690) (-2807.523) (-2805.466) * (-2810.312) [-2807.095] (-2809.722) (-2807.026) -- 0:01:55
      306000 -- (-2806.148) (-2819.183) (-2810.139) [-2814.541] * (-2812.322) (-2814.876) (-2818.178) [-2809.674] -- 0:01:55
      306500 -- (-2811.495) (-2813.032) (-2809.292) [-2808.771] * (-2810.951) (-2805.873) (-2817.373) [-2809.567] -- 0:01:55
      307000 -- (-2809.734) (-2823.085) (-2806.863) [-2804.804] * (-2807.701) (-2815.304) [-2813.519] (-2808.982) -- 0:01:57
      307500 -- (-2806.215) (-2820.669) [-2815.038] (-2806.431) * (-2814.205) (-2812.575) (-2806.070) [-2807.007] -- 0:01:57
      308000 -- (-2811.188) [-2813.695] (-2807.364) (-2804.559) * (-2820.309) [-2810.578] (-2817.101) (-2807.368) -- 0:01:56
      308500 -- (-2807.981) (-2812.816) [-2810.594] (-2812.801) * (-2808.382) (-2811.934) [-2807.918] (-2807.345) -- 0:01:56
      309000 -- [-2805.393] (-2810.113) (-2808.693) (-2821.987) * (-2808.011) (-2812.808) (-2806.834) [-2806.545] -- 0:01:56
      309500 -- (-2810.031) (-2806.775) (-2807.896) [-2809.614] * (-2807.564) [-2809.769] (-2812.518) (-2810.100) -- 0:01:56
      310000 -- (-2809.168) (-2809.491) [-2807.654] (-2810.093) * (-2811.491) (-2816.000) (-2818.390) [-2806.669] -- 0:01:55

      Average standard deviation of split frequencies: 0.009104

      310500 -- (-2809.900) (-2809.818) [-2810.806] (-2814.145) * [-2810.579] (-2811.051) (-2810.369) (-2811.635) -- 0:01:55
      311000 -- [-2809.350] (-2807.512) (-2806.327) (-2804.310) * (-2807.846) (-2814.305) (-2814.948) [-2811.383] -- 0:01:55
      311500 -- [-2809.786] (-2808.967) (-2808.453) (-2817.807) * [-2806.922] (-2811.139) (-2807.193) (-2808.252) -- 0:01:54
      312000 -- (-2810.555) (-2807.857) (-2807.547) [-2810.480] * (-2806.881) (-2810.839) (-2813.803) [-2810.079] -- 0:01:54
      312500 -- (-2811.521) (-2807.951) [-2815.259] (-2805.684) * (-2811.610) (-2813.093) (-2813.975) [-2806.908] -- 0:01:54
      313000 -- (-2807.576) [-2810.908] (-2814.904) (-2812.561) * [-2809.963] (-2809.854) (-2819.495) (-2813.770) -- 0:01:56
      313500 -- (-2810.740) (-2824.408) (-2809.142) [-2807.169] * [-2806.759] (-2808.027) (-2812.034) (-2812.283) -- 0:01:56
      314000 -- (-2807.848) (-2808.318) (-2809.548) [-2812.927] * [-2806.793] (-2811.233) (-2814.398) (-2807.271) -- 0:01:55
      314500 -- (-2814.609) (-2818.320) [-2812.471] (-2807.651) * (-2807.647) [-2802.708] (-2811.695) (-2812.937) -- 0:01:55
      315000 -- (-2814.695) [-2810.087] (-2809.345) (-2813.133) * [-2807.108] (-2807.422) (-2809.669) (-2808.586) -- 0:01:55

      Average standard deviation of split frequencies: 0.007956

      315500 -- (-2816.059) [-2809.337] (-2813.815) (-2811.456) * (-2811.650) (-2807.167) (-2819.577) [-2806.713] -- 0:01:54
      316000 -- [-2810.293] (-2812.720) (-2810.108) (-2806.962) * (-2805.825) [-2806.089] (-2814.578) (-2818.129) -- 0:01:54
      316500 -- [-2806.466] (-2813.606) (-2813.603) (-2810.251) * [-2808.036] (-2811.319) (-2813.604) (-2814.240) -- 0:01:54
      317000 -- (-2806.653) (-2815.906) [-2806.155] (-2807.843) * (-2812.709) [-2810.272] (-2811.366) (-2816.712) -- 0:01:54
      317500 -- [-2808.831] (-2812.549) (-2814.158) (-2809.857) * (-2811.650) [-2809.173] (-2817.284) (-2816.699) -- 0:01:53
      318000 -- (-2812.229) (-2815.359) (-2814.486) [-2804.953] * (-2808.721) [-2805.845] (-2808.691) (-2806.740) -- 0:01:53
      318500 -- (-2809.450) (-2811.854) (-2809.505) [-2806.398] * (-2810.997) [-2809.421] (-2809.315) (-2811.413) -- 0:01:53
      319000 -- [-2810.771] (-2816.435) (-2806.642) (-2810.864) * (-2810.815) [-2810.286] (-2813.136) (-2816.722) -- 0:01:55
      319500 -- [-2805.573] (-2816.484) (-2811.219) (-2810.981) * (-2808.183) (-2811.148) (-2807.439) [-2811.196] -- 0:01:55
      320000 -- (-2814.590) (-2813.513) [-2808.449] (-2815.720) * (-2812.438) (-2811.696) (-2808.130) [-2809.162] -- 0:01:54

      Average standard deviation of split frequencies: 0.007840

      320500 -- (-2806.618) [-2806.110] (-2815.739) (-2812.914) * (-2807.462) [-2810.233] (-2809.302) (-2818.468) -- 0:01:54
      321000 -- (-2812.429) (-2810.046) [-2814.163] (-2813.402) * [-2804.057] (-2806.057) (-2810.709) (-2816.496) -- 0:01:54
      321500 -- (-2806.724) (-2814.411) (-2814.632) [-2814.948] * (-2815.677) (-2806.267) [-2806.243] (-2820.217) -- 0:01:53
      322000 -- (-2815.131) (-2813.364) (-2808.998) [-2807.036] * (-2806.950) (-2813.493) [-2808.480] (-2814.966) -- 0:01:53
      322500 -- (-2816.153) (-2803.881) (-2816.627) [-2811.803] * (-2809.274) [-2815.695] (-2813.774) (-2812.266) -- 0:01:53
      323000 -- [-2809.096] (-2813.435) (-2813.379) (-2809.583) * (-2815.182) (-2811.066) (-2809.636) [-2809.502] -- 0:01:53
      323500 -- (-2810.733) (-2810.350) (-2814.157) [-2808.075] * (-2809.200) (-2814.415) (-2807.700) [-2811.501] -- 0:01:52
      324000 -- (-2811.120) (-2804.726) (-2811.793) [-2810.779] * [-2807.107] (-2812.440) (-2816.110) (-2817.906) -- 0:01:52
      324500 -- [-2815.080] (-2807.959) (-2812.613) (-2808.839) * [-2809.151] (-2806.051) (-2816.852) (-2810.584) -- 0:01:54
      325000 -- (-2813.381) (-2806.088) [-2807.428] (-2809.536) * [-2814.101] (-2809.481) (-2811.939) (-2808.186) -- 0:01:54

      Average standard deviation of split frequencies: 0.010604

      325500 -- (-2809.239) [-2811.735] (-2815.794) (-2813.430) * (-2808.698) (-2816.994) (-2817.155) [-2811.110] -- 0:01:53
      326000 -- (-2806.312) (-2806.666) [-2810.240] (-2806.961) * [-2808.992] (-2810.515) (-2818.232) (-2808.462) -- 0:01:53
      326500 -- (-2812.675) (-2804.924) (-2813.865) [-2804.256] * (-2810.117) [-2809.214] (-2815.874) (-2811.315) -- 0:01:53
      327000 -- [-2807.336] (-2814.091) (-2810.760) (-2810.901) * (-2808.768) [-2808.003] (-2805.219) (-2812.828) -- 0:01:53
      327500 -- (-2816.152) [-2805.650] (-2806.568) (-2817.273) * (-2810.621) (-2807.857) (-2804.949) [-2808.441] -- 0:01:52
      328000 -- (-2810.416) (-2807.197) [-2805.063] (-2812.603) * [-2808.054] (-2811.036) (-2811.484) (-2809.422) -- 0:01:52
      328500 -- [-2819.540] (-2807.667) (-2809.170) (-2808.892) * (-2807.658) (-2812.638) (-2814.301) [-2804.450] -- 0:01:52
      329000 -- (-2813.430) (-2810.617) [-2806.706] (-2814.486) * (-2806.126) (-2811.792) (-2813.113) [-2805.984] -- 0:01:52
      329500 -- (-2813.509) (-2808.709) (-2808.310) [-2812.735] * (-2804.089) (-2812.607) (-2814.356) [-2807.575] -- 0:01:51
      330000 -- (-2810.373) (-2812.564) [-2812.537] (-2806.804) * (-2804.924) (-2813.086) (-2816.639) [-2808.342] -- 0:01:51

      Average standard deviation of split frequencies: 0.012355

      330500 -- [-2808.320] (-2811.322) (-2813.350) (-2815.701) * [-2810.793] (-2811.149) (-2812.942) (-2807.396) -- 0:01:53
      331000 -- (-2809.441) (-2806.351) (-2817.520) [-2805.085] * (-2806.724) (-2811.768) [-2814.354] (-2809.517) -- 0:01:53
      331500 -- (-2813.075) [-2809.217] (-2806.287) (-2806.170) * [-2811.032] (-2814.408) (-2802.989) (-2809.916) -- 0:01:52
      332000 -- [-2810.211] (-2810.603) (-2807.340) (-2813.279) * (-2813.867) (-2807.019) (-2808.493) [-2810.284] -- 0:01:52
      332500 -- (-2810.159) (-2810.965) (-2809.519) [-2808.537] * (-2807.822) [-2808.130] (-2814.605) (-2809.842) -- 0:01:52
      333000 -- (-2811.444) (-2809.396) (-2811.540) [-2809.930] * (-2813.072) (-2809.261) [-2807.387] (-2810.302) -- 0:01:52
      333500 -- [-2804.927] (-2807.218) (-2809.145) (-2811.672) * (-2807.711) [-2809.031] (-2810.409) (-2810.151) -- 0:01:51
      334000 -- (-2809.945) [-2810.879] (-2811.818) (-2806.329) * (-2808.357) [-2810.093] (-2804.677) (-2813.760) -- 0:01:51
      334500 -- (-2816.031) (-2811.086) [-2808.408] (-2811.376) * (-2813.444) (-2814.221) [-2808.360] (-2810.472) -- 0:01:51
      335000 -- (-2810.119) (-2805.935) [-2809.617] (-2807.955) * (-2811.200) (-2809.059) (-2806.182) [-2807.439] -- 0:01:51

      Average standard deviation of split frequencies: 0.010289

      335500 -- (-2826.005) (-2806.379) (-2811.093) [-2813.528] * (-2816.343) (-2810.139) [-2810.303] (-2811.655) -- 0:01:50
      336000 -- (-2815.161) (-2808.818) [-2807.163] (-2810.317) * (-2811.483) (-2808.186) (-2809.765) [-2806.598] -- 0:01:50
      336500 -- (-2809.857) (-2807.100) [-2814.241] (-2815.611) * (-2815.195) (-2808.771) (-2810.223) [-2807.647] -- 0:01:52
      337000 -- [-2810.565] (-2808.104) (-2814.171) (-2813.756) * [-2812.422] (-2806.668) (-2810.142) (-2808.030) -- 0:01:52
      337500 -- (-2807.032) [-2807.908] (-2810.100) (-2807.385) * [-2806.089] (-2812.479) (-2810.377) (-2808.002) -- 0:01:51
      338000 -- (-2810.330) (-2819.211) [-2809.549] (-2806.994) * (-2808.973) (-2812.212) (-2804.696) [-2811.822] -- 0:01:51
      338500 -- (-2811.419) [-2805.539] (-2808.204) (-2812.785) * [-2808.526] (-2809.498) (-2808.774) (-2809.765) -- 0:01:51
      339000 -- (-2815.177) (-2806.707) [-2804.952] (-2811.883) * (-2809.009) (-2814.373) (-2812.258) [-2807.649] -- 0:01:51
      339500 -- (-2814.120) (-2808.917) [-2810.586] (-2809.748) * (-2809.997) (-2812.263) (-2809.464) [-2805.194] -- 0:01:50
      340000 -- (-2809.372) [-2809.316] (-2821.405) (-2810.091) * (-2813.829) (-2811.250) (-2811.884) [-2814.805] -- 0:01:50

      Average standard deviation of split frequencies: 0.010148

      340500 -- [-2812.089] (-2808.826) (-2815.197) (-2810.174) * [-2810.517] (-2806.081) (-2810.444) (-2814.442) -- 0:01:50
      341000 -- (-2813.125) (-2807.847) (-2810.561) [-2805.990] * (-2810.952) [-2807.472] (-2808.358) (-2813.929) -- 0:01:50
      341500 -- (-2817.424) [-2806.234] (-2809.911) (-2811.771) * (-2806.998) (-2811.188) (-2810.578) [-2809.975] -- 0:01:49
      342000 -- (-2810.811) (-2812.042) [-2808.323] (-2811.715) * (-2812.738) (-2817.158) (-2813.025) [-2808.863] -- 0:01:49
      342500 -- [-2807.124] (-2807.444) (-2806.616) (-2811.928) * (-2810.002) [-2807.138] (-2804.584) (-2811.307) -- 0:01:51
      343000 -- (-2812.663) (-2804.466) [-2813.464] (-2809.280) * (-2807.979) (-2816.404) [-2808.796] (-2807.596) -- 0:01:51
      343500 -- (-2809.045) (-2806.385) [-2806.187] (-2810.337) * [-2808.466] (-2816.945) (-2809.431) (-2812.191) -- 0:01:50
      344000 -- [-2811.579] (-2809.723) (-2807.610) (-2812.307) * (-2817.211) [-2813.892] (-2804.456) (-2813.211) -- 0:01:50
      344500 -- (-2807.937) (-2806.911) (-2808.732) [-2810.099] * [-2809.375] (-2815.054) (-2814.229) (-2811.883) -- 0:01:50
      345000 -- (-2810.184) (-2807.387) [-2809.106] (-2815.966) * [-2811.831] (-2810.282) (-2811.117) (-2808.083) -- 0:01:50

      Average standard deviation of split frequencies: 0.009991

      345500 -- [-2807.881] (-2808.021) (-2810.407) (-2817.901) * (-2812.572) [-2809.819] (-2804.756) (-2808.928) -- 0:01:49
      346000 -- [-2817.468] (-2813.128) (-2809.613) (-2819.481) * (-2811.215) [-2807.134] (-2807.318) (-2806.819) -- 0:01:49
      346500 -- (-2809.951) [-2806.776] (-2809.984) (-2816.268) * [-2807.210] (-2806.346) (-2805.129) (-2811.233) -- 0:01:49
      347000 -- [-2814.647] (-2810.731) (-2815.929) (-2809.756) * (-2809.153) (-2811.466) [-2812.931] (-2812.110) -- 0:01:49
      347500 -- (-2808.406) (-2819.136) [-2809.000] (-2809.335) * (-2806.951) [-2807.245] (-2814.718) (-2809.061) -- 0:01:48
      348000 -- (-2814.035) (-2813.774) (-2808.884) [-2818.854] * (-2805.762) (-2815.991) [-2808.741] (-2809.420) -- 0:01:48
      348500 -- (-2811.913) (-2812.181) (-2807.498) [-2815.453] * (-2805.990) (-2817.382) [-2805.617] (-2817.027) -- 0:01:50
      349000 -- (-2808.756) (-2807.007) [-2809.263] (-2809.712) * (-2811.143) [-2820.119] (-2807.728) (-2803.949) -- 0:01:50
      349500 -- [-2806.368] (-2811.036) (-2806.597) (-2814.756) * (-2805.842) (-2813.785) [-2809.299] (-2812.015) -- 0:01:49
      350000 -- (-2818.630) [-2808.731] (-2807.086) (-2811.059) * (-2809.553) (-2809.928) [-2808.532] (-2808.299) -- 0:01:49

      Average standard deviation of split frequencies: 0.008962

      350500 -- [-2812.377] (-2808.777) (-2808.147) (-2812.007) * [-2807.561] (-2813.240) (-2806.954) (-2809.657) -- 0:01:49
      351000 -- [-2807.169] (-2808.881) (-2811.515) (-2813.964) * (-2810.095) (-2812.612) [-2815.184] (-2813.225) -- 0:01:49
      351500 -- [-2809.792] (-2810.121) (-2815.986) (-2814.886) * (-2814.667) (-2813.961) [-2807.929] (-2811.599) -- 0:01:48
      352000 -- [-2805.121] (-2811.300) (-2815.257) (-2811.772) * (-2816.255) [-2807.942] (-2817.019) (-2811.914) -- 0:01:48
      352500 -- (-2816.157) (-2812.418) (-2814.305) [-2809.173] * (-2809.467) [-2809.812] (-2809.425) (-2812.874) -- 0:01:48
      353000 -- [-2805.884] (-2816.713) (-2812.444) (-2810.002) * [-2804.199] (-2814.820) (-2815.502) (-2810.222) -- 0:01:48
      353500 -- [-2809.176] (-2815.817) (-2812.498) (-2809.515) * (-2815.716) (-2810.016) (-2813.144) [-2806.252] -- 0:01:47
      354000 -- (-2808.685) [-2806.131] (-2808.824) (-2812.641) * (-2811.811) [-2810.890] (-2813.279) (-2811.160) -- 0:01:47
      354500 -- (-2818.334) (-2811.801) [-2816.492] (-2814.183) * (-2810.240) (-2811.893) [-2811.229] (-2812.667) -- 0:01:49
      355000 -- [-2810.118] (-2807.423) (-2804.025) (-2815.493) * (-2816.174) [-2809.801] (-2807.122) (-2810.251) -- 0:01:49

      Average standard deviation of split frequencies: 0.009711

      355500 -- (-2807.054) (-2813.944) (-2810.955) [-2811.873] * [-2812.175] (-2810.971) (-2812.619) (-2806.992) -- 0:01:48
      356000 -- (-2807.833) (-2812.525) [-2812.068] (-2813.909) * (-2810.681) (-2811.701) (-2813.636) [-2813.684] -- 0:01:48
      356500 -- (-2809.167) (-2814.929) (-2809.304) [-2809.110] * (-2814.317) (-2817.617) (-2812.158) [-2808.825] -- 0:01:48
      357000 -- (-2809.552) (-2808.379) (-2807.888) [-2808.962] * (-2808.841) [-2807.859] (-2809.874) (-2816.203) -- 0:01:48
      357500 -- (-2817.848) [-2807.015] (-2806.454) (-2811.687) * (-2809.592) (-2809.942) (-2806.444) [-2813.138] -- 0:01:47
      358000 -- (-2810.671) (-2817.131) [-2806.276] (-2805.706) * (-2811.854) (-2804.968) [-2806.148] (-2806.132) -- 0:01:47
      358500 -- (-2808.883) (-2805.207) [-2814.467] (-2812.347) * [-2811.963] (-2806.492) (-2805.072) (-2815.465) -- 0:01:47
      359000 -- [-2810.407] (-2809.853) (-2811.608) (-2808.698) * (-2809.658) (-2811.466) [-2809.431] (-2807.411) -- 0:01:47
      359500 -- (-2806.318) (-2812.213) (-2807.123) [-2807.490] * (-2817.835) (-2811.255) (-2810.931) [-2806.760] -- 0:01:46
      360000 -- (-2807.855) (-2815.089) (-2813.481) [-2803.024] * [-2812.393] (-2809.966) (-2810.054) (-2811.876) -- 0:01:46

      Average standard deviation of split frequencies: 0.011328

      360500 -- (-2806.388) [-2810.235] (-2807.910) (-2808.149) * (-2814.433) [-2812.516] (-2815.048) (-2809.962) -- 0:01:48
      361000 -- (-2806.356) [-2810.081] (-2805.502) (-2809.748) * (-2816.026) (-2804.854) [-2804.325] (-2806.448) -- 0:01:47
      361500 -- (-2810.517) [-2808.801] (-2806.178) (-2816.709) * [-2808.599] (-2809.157) (-2808.052) (-2809.178) -- 0:01:47
      362000 -- (-2809.867) (-2812.091) (-2808.972) [-2807.163] * (-2812.030) (-2814.439) (-2813.294) [-2812.599] -- 0:01:47
      362500 -- (-2814.919) (-2808.974) (-2811.731) [-2808.502] * [-2808.426] (-2812.656) (-2813.490) (-2810.134) -- 0:01:47
      363000 -- (-2814.974) (-2807.892) [-2811.654] (-2811.407) * (-2809.330) [-2809.749] (-2812.250) (-2809.841) -- 0:01:47
      363500 -- (-2806.904) [-2811.589] (-2810.084) (-2817.766) * (-2807.365) (-2809.348) (-2811.526) [-2812.084] -- 0:01:46
      364000 -- (-2809.993) (-2815.171) [-2811.847] (-2813.119) * (-2805.192) [-2805.919] (-2809.621) (-2813.886) -- 0:01:46
      364500 -- (-2811.359) (-2811.745) (-2810.468) [-2815.432] * (-2809.923) (-2809.391) [-2808.470] (-2813.312) -- 0:01:46
      365000 -- [-2803.714] (-2813.908) (-2810.487) (-2808.114) * (-2816.920) (-2807.392) (-2811.802) [-2814.854] -- 0:01:46

      Average standard deviation of split frequencies: 0.012880

      365500 -- (-2808.478) (-2811.107) [-2813.149] (-2810.008) * [-2811.415] (-2808.605) (-2804.924) (-2816.289) -- 0:01:45
      366000 -- (-2810.168) [-2807.101] (-2818.552) (-2815.491) * (-2808.867) (-2810.978) [-2807.132] (-2810.213) -- 0:01:45
      366500 -- (-2813.227) (-2808.823) (-2816.712) [-2810.514] * [-2812.580] (-2806.131) (-2808.840) (-2809.335) -- 0:01:47
      367000 -- (-2812.456) [-2813.814] (-2812.231) (-2811.874) * (-2815.037) [-2809.420] (-2815.076) (-2812.389) -- 0:01:46
      367500 -- (-2808.743) [-2812.380] (-2806.609) (-2810.919) * [-2814.309] (-2810.384) (-2813.098) (-2815.390) -- 0:01:46
      368000 -- (-2811.856) (-2811.920) [-2807.814] (-2816.897) * (-2816.501) (-2818.733) (-2810.066) [-2811.622] -- 0:01:46
      368500 -- (-2811.415) (-2807.910) (-2814.885) [-2814.246] * (-2813.748) (-2811.230) [-2816.177] (-2807.807) -- 0:01:46
      369000 -- (-2811.603) (-2813.879) [-2821.298] (-2815.311) * (-2807.680) (-2814.769) [-2807.489] (-2810.303) -- 0:01:46
      369500 -- (-2812.487) (-2822.792) (-2807.305) [-2809.979] * (-2804.456) (-2811.844) [-2808.792] (-2809.079) -- 0:01:45
      370000 -- (-2808.930) (-2816.890) [-2806.383] (-2808.629) * (-2808.513) (-2806.956) [-2811.348] (-2807.618) -- 0:01:45

      Average standard deviation of split frequencies: 0.011870

      370500 -- [-2804.806] (-2806.559) (-2810.248) (-2811.570) * (-2813.126) (-2810.618) [-2809.800] (-2807.827) -- 0:01:45
      371000 -- (-2807.521) (-2812.774) (-2811.913) [-2812.057] * (-2810.664) (-2812.437) (-2813.416) [-2811.752] -- 0:01:45
      371500 -- (-2804.755) [-2810.828] (-2804.945) (-2816.241) * (-2809.648) [-2807.099] (-2808.939) (-2811.255) -- 0:01:44
      372000 -- (-2807.951) (-2817.032) (-2807.936) [-2809.942] * [-2813.221] (-2809.666) (-2810.547) (-2814.752) -- 0:01:44
      372500 -- (-2811.201) (-2809.611) [-2811.118] (-2808.419) * (-2806.450) (-2807.644) [-2807.932] (-2807.339) -- 0:01:46
      373000 -- (-2809.251) (-2808.661) (-2813.658) [-2813.825] * [-2808.170] (-2810.057) (-2807.040) (-2809.039) -- 0:01:45
      373500 -- (-2812.822) (-2812.512) [-2809.720] (-2809.690) * [-2807.011] (-2811.098) (-2807.550) (-2815.121) -- 0:01:45
      374000 -- [-2811.419] (-2813.764) (-2810.887) (-2806.868) * (-2804.481) (-2806.230) (-2811.966) [-2805.892] -- 0:01:45
      374500 -- (-2807.255) (-2810.127) (-2809.106) [-2808.067] * (-2811.742) [-2808.299] (-2806.320) (-2810.502) -- 0:01:45
      375000 -- [-2807.371] (-2813.288) (-2812.275) (-2810.702) * [-2808.697] (-2814.008) (-2810.584) (-2812.172) -- 0:01:45

      Average standard deviation of split frequencies: 0.015045

      375500 -- (-2804.831) [-2810.680] (-2808.923) (-2811.271) * (-2807.344) [-2810.910] (-2811.855) (-2810.491) -- 0:01:44
      376000 -- (-2806.798) [-2815.550] (-2813.840) (-2812.958) * (-2805.328) [-2806.904] (-2810.420) (-2813.025) -- 0:01:44
      376500 -- (-2813.021) (-2809.427) (-2808.316) [-2807.674] * (-2805.925) (-2811.167) [-2810.352] (-2818.169) -- 0:01:44
      377000 -- [-2815.536] (-2807.774) (-2813.784) (-2809.194) * [-2809.711] (-2807.484) (-2806.537) (-2809.962) -- 0:01:44
      377500 -- (-2815.036) [-2807.715] (-2810.032) (-2812.008) * (-2810.173) (-2810.133) (-2806.249) [-2805.713] -- 0:01:43
      378000 -- (-2815.044) (-2806.934) [-2806.751] (-2811.554) * (-2810.546) (-2808.836) [-2805.710] (-2811.882) -- 0:01:43
      378500 -- (-2805.692) (-2814.866) (-2814.374) [-2814.018] * (-2810.305) [-2805.393] (-2807.090) (-2808.791) -- 0:01:45
      379000 -- [-2807.792] (-2811.687) (-2804.870) (-2809.488) * [-2814.165] (-2811.449) (-2813.723) (-2808.013) -- 0:01:44
      379500 -- (-2810.214) (-2810.946) (-2807.945) [-2806.071] * (-2817.446) [-2805.614] (-2814.024) (-2814.743) -- 0:01:44
      380000 -- (-2816.584) [-2810.362] (-2809.743) (-2805.346) * (-2813.870) (-2812.344) [-2810.568] (-2808.543) -- 0:01:44

      Average standard deviation of split frequencies: 0.016512

      380500 -- [-2811.545] (-2810.999) (-2809.009) (-2807.138) * (-2811.807) (-2810.354) (-2809.142) [-2807.190] -- 0:01:44
      381000 -- (-2814.214) (-2811.492) (-2812.085) [-2805.941] * (-2811.386) [-2810.507] (-2810.950) (-2808.305) -- 0:01:43
      381500 -- (-2810.365) (-2813.855) [-2812.286] (-2807.866) * (-2810.195) (-2806.600) (-2811.404) [-2808.593] -- 0:01:43
      382000 -- [-2810.144] (-2806.730) (-2811.436) (-2808.873) * [-2806.422] (-2809.847) (-2812.388) (-2813.203) -- 0:01:43
      382500 -- (-2812.091) (-2811.308) [-2814.093] (-2809.245) * (-2809.439) (-2805.832) (-2814.317) [-2811.833] -- 0:01:43
      383000 -- (-2808.294) (-2811.022) (-2812.503) [-2807.000] * [-2808.616] (-2813.012) (-2808.580) (-2814.169) -- 0:01:43
      383500 -- (-2812.852) (-2809.681) [-2811.768] (-2805.980) * [-2804.156] (-2810.526) (-2812.922) (-2808.980) -- 0:01:42
      384000 -- [-2813.416] (-2804.094) (-2819.805) (-2815.618) * [-2808.881] (-2807.151) (-2815.314) (-2809.465) -- 0:01:42
      384500 -- (-2815.806) (-2813.555) [-2809.835] (-2815.147) * (-2813.923) (-2813.243) [-2805.612] (-2812.051) -- 0:01:44
      385000 -- (-2814.385) (-2809.372) [-2814.167] (-2816.317) * (-2821.343) (-2814.137) [-2810.392] (-2806.410) -- 0:01:43

      Average standard deviation of split frequencies: 0.017912

      385500 -- (-2809.039) (-2806.714) (-2814.675) [-2809.882] * (-2811.285) (-2809.135) [-2807.903] (-2805.045) -- 0:01:43
      386000 -- [-2810.810] (-2808.733) (-2812.589) (-2809.575) * [-2809.577] (-2810.377) (-2811.889) (-2810.604) -- 0:01:43
      386500 -- [-2812.945] (-2813.736) (-2810.202) (-2810.718) * (-2814.408) (-2808.933) [-2814.211] (-2814.070) -- 0:01:43
      387000 -- (-2810.034) (-2807.048) (-2811.702) [-2806.183] * [-2811.693] (-2810.413) (-2811.199) (-2812.164) -- 0:01:42
      387500 -- [-2805.837] (-2808.277) (-2807.759) (-2808.575) * [-2810.138] (-2810.788) (-2810.820) (-2811.870) -- 0:01:42
      388000 -- (-2813.695) (-2807.176) (-2811.156) [-2808.927] * [-2807.797] (-2815.812) (-2811.001) (-2813.373) -- 0:01:42
      388500 -- [-2808.525] (-2808.540) (-2809.152) (-2806.283) * (-2806.043) [-2815.902] (-2811.971) (-2808.744) -- 0:01:42
      389000 -- [-2811.739] (-2812.742) (-2814.071) (-2810.400) * (-2807.547) (-2814.758) [-2811.100] (-2808.150) -- 0:01:42
      389500 -- (-2809.945) [-2805.873] (-2809.909) (-2810.118) * (-2808.005) (-2808.670) (-2810.653) [-2809.203] -- 0:01:41
      390000 -- (-2808.268) (-2811.115) [-2805.204] (-2810.377) * [-2807.769] (-2811.080) (-2809.264) (-2807.768) -- 0:01:41

      Average standard deviation of split frequencies: 0.015284

      390500 -- (-2810.843) (-2810.922) (-2811.664) [-2809.000] * (-2812.147) [-2809.095] (-2814.878) (-2818.301) -- 0:01:43
      391000 -- (-2811.894) (-2806.520) (-2806.234) [-2810.633] * [-2808.236] (-2813.733) (-2817.344) (-2809.060) -- 0:01:42
      391500 -- [-2806.449] (-2807.526) (-2807.769) (-2815.831) * [-2815.461] (-2809.712) (-2809.997) (-2808.756) -- 0:01:42
      392000 -- (-2814.141) (-2811.158) [-2811.244] (-2812.045) * (-2809.143) (-2811.967) (-2810.437) [-2806.746] -- 0:01:42
      392500 -- (-2809.221) (-2809.492) [-2806.442] (-2807.615) * (-2816.118) (-2806.950) (-2810.607) [-2807.644] -- 0:01:42
      393000 -- (-2821.398) (-2812.194) (-2812.796) [-2807.201] * (-2808.751) (-2813.704) (-2808.469) [-2806.094] -- 0:01:41
      393500 -- [-2804.030] (-2810.516) (-2810.491) (-2810.739) * (-2808.778) (-2812.556) [-2806.097] (-2806.064) -- 0:01:41
      394000 -- (-2808.512) (-2809.983) [-2814.525] (-2809.703) * (-2806.009) (-2814.967) (-2808.302) [-2805.234] -- 0:01:41
      394500 -- (-2815.041) (-2809.938) (-2810.796) [-2805.733] * [-2809.707] (-2816.649) (-2806.285) (-2808.396) -- 0:01:41
      395000 -- (-2811.757) (-2810.405) [-2814.869] (-2808.068) * (-2813.126) (-2813.698) (-2812.015) [-2812.678] -- 0:01:41

      Average standard deviation of split frequencies: 0.015872

      395500 -- (-2813.635) (-2811.358) [-2815.981] (-2811.040) * (-2819.471) (-2810.907) [-2814.195] (-2811.212) -- 0:01:40
      396000 -- (-2811.445) (-2813.688) (-2815.549) [-2807.569] * (-2826.632) [-2809.918] (-2812.717) (-2808.080) -- 0:01:40
      396500 -- [-2808.676] (-2805.845) (-2807.901) (-2806.097) * (-2815.826) [-2810.851] (-2808.494) (-2811.178) -- 0:01:41
      397000 -- (-2808.563) (-2814.171) (-2808.809) [-2807.810] * (-2812.158) (-2810.316) (-2806.656) [-2809.228] -- 0:01:41
      397500 -- [-2806.553] (-2807.582) (-2807.130) (-2810.033) * [-2812.822] (-2813.844) (-2811.664) (-2810.628) -- 0:01:41
      398000 -- (-2810.168) (-2814.018) [-2803.992] (-2811.979) * (-2806.568) [-2807.307] (-2812.980) (-2807.524) -- 0:01:41
      398500 -- [-2810.543] (-2811.698) (-2806.058) (-2809.192) * [-2810.341] (-2809.660) (-2811.678) (-2806.135) -- 0:01:41
      399000 -- (-2813.405) (-2817.144) [-2809.138] (-2811.541) * (-2810.588) [-2808.473] (-2813.209) (-2810.891) -- 0:01:40
      399500 -- (-2809.685) [-2809.450] (-2812.442) (-2817.494) * (-2811.933) [-2804.298] (-2812.921) (-2808.007) -- 0:01:40
      400000 -- (-2809.901) [-2809.753] (-2815.602) (-2812.675) * [-2811.266] (-2809.379) (-2813.855) (-2806.790) -- 0:01:40

      Average standard deviation of split frequencies: 0.017256

      400500 -- [-2811.102] (-2814.603) (-2808.952) (-2818.120) * (-2807.607) (-2808.953) [-2806.805] (-2805.246) -- 0:01:40
      401000 -- [-2815.109] (-2805.520) (-2814.529) (-2810.611) * (-2806.696) [-2808.363] (-2806.779) (-2809.233) -- 0:01:40
      401500 -- (-2821.607) (-2812.818) (-2808.089) [-2805.972] * (-2806.141) (-2813.937) [-2805.882] (-2813.629) -- 0:01:39
      402000 -- (-2814.548) (-2808.495) [-2808.898] (-2811.071) * (-2810.684) (-2806.191) [-2804.863] (-2811.243) -- 0:01:39
      402500 -- (-2817.009) (-2808.399) (-2807.754) [-2805.702] * (-2808.845) (-2811.374) [-2804.716] (-2809.906) -- 0:01:40
      403000 -- [-2806.855] (-2809.872) (-2809.388) (-2809.722) * (-2804.938) [-2810.685] (-2808.401) (-2809.879) -- 0:01:40
      403500 -- [-2811.655] (-2812.701) (-2805.606) (-2807.236) * (-2812.283) [-2808.486] (-2808.402) (-2803.702) -- 0:01:40
      404000 -- [-2808.073] (-2814.829) (-2812.867) (-2815.463) * (-2815.286) (-2812.299) (-2818.793) [-2811.464] -- 0:01:40
      404500 -- [-2818.741] (-2808.215) (-2814.960) (-2810.390) * [-2810.792] (-2809.559) (-2813.146) (-2806.617) -- 0:01:40
      405000 -- (-2816.702) [-2809.022] (-2818.804) (-2817.211) * (-2815.654) (-2813.448) (-2806.250) [-2813.480] -- 0:01:39

      Average standard deviation of split frequencies: 0.019352

      405500 -- (-2814.218) [-2806.354] (-2814.582) (-2806.485) * (-2813.918) (-2818.950) [-2808.753] (-2811.189) -- 0:01:39
      406000 -- (-2812.344) (-2811.124) [-2815.437] (-2812.294) * [-2806.701] (-2816.405) (-2807.524) (-2817.812) -- 0:01:39
      406500 -- (-2812.063) [-2812.806] (-2808.750) (-2813.941) * [-2805.662] (-2814.455) (-2813.363) (-2808.124) -- 0:01:39
      407000 -- (-2819.476) [-2806.009] (-2808.772) (-2814.048) * (-2807.675) (-2807.284) (-2810.076) [-2805.648] -- 0:01:39
      407500 -- (-2809.086) [-2812.441] (-2814.572) (-2813.750) * (-2810.362) (-2814.590) (-2813.000) [-2804.278] -- 0:01:38
      408000 -- (-2812.378) (-2809.145) [-2814.445] (-2808.727) * [-2807.412] (-2808.901) (-2822.792) (-2809.640) -- 0:01:40
      408500 -- [-2809.504] (-2808.714) (-2814.377) (-2815.805) * (-2813.934) (-2815.079) (-2804.785) [-2808.261] -- 0:01:39
      409000 -- (-2807.255) (-2804.926) (-2810.052) [-2809.536] * (-2820.727) (-2809.606) (-2805.453) [-2806.235] -- 0:01:39
      409500 -- (-2806.301) (-2808.733) (-2808.947) [-2807.672] * (-2823.341) (-2811.117) [-2809.533] (-2811.084) -- 0:01:39
      410000 -- (-2809.370) (-2806.664) (-2814.447) [-2812.397] * (-2819.235) [-2812.922] (-2805.960) (-2808.441) -- 0:01:39

      Average standard deviation of split frequencies: 0.022958

      410500 -- [-2807.852] (-2811.652) (-2813.853) (-2810.957) * (-2808.860) (-2812.309) (-2808.164) [-2815.383] -- 0:01:39
      411000 -- (-2806.652) (-2807.540) [-2806.678] (-2810.132) * [-2807.015] (-2809.222) (-2810.218) (-2813.062) -- 0:01:38
      411500 -- (-2804.996) (-2813.087) [-2814.928] (-2815.541) * [-2806.384] (-2812.283) (-2818.016) (-2809.703) -- 0:01:38
      412000 -- [-2806.291] (-2817.002) (-2811.382) (-2823.866) * (-2808.489) (-2812.161) [-2806.803] (-2804.943) -- 0:01:38
      412500 -- (-2808.562) (-2816.653) (-2809.577) [-2806.598] * (-2807.160) [-2817.416] (-2815.960) (-2810.045) -- 0:01:38
      413000 -- (-2814.422) [-2810.363] (-2809.310) (-2816.080) * [-2809.256] (-2817.223) (-2813.237) (-2806.074) -- 0:01:38
      413500 -- [-2820.089] (-2813.013) (-2810.249) (-2813.432) * [-2807.350] (-2809.461) (-2809.299) (-2813.851) -- 0:01:37
      414000 -- (-2814.194) [-2809.252] (-2807.254) (-2812.261) * (-2808.640) [-2820.240] (-2814.445) (-2812.445) -- 0:01:39
      414500 -- [-2808.992] (-2809.354) (-2810.540) (-2817.390) * (-2810.637) [-2810.956] (-2812.710) (-2815.724) -- 0:01:38
      415000 -- (-2807.310) (-2804.798) [-2808.898] (-2812.006) * (-2809.670) [-2812.455] (-2811.577) (-2819.840) -- 0:01:38

      Average standard deviation of split frequencies: 0.024930

      415500 -- (-2812.370) [-2807.393] (-2812.059) (-2810.775) * [-2807.341] (-2812.799) (-2808.582) (-2812.793) -- 0:01:38
      416000 -- (-2810.058) [-2813.580] (-2811.648) (-2808.968) * (-2808.759) [-2808.511] (-2810.836) (-2817.686) -- 0:01:38
      416500 -- (-2814.654) (-2809.690) [-2809.467] (-2815.667) * (-2808.752) (-2809.023) (-2806.561) [-2815.308] -- 0:01:38
      417000 -- [-2810.680] (-2810.357) (-2814.369) (-2809.004) * (-2819.715) [-2805.058] (-2808.032) (-2811.111) -- 0:01:37
      417500 -- (-2813.881) (-2810.510) [-2817.970] (-2807.068) * (-2813.973) (-2806.906) [-2811.089] (-2807.170) -- 0:01:37
      418000 -- (-2818.146) (-2817.088) [-2808.462] (-2809.136) * (-2810.293) (-2808.438) [-2810.777] (-2807.483) -- 0:01:37
      418500 -- [-2818.306] (-2813.457) (-2807.915) (-2822.263) * (-2816.518) (-2808.793) [-2804.504] (-2812.555) -- 0:01:37
      419000 -- (-2808.417) [-2805.356] (-2813.756) (-2808.857) * (-2809.839) (-2809.939) (-2811.481) [-2815.221] -- 0:01:37
      419500 -- (-2812.220) (-2807.252) (-2815.632) [-2812.479] * (-2809.845) (-2816.305) [-2811.168] (-2811.389) -- 0:01:36
      420000 -- (-2808.795) (-2810.690) [-2814.601] (-2807.858) * [-2808.252] (-2822.828) (-2812.018) (-2812.340) -- 0:01:38

      Average standard deviation of split frequencies: 0.025401

      420500 -- (-2809.538) (-2812.491) (-2810.054) [-2808.872] * (-2806.370) (-2811.946) [-2809.698] (-2811.118) -- 0:01:37
      421000 -- (-2810.726) (-2815.031) [-2810.080] (-2805.676) * (-2812.150) (-2809.266) [-2807.186] (-2808.306) -- 0:01:37
      421500 -- (-2815.281) [-2806.997] (-2807.976) (-2818.540) * (-2806.997) [-2810.065] (-2803.248) (-2810.031) -- 0:01:37
      422000 -- (-2809.161) [-2806.655] (-2810.311) (-2807.286) * (-2808.308) (-2806.531) [-2805.660] (-2809.935) -- 0:01:37
      422500 -- (-2809.788) [-2810.292] (-2807.765) (-2809.324) * (-2811.708) [-2813.311] (-2808.563) (-2809.925) -- 0:01:37
      423000 -- [-2813.840] (-2818.761) (-2814.862) (-2811.352) * (-2806.059) (-2807.905) (-2813.484) [-2807.341] -- 0:01:36
      423500 -- (-2809.080) (-2810.388) [-2812.829] (-2810.098) * (-2804.155) (-2809.023) (-2815.688) [-2807.259] -- 0:01:36
      424000 -- (-2814.073) (-2813.443) (-2813.034) [-2813.786] * [-2809.425] (-2812.755) (-2808.773) (-2808.732) -- 0:01:36
      424500 -- (-2812.359) (-2808.231) (-2812.035) [-2805.781] * (-2806.177) (-2810.916) [-2808.358] (-2811.166) -- 0:01:36
      425000 -- (-2806.808) (-2809.060) (-2811.361) [-2803.755] * (-2810.936) (-2808.164) (-2816.719) [-2813.123] -- 0:01:36

      Average standard deviation of split frequencies: 0.025820

      425500 -- [-2808.888] (-2810.740) (-2809.118) (-2808.668) * [-2807.983] (-2810.983) (-2812.225) (-2810.084) -- 0:01:35
      426000 -- [-2808.289] (-2809.573) (-2809.642) (-2805.832) * (-2814.325) (-2807.540) (-2809.087) [-2810.822] -- 0:01:37
      426500 -- [-2812.832] (-2806.322) (-2807.933) (-2809.666) * (-2810.340) (-2813.060) [-2805.929] (-2806.604) -- 0:01:36
      427000 -- [-2816.586] (-2812.671) (-2816.437) (-2807.804) * (-2816.176) (-2807.111) (-2810.411) [-2806.778] -- 0:01:36
      427500 -- (-2807.602) [-2815.648] (-2807.997) (-2807.263) * (-2810.078) (-2812.144) [-2808.363] (-2811.373) -- 0:01:36
      428000 -- (-2812.262) (-2811.011) [-2807.169] (-2809.060) * [-2810.268] (-2814.712) (-2811.856) (-2806.893) -- 0:01:36
      428500 -- (-2812.037) (-2809.591) (-2813.330) [-2809.605] * [-2807.956] (-2813.170) (-2810.805) (-2811.996) -- 0:01:36
      429000 -- [-2813.023] (-2812.663) (-2809.209) (-2815.512) * (-2813.731) (-2811.991) [-2808.351] (-2816.128) -- 0:01:35
      429500 -- (-2813.471) (-2805.700) [-2809.151] (-2819.166) * [-2809.628] (-2812.250) (-2816.044) (-2813.978) -- 0:01:35
      430000 -- (-2816.223) (-2812.036) [-2805.975] (-2814.973) * (-2808.742) (-2808.458) (-2811.230) [-2806.943] -- 0:01:35

      Average standard deviation of split frequencies: 0.024081

      430500 -- (-2807.754) (-2813.518) (-2814.689) [-2806.722] * (-2812.582) (-2808.031) [-2811.552] (-2807.269) -- 0:01:35
      431000 -- [-2805.877] (-2814.831) (-2807.607) (-2815.848) * [-2814.132] (-2807.763) (-2807.158) (-2812.638) -- 0:01:35
      431500 -- [-2808.164] (-2809.241) (-2806.466) (-2822.257) * (-2812.696) (-2808.721) [-2808.088] (-2807.332) -- 0:01:34
      432000 -- [-2816.958] (-2814.492) (-2807.531) (-2818.996) * [-2811.971] (-2809.764) (-2813.009) (-2824.440) -- 0:01:35
      432500 -- [-2805.182] (-2806.909) (-2813.757) (-2814.411) * (-2812.350) [-2814.743] (-2812.931) (-2814.926) -- 0:01:35
      433000 -- [-2811.101] (-2807.589) (-2807.342) (-2806.204) * (-2822.236) (-2807.359) (-2815.964) [-2807.086] -- 0:01:35
      433500 -- [-2809.195] (-2809.992) (-2812.474) (-2804.816) * (-2812.354) (-2810.822) (-2809.013) [-2814.579] -- 0:01:35
      434000 -- (-2807.474) [-2805.996] (-2809.391) (-2808.884) * (-2812.328) (-2806.276) (-2817.070) [-2807.797] -- 0:01:35
      434500 -- (-2806.312) (-2816.108) (-2812.636) [-2808.829] * (-2814.564) (-2810.538) [-2812.195] (-2809.968) -- 0:01:35
      435000 -- (-2810.629) (-2818.214) (-2811.423) [-2812.153] * (-2817.198) (-2810.504) [-2815.355] (-2809.665) -- 0:01:34

      Average standard deviation of split frequencies: 0.024507

      435500 -- (-2813.383) (-2811.349) (-2813.568) [-2807.894] * [-2815.093] (-2808.399) (-2805.200) (-2813.116) -- 0:01:34
      436000 -- (-2810.982) (-2810.183) [-2810.014] (-2804.879) * (-2808.222) [-2814.297] (-2807.696) (-2810.183) -- 0:01:34
      436500 -- (-2814.722) (-2813.305) [-2808.237] (-2808.126) * (-2812.106) (-2810.295) [-2806.611] (-2808.854) -- 0:01:34
      437000 -- (-2817.246) (-2807.317) (-2813.244) [-2806.749] * (-2809.417) (-2811.923) (-2806.291) [-2810.567] -- 0:01:34
      437500 -- (-2813.845) [-2808.097] (-2808.095) (-2808.493) * (-2809.165) [-2808.268] (-2808.350) (-2811.689) -- 0:01:33
      438000 -- (-2808.627) (-2821.247) (-2807.238) [-2810.138] * (-2813.371) (-2813.215) [-2805.732] (-2812.984) -- 0:01:34
      438500 -- [-2814.135] (-2806.271) (-2810.211) (-2806.942) * (-2821.391) (-2809.956) (-2813.587) [-2805.874] -- 0:01:34
      439000 -- (-2809.321) [-2806.500] (-2810.572) (-2812.568) * (-2812.243) [-2808.880] (-2808.754) (-2809.327) -- 0:01:34
      439500 -- (-2812.690) (-2816.898) [-2807.046] (-2816.676) * [-2810.123] (-2808.408) (-2806.227) (-2811.396) -- 0:01:34
      440000 -- (-2808.832) (-2809.907) (-2808.167) [-2809.669] * (-2805.640) [-2807.026] (-2812.730) (-2809.047) -- 0:01:34

      Average standard deviation of split frequencies: 0.022821

      440500 -- (-2807.925) [-2808.466] (-2810.696) (-2811.740) * (-2814.349) (-2808.897) [-2811.635] (-2811.222) -- 0:01:33
      441000 -- [-2804.655] (-2813.230) (-2810.476) (-2811.924) * (-2808.347) (-2808.267) (-2812.384) [-2807.323] -- 0:01:33
      441500 -- (-2810.296) [-2809.911] (-2816.834) (-2809.473) * (-2807.056) [-2807.486] (-2809.978) (-2812.515) -- 0:01:33
      442000 -- (-2813.249) (-2806.238) (-2814.639) [-2808.407] * (-2808.967) [-2808.708] (-2811.469) (-2812.960) -- 0:01:33
      442500 -- (-2805.668) (-2808.692) (-2815.219) [-2807.643] * (-2807.371) (-2812.037) (-2806.815) [-2807.482] -- 0:01:33
      443000 -- (-2816.648) (-2810.054) [-2805.559] (-2805.333) * (-2806.255) [-2807.797] (-2814.262) (-2807.126) -- 0:01:33
      443500 -- (-2813.296) (-2809.619) (-2808.582) [-2809.111] * (-2810.774) (-2804.502) (-2809.129) [-2807.727] -- 0:01:32
      444000 -- [-2808.763] (-2811.292) (-2811.549) (-2812.423) * (-2812.325) (-2808.686) [-2805.154] (-2805.389) -- 0:01:33
      444500 -- (-2808.850) (-2810.205) (-2809.602) [-2810.089] * (-2810.062) (-2809.225) (-2807.404) [-2805.194] -- 0:01:33
      445000 -- [-2816.420] (-2809.393) (-2810.441) (-2811.095) * [-2807.499] (-2813.895) (-2811.791) (-2806.271) -- 0:01:33

      Average standard deviation of split frequencies: 0.024662

      445500 -- (-2813.338) [-2805.313] (-2810.784) (-2809.728) * (-2809.731) (-2808.920) (-2814.769) [-2809.356] -- 0:01:33
      446000 -- (-2809.517) (-2817.082) (-2806.310) [-2806.785] * [-2807.767] (-2812.462) (-2812.093) (-2805.163) -- 0:01:33
      446500 -- [-2816.346] (-2821.100) (-2808.870) (-2808.539) * [-2811.346] (-2810.368) (-2806.736) (-2808.322) -- 0:01:32
      447000 -- (-2810.058) (-2808.928) [-2807.652] (-2817.403) * [-2812.238] (-2812.056) (-2809.597) (-2815.023) -- 0:01:32
      447500 -- (-2811.427) [-2812.958] (-2808.501) (-2811.966) * (-2813.714) (-2809.195) (-2813.242) [-2813.419] -- 0:01:32
      448000 -- (-2812.302) [-2808.606] (-2809.353) (-2816.368) * (-2808.755) [-2805.972] (-2808.522) (-2809.276) -- 0:01:32
      448500 -- (-2809.851) (-2821.648) (-2813.595) [-2808.494] * [-2810.032] (-2814.419) (-2811.962) (-2811.241) -- 0:01:32
      449000 -- (-2806.658) [-2808.069] (-2808.363) (-2819.369) * (-2811.221) (-2808.314) [-2807.590] (-2809.132) -- 0:01:32
      449500 -- (-2807.808) (-2817.008) (-2813.687) [-2810.756] * [-2805.075] (-2808.210) (-2809.633) (-2817.191) -- 0:01:31
      450000 -- (-2810.663) (-2810.443) [-2811.324] (-2806.912) * (-2812.342) [-2809.214] (-2810.990) (-2816.658) -- 0:01:32

      Average standard deviation of split frequencies: 0.021618

      450500 -- [-2804.394] (-2809.499) (-2809.713) (-2811.647) * (-2810.709) (-2808.381) [-2809.130] (-2808.952) -- 0:01:32
      451000 -- (-2807.673) (-2809.582) (-2814.192) [-2814.461] * [-2808.567] (-2809.651) (-2809.011) (-2816.526) -- 0:01:32
      451500 -- [-2809.387] (-2807.114) (-2808.785) (-2815.855) * (-2806.773) [-2807.735] (-2813.151) (-2816.117) -- 0:01:32
      452000 -- [-2812.955] (-2810.728) (-2812.769) (-2812.921) * (-2813.148) [-2811.568] (-2810.223) (-2805.461) -- 0:01:32
      452500 -- [-2806.668] (-2815.496) (-2807.628) (-2810.503) * (-2806.868) (-2811.756) [-2812.363] (-2808.388) -- 0:01:31
      453000 -- [-2808.302] (-2811.048) (-2810.892) (-2811.571) * (-2806.813) (-2810.485) [-2807.735] (-2808.218) -- 0:01:31
      453500 -- (-2808.181) (-2807.266) (-2809.581) [-2809.353] * [-2812.954] (-2814.987) (-2820.415) (-2804.482) -- 0:01:31
      454000 -- [-2814.619] (-2813.760) (-2814.995) (-2814.851) * (-2808.338) (-2807.329) [-2806.184] (-2806.149) -- 0:01:31
      454500 -- (-2808.024) (-2809.559) (-2809.877) [-2813.263] * [-2809.531] (-2812.467) (-2813.631) (-2809.813) -- 0:01:31
      455000 -- [-2808.591] (-2819.785) (-2814.220) (-2811.628) * [-2807.255] (-2815.426) (-2814.722) (-2811.166) -- 0:01:31

      Average standard deviation of split frequencies: 0.024811

      455500 -- (-2808.955) [-2809.800] (-2812.329) (-2813.692) * (-2812.093) (-2809.222) [-2810.790] (-2808.237) -- 0:01:30
      456000 -- (-2807.536) (-2807.802) (-2809.647) [-2808.468] * (-2821.777) (-2808.974) (-2813.535) [-2808.185] -- 0:01:31
      456500 -- (-2811.350) (-2808.313) (-2806.084) [-2808.894] * (-2819.926) [-2809.928] (-2809.200) (-2806.582) -- 0:01:31
      457000 -- (-2811.162) (-2810.559) (-2811.270) [-2809.606] * (-2810.348) (-2809.334) [-2815.736] (-2809.720) -- 0:01:31
      457500 -- (-2808.673) (-2809.844) [-2806.891] (-2812.065) * [-2811.201] (-2810.699) (-2811.384) (-2810.391) -- 0:01:31
      458000 -- [-2807.309] (-2808.540) (-2809.469) (-2808.319) * (-2805.397) (-2810.587) (-2812.105) [-2807.166] -- 0:01:31
      458500 -- (-2805.847) (-2809.437) (-2811.628) [-2809.911] * (-2808.413) [-2808.764] (-2813.041) (-2807.474) -- 0:01:30
      459000 -- (-2811.320) (-2812.613) [-2811.422] (-2813.369) * (-2810.797) (-2809.654) [-2810.566] (-2806.497) -- 0:01:30
      459500 -- [-2805.029] (-2808.189) (-2814.503) (-2802.655) * (-2809.656) [-2805.168] (-2814.957) (-2810.901) -- 0:01:30
      460000 -- [-2803.221] (-2808.696) (-2809.435) (-2808.757) * [-2807.012] (-2810.713) (-2811.645) (-2808.289) -- 0:01:30

      Average standard deviation of split frequencies: 0.027288

      460500 -- (-2809.859) (-2813.788) (-2810.322) [-2809.193] * (-2820.139) (-2809.300) (-2809.598) [-2809.155] -- 0:01:30
      461000 -- (-2807.641) (-2816.259) [-2808.880] (-2818.294) * (-2814.040) (-2812.904) (-2816.065) [-2810.844] -- 0:01:30
      461500 -- (-2809.415) (-2804.089) (-2810.511) [-2810.218] * (-2813.247) (-2808.799) (-2807.004) [-2806.645] -- 0:01:29
      462000 -- (-2809.376) [-2806.895] (-2816.358) (-2810.135) * (-2812.936) (-2810.809) (-2813.568) [-2809.141] -- 0:01:30
      462500 -- (-2815.587) (-2807.508) [-2809.326] (-2810.942) * (-2812.050) (-2809.724) (-2810.498) [-2805.914] -- 0:01:30
      463000 -- (-2812.883) [-2812.662] (-2808.075) (-2807.581) * (-2813.313) [-2812.022] (-2808.872) (-2810.932) -- 0:01:30
      463500 -- (-2810.335) [-2810.483] (-2810.626) (-2811.838) * (-2812.578) (-2812.387) [-2803.123] (-2814.700) -- 0:01:30
      464000 -- [-2807.168] (-2821.285) (-2804.452) (-2811.790) * (-2809.397) (-2809.735) [-2807.951] (-2805.991) -- 0:01:30
      464500 -- (-2812.160) (-2813.430) (-2806.927) [-2820.926] * (-2804.454) (-2807.380) [-2813.929] (-2814.660) -- 0:01:29
      465000 -- (-2806.259) [-2810.612] (-2810.224) (-2812.990) * (-2814.597) [-2805.801] (-2810.205) (-2806.649) -- 0:01:29

      Average standard deviation of split frequencies: 0.026302

      465500 -- (-2806.933) (-2811.005) [-2807.876] (-2815.264) * (-2806.327) [-2812.226] (-2809.622) (-2814.287) -- 0:01:29
      466000 -- [-2810.949] (-2813.783) (-2809.285) (-2815.706) * (-2809.463) [-2809.485] (-2810.908) (-2812.319) -- 0:01:29
      466500 -- (-2816.216) (-2803.433) (-2812.413) [-2807.930] * (-2812.931) [-2806.664] (-2807.965) (-2805.741) -- 0:01:29
      467000 -- (-2808.786) (-2811.118) [-2810.275] (-2806.851) * (-2811.243) (-2813.367) [-2807.873] (-2806.347) -- 0:01:29
      467500 -- (-2809.819) (-2805.004) [-2812.138] (-2812.110) * (-2812.575) (-2810.457) [-2807.838] (-2810.368) -- 0:01:28
      468000 -- (-2807.253) [-2810.865] (-2807.642) (-2811.043) * (-2821.811) (-2812.801) [-2809.269] (-2810.641) -- 0:01:29
      468500 -- [-2806.784] (-2813.930) (-2811.824) (-2808.008) * (-2810.581) (-2807.312) [-2814.658] (-2806.804) -- 0:01:29
      469000 -- (-2809.341) (-2811.488) [-2808.839] (-2815.601) * (-2807.182) [-2805.931] (-2812.708) (-2814.201) -- 0:01:29
      469500 -- (-2811.119) [-2811.700] (-2812.775) (-2809.996) * (-2805.750) (-2809.639) [-2814.776] (-2816.919) -- 0:01:29
      470000 -- (-2816.241) [-2810.704] (-2809.591) (-2809.866) * (-2808.065) [-2805.772] (-2810.779) (-2811.879) -- 0:01:29

      Average standard deviation of split frequencies: 0.028044

      470500 -- [-2809.984] (-2806.345) (-2804.777) (-2812.303) * (-2813.921) [-2808.527] (-2811.941) (-2815.427) -- 0:01:28
      471000 -- (-2808.511) (-2806.259) [-2804.198] (-2816.511) * (-2816.936) (-2808.595) (-2811.966) [-2812.434] -- 0:01:28
      471500 -- (-2807.824) (-2810.428) [-2808.286] (-2821.009) * (-2816.790) (-2814.230) (-2809.613) [-2812.333] -- 0:01:28
      472000 -- (-2809.727) [-2810.201] (-2806.057) (-2819.174) * (-2808.079) [-2811.458] (-2812.873) (-2813.516) -- 0:01:28
      472500 -- (-2812.675) (-2806.870) [-2810.300] (-2818.138) * (-2811.269) (-2810.654) (-2810.880) [-2816.510] -- 0:01:28
      473000 -- (-2811.059) [-2805.018] (-2808.357) (-2809.142) * (-2809.925) (-2815.648) (-2811.881) [-2809.225] -- 0:01:28
      473500 -- [-2806.598] (-2816.464) (-2809.454) (-2811.664) * [-2805.684] (-2812.498) (-2806.843) (-2810.710) -- 0:01:27
      474000 -- (-2806.317) [-2806.994] (-2811.125) (-2812.749) * [-2806.333] (-2809.685) (-2806.022) (-2818.335) -- 0:01:28
      474500 -- (-2814.784) [-2813.541] (-2808.804) (-2812.560) * (-2815.329) (-2816.340) [-2805.947] (-2806.810) -- 0:01:28
      475000 -- [-2808.687] (-2811.095) (-2810.546) (-2814.103) * (-2810.988) [-2813.598] (-2805.812) (-2806.872) -- 0:01:28

      Average standard deviation of split frequencies: 0.029050

      475500 -- (-2811.478) (-2818.613) [-2809.174] (-2815.985) * (-2810.002) (-2813.530) (-2810.798) [-2807.665] -- 0:01:28
      476000 -- [-2806.934] (-2811.700) (-2806.077) (-2810.844) * [-2810.191] (-2804.755) (-2809.536) (-2806.867) -- 0:01:28
      476500 -- [-2808.366] (-2811.196) (-2808.650) (-2812.034) * (-2811.579) (-2808.591) (-2806.572) [-2810.046] -- 0:01:27
      477000 -- (-2803.676) (-2814.910) [-2804.857] (-2808.298) * (-2814.547) (-2808.706) (-2811.473) [-2806.228] -- 0:01:27
      477500 -- [-2807.187] (-2807.161) (-2809.171) (-2814.052) * (-2813.005) (-2807.328) (-2809.349) [-2810.964] -- 0:01:27
      478000 -- [-2805.564] (-2813.179) (-2811.821) (-2807.730) * (-2812.776) (-2806.050) [-2812.262] (-2809.602) -- 0:01:27
      478500 -- (-2810.051) (-2811.320) (-2806.684) [-2812.924] * [-2810.490] (-2810.511) (-2803.538) (-2809.625) -- 0:01:27
      479000 -- (-2809.083) [-2810.008] (-2810.517) (-2810.709) * (-2812.589) [-2809.228] (-2809.247) (-2808.884) -- 0:01:27
      479500 -- (-2815.523) (-2805.070) (-2809.279) [-2806.589] * (-2807.466) [-2805.393] (-2808.386) (-2810.259) -- 0:01:26
      480000 -- (-2809.825) (-2808.290) (-2805.807) [-2806.103] * (-2809.557) (-2817.680) [-2804.819] (-2814.327) -- 0:01:27

      Average standard deviation of split frequencies: 0.029422

      480500 -- (-2812.266) [-2813.110] (-2804.471) (-2816.573) * [-2810.837] (-2814.579) (-2810.801) (-2816.857) -- 0:01:27
      481000 -- (-2805.220) (-2814.752) (-2811.743) [-2806.531] * (-2807.480) (-2816.933) (-2811.185) [-2810.386] -- 0:01:27
      481500 -- (-2806.134) (-2810.620) [-2807.687] (-2807.999) * (-2807.659) [-2809.625] (-2810.983) (-2809.953) -- 0:01:27
      482000 -- (-2809.390) (-2816.008) (-2810.679) [-2805.702] * [-2806.329] (-2811.669) (-2809.730) (-2816.004) -- 0:01:27
      482500 -- (-2808.429) (-2805.740) [-2805.684] (-2817.936) * (-2815.038) (-2814.195) [-2805.241] (-2813.918) -- 0:01:26
      483000 -- (-2810.129) [-2807.517] (-2805.935) (-2803.994) * (-2812.166) (-2808.409) (-2807.052) [-2812.994] -- 0:01:26
      483500 -- [-2809.711] (-2809.301) (-2807.711) (-2811.982) * [-2813.663] (-2818.144) (-2811.476) (-2811.215) -- 0:01:26
      484000 -- (-2811.996) (-2811.640) [-2806.907] (-2809.785) * [-2808.300] (-2812.909) (-2804.793) (-2810.383) -- 0:01:26
      484500 -- [-2815.392] (-2810.410) (-2812.018) (-2809.356) * [-2807.877] (-2808.003) (-2814.608) (-2811.276) -- 0:01:26
      485000 -- [-2807.520] (-2809.515) (-2806.172) (-2809.788) * (-2809.795) (-2808.315) [-2808.313] (-2826.352) -- 0:01:26

      Average standard deviation of split frequencies: 0.031686

      485500 -- [-2811.957] (-2807.040) (-2809.527) (-2812.564) * (-2806.782) (-2814.491) [-2809.961] (-2819.991) -- 0:01:25
      486000 -- (-2807.056) (-2818.522) [-2814.398] (-2814.675) * (-2811.011) [-2809.495] (-2813.495) (-2814.454) -- 0:01:26
      486500 -- (-2807.364) [-2812.598] (-2811.162) (-2818.875) * (-2817.622) (-2807.369) [-2806.803] (-2811.422) -- 0:01:26
      487000 -- (-2808.913) (-2815.570) [-2807.680] (-2818.876) * (-2809.359) (-2819.101) (-2810.192) [-2807.401] -- 0:01:26
      487500 -- (-2809.408) [-2808.222] (-2815.479) (-2815.878) * (-2815.344) [-2808.492] (-2817.053) (-2806.819) -- 0:01:26
      488000 -- (-2804.525) (-2811.169) [-2809.137] (-2812.910) * [-2806.378] (-2814.352) (-2813.832) (-2806.317) -- 0:01:26
      488500 -- (-2805.078) [-2811.577] (-2808.702) (-2809.208) * [-2809.788] (-2810.656) (-2810.031) (-2813.177) -- 0:01:25
      489000 -- (-2808.487) (-2809.760) (-2813.501) [-2808.189] * [-2808.280] (-2812.736) (-2811.115) (-2812.122) -- 0:01:25
      489500 -- [-2806.248] (-2805.619) (-2807.983) (-2812.738) * (-2811.713) [-2807.483] (-2814.915) (-2812.723) -- 0:01:25
      490000 -- [-2816.766] (-2807.734) (-2807.386) (-2814.454) * (-2814.366) [-2810.971] (-2817.298) (-2812.672) -- 0:01:25

      Average standard deviation of split frequencies: 0.033946

      490500 -- (-2808.134) [-2807.541] (-2811.061) (-2812.557) * (-2808.245) [-2809.586] (-2820.458) (-2812.658) -- 0:01:25
      491000 -- [-2807.371] (-2805.488) (-2813.406) (-2815.407) * [-2813.480] (-2811.357) (-2815.660) (-2813.068) -- 0:01:25
      491500 -- (-2807.018) (-2811.685) [-2810.398] (-2807.144) * (-2807.552) [-2807.401] (-2812.633) (-2817.293) -- 0:01:25
      492000 -- (-2811.014) (-2818.569) (-2817.924) [-2811.012] * (-2809.299) (-2809.041) [-2812.049] (-2807.378) -- 0:01:25
      492500 -- (-2811.437) (-2811.766) [-2810.966] (-2806.033) * (-2809.050) (-2802.333) (-2812.975) [-2806.549] -- 0:01:25
      493000 -- (-2813.625) (-2805.317) (-2808.058) [-2806.436] * (-2813.110) (-2805.879) (-2824.867) [-2807.863] -- 0:01:25
      493500 -- (-2808.488) (-2808.712) [-2808.120] (-2808.787) * [-2812.978] (-2810.250) (-2815.207) (-2807.863) -- 0:01:25
      494000 -- (-2808.566) (-2806.219) (-2806.834) [-2811.055] * (-2813.030) [-2811.245] (-2812.260) (-2809.712) -- 0:01:25
      494500 -- (-2807.697) (-2811.326) [-2809.629] (-2809.237) * (-2809.082) (-2811.925) [-2811.646] (-2811.180) -- 0:01:24
      495000 -- (-2806.139) (-2810.140) [-2806.857] (-2806.971) * [-2807.149] (-2807.532) (-2809.048) (-2815.606) -- 0:01:24

      Average standard deviation of split frequencies: 0.034215

      495500 -- (-2810.254) (-2819.638) [-2811.271] (-2809.717) * (-2817.965) [-2809.213] (-2811.412) (-2809.265) -- 0:01:24
      496000 -- (-2816.626) (-2806.650) [-2806.340] (-2814.287) * (-2808.938) (-2805.418) [-2810.251] (-2810.522) -- 0:01:24
      496500 -- (-2811.371) [-2809.130] (-2811.687) (-2820.180) * [-2813.842] (-2808.758) (-2811.252) (-2811.817) -- 0:01:24
      497000 -- (-2804.131) (-2815.813) (-2808.936) [-2803.377] * [-2811.723] (-2808.682) (-2813.624) (-2810.484) -- 0:01:24
      497500 -- [-2809.096] (-2811.814) (-2810.048) (-2809.359) * [-2811.303] (-2806.645) (-2810.064) (-2808.105) -- 0:01:24
      498000 -- (-2806.620) (-2815.161) [-2810.159] (-2808.919) * (-2808.289) (-2810.459) [-2805.037] (-2811.008) -- 0:01:24
      498500 -- [-2809.228] (-2812.051) (-2811.572) (-2810.478) * [-2806.366] (-2806.012) (-2814.011) (-2820.614) -- 0:01:24
      499000 -- (-2808.354) (-2811.306) [-2810.632] (-2810.915) * (-2807.766) (-2804.855) [-2806.636] (-2816.555) -- 0:01:24
      499500 -- (-2805.317) (-2808.725) [-2807.261] (-2812.343) * (-2811.930) (-2806.335) (-2807.139) [-2808.488] -- 0:01:24
      500000 -- (-2807.352) [-2814.372] (-2811.848) (-2808.793) * [-2808.489] (-2815.268) (-2814.444) (-2809.016) -- 0:01:24

      Average standard deviation of split frequencies: 0.035151

      500500 -- (-2810.574) (-2811.584) (-2810.918) [-2805.493] * (-2817.786) (-2817.364) (-2817.614) [-2807.917] -- 0:01:23
      501000 -- (-2806.745) (-2805.240) (-2812.676) [-2807.642] * (-2809.916) [-2806.222] (-2807.189) (-2814.167) -- 0:01:23
      501500 -- (-2816.084) (-2810.417) (-2804.505) [-2804.330] * (-2809.473) (-2808.911) [-2807.617] (-2810.342) -- 0:01:23
      502000 -- (-2805.109) (-2807.885) (-2805.894) [-2809.618] * (-2805.315) (-2807.110) (-2812.412) [-2808.320] -- 0:01:23
      502500 -- (-2808.206) (-2805.531) [-2812.670] (-2808.414) * [-2807.650] (-2816.500) (-2819.318) (-2808.876) -- 0:01:23
      503000 -- [-2808.678] (-2811.225) (-2810.556) (-2807.865) * (-2805.648) (-2807.714) (-2808.672) [-2810.344] -- 0:01:22
      503500 -- (-2807.843) [-2813.194] (-2811.758) (-2808.714) * [-2810.201] (-2808.481) (-2813.734) (-2808.730) -- 0:01:23
      504000 -- (-2807.929) [-2810.922] (-2806.119) (-2810.438) * [-2809.593] (-2810.106) (-2805.544) (-2809.382) -- 0:01:23
      504500 -- [-2807.278] (-2815.916) (-2818.287) (-2810.429) * (-2807.719) (-2807.951) (-2810.672) [-2808.757] -- 0:01:23
      505000 -- (-2805.685) [-2807.619] (-2814.166) (-2808.099) * (-2812.707) (-2811.552) [-2809.503] (-2805.401) -- 0:01:23

      Average standard deviation of split frequencies: 0.036644

      505500 -- (-2811.586) (-2809.523) (-2809.442) [-2808.391] * (-2807.877) [-2808.890] (-2811.049) (-2812.280) -- 0:01:23
      506000 -- (-2811.474) (-2804.757) [-2812.392] (-2810.879) * (-2805.466) (-2813.384) (-2806.915) [-2806.158] -- 0:01:22
      506500 -- (-2814.472) (-2809.274) (-2814.616) [-2805.581] * (-2808.379) (-2812.124) [-2806.704] (-2813.433) -- 0:01:22
      507000 -- (-2811.806) (-2809.538) (-2809.454) [-2811.184] * (-2809.446) (-2810.457) (-2814.502) [-2809.581] -- 0:01:22
      507500 -- (-2811.100) (-2806.845) [-2818.340] (-2807.932) * [-2814.661] (-2806.980) (-2810.408) (-2813.737) -- 0:01:22
      508000 -- [-2808.256] (-2807.700) (-2808.770) (-2811.266) * (-2815.138) (-2811.342) (-2816.343) [-2812.616] -- 0:01:22
      508500 -- [-2808.997] (-2821.116) (-2811.559) (-2813.461) * (-2806.871) (-2807.489) [-2808.621] (-2812.460) -- 0:01:22
      509000 -- [-2807.779] (-2816.715) (-2807.696) (-2810.395) * (-2808.272) [-2805.207] (-2812.921) (-2810.316) -- 0:01:21
      509500 -- [-2809.321] (-2814.883) (-2808.093) (-2812.548) * (-2811.311) [-2812.845] (-2813.670) (-2807.818) -- 0:01:22
      510000 -- (-2808.929) [-2808.752] (-2811.903) (-2805.981) * [-2812.580] (-2812.916) (-2807.490) (-2813.521) -- 0:01:22

      Average standard deviation of split frequencies: 0.036925

      510500 -- (-2814.180) (-2810.720) [-2804.003] (-2802.744) * [-2810.613] (-2812.003) (-2807.900) (-2807.826) -- 0:01:22
      511000 -- (-2808.184) (-2813.760) [-2807.035] (-2807.566) * (-2808.212) (-2807.815) (-2810.094) [-2806.882] -- 0:01:22
      511500 -- (-2807.780) (-2812.034) [-2812.330] (-2812.722) * (-2815.790) (-2812.517) (-2813.609) [-2804.253] -- 0:01:22
      512000 -- (-2807.318) (-2817.284) (-2811.457) [-2809.395] * [-2809.118] (-2809.955) (-2809.612) (-2809.528) -- 0:01:21
      512500 -- (-2810.927) [-2812.063] (-2816.002) (-2803.483) * (-2810.208) [-2807.374] (-2808.185) (-2807.419) -- 0:01:21
      513000 -- (-2811.571) (-2812.378) (-2810.408) [-2806.295] * (-2815.505) (-2813.998) [-2809.852] (-2806.678) -- 0:01:21
      513500 -- (-2814.502) [-2808.422] (-2814.339) (-2815.496) * [-2815.562] (-2810.343) (-2808.945) (-2809.370) -- 0:01:21
      514000 -- (-2807.841) (-2809.560) [-2806.566] (-2812.563) * (-2810.076) (-2811.509) [-2808.888] (-2813.035) -- 0:01:21
      514500 -- (-2814.901) [-2809.639] (-2811.311) (-2808.613) * (-2814.107) (-2807.687) [-2809.118] (-2812.494) -- 0:01:21
      515000 -- (-2803.987) [-2803.830] (-2812.657) (-2811.226) * (-2817.387) [-2808.247] (-2807.493) (-2808.141) -- 0:01:20

      Average standard deviation of split frequencies: 0.035934

      515500 -- (-2810.853) (-2806.630) (-2815.999) [-2807.918] * (-2811.937) (-2807.142) (-2810.765) [-2808.463] -- 0:01:21
      516000 -- (-2806.940) [-2811.207] (-2805.556) (-2808.647) * (-2809.101) (-2808.301) [-2812.632] (-2806.525) -- 0:01:21
      516500 -- (-2806.575) (-2806.859) [-2804.872] (-2808.381) * [-2805.833] (-2809.630) (-2809.453) (-2808.835) -- 0:01:21
      517000 -- (-2813.616) [-2812.628] (-2810.602) (-2819.645) * [-2806.925] (-2813.813) (-2812.343) (-2808.913) -- 0:01:21
      517500 -- (-2806.696) (-2814.012) [-2808.905] (-2814.021) * [-2807.984] (-2814.095) (-2813.144) (-2807.661) -- 0:01:21
      518000 -- (-2812.416) [-2809.385] (-2810.061) (-2813.873) * (-2817.666) (-2812.498) (-2818.143) [-2809.978] -- 0:01:20
      518500 -- (-2805.451) (-2812.549) [-2805.680] (-2806.073) * (-2811.877) [-2814.415] (-2818.105) (-2808.643) -- 0:01:20
      519000 -- (-2811.763) [-2812.140] (-2811.643) (-2809.310) * (-2818.839) (-2811.135) (-2809.975) [-2806.152] -- 0:01:20
      519500 -- (-2810.885) [-2805.917] (-2810.699) (-2810.497) * (-2815.112) [-2806.957] (-2815.146) (-2811.173) -- 0:01:20
      520000 -- [-2808.841] (-2807.610) (-2810.166) (-2809.014) * (-2810.724) (-2806.795) (-2809.717) [-2810.088] -- 0:01:20

      Average standard deviation of split frequencies: 0.037423

      520500 -- (-2806.793) (-2807.906) [-2806.919] (-2814.567) * (-2808.347) (-2809.582) [-2807.723] (-2810.363) -- 0:01:20
      521000 -- (-2818.401) [-2816.544] (-2806.573) (-2812.649) * (-2816.880) (-2811.427) [-2808.612] (-2811.732) -- 0:01:19
      521500 -- (-2809.813) (-2816.152) (-2810.003) [-2807.623] * (-2818.377) (-2808.362) (-2811.386) [-2809.640] -- 0:01:20
      522000 -- (-2809.464) (-2809.509) [-2811.166] (-2806.359) * (-2811.447) (-2813.109) [-2807.670] (-2809.579) -- 0:01:20
      522500 -- (-2809.261) [-2804.642] (-2814.906) (-2805.145) * (-2808.879) (-2813.036) [-2806.318] (-2810.214) -- 0:01:20
      523000 -- (-2810.620) (-2808.924) [-2809.914] (-2804.685) * (-2807.500) [-2806.619] (-2810.855) (-2810.484) -- 0:01:20
      523500 -- (-2809.838) [-2805.869] (-2813.202) (-2814.801) * (-2809.179) [-2809.486] (-2807.639) (-2808.914) -- 0:01:20
      524000 -- (-2816.880) [-2810.994] (-2815.945) (-2810.224) * [-2807.419] (-2810.160) (-2809.592) (-2811.647) -- 0:01:19
      524500 -- (-2812.413) (-2809.290) [-2809.303] (-2815.575) * (-2809.941) (-2810.707) [-2809.617] (-2810.289) -- 0:01:19
      525000 -- (-2816.043) (-2816.025) (-2810.650) [-2819.858] * (-2814.975) (-2818.883) [-2807.715] (-2809.421) -- 0:01:19

      Average standard deviation of split frequencies: 0.037043

      525500 -- [-2805.347] (-2805.632) (-2808.051) (-2809.658) * [-2805.189] (-2814.152) (-2812.840) (-2809.105) -- 0:01:19
      526000 -- (-2812.607) [-2809.776] (-2813.553) (-2806.969) * (-2807.573) (-2814.462) (-2810.521) [-2806.488] -- 0:01:19
      526500 -- [-2812.264] (-2810.794) (-2809.760) (-2811.107) * (-2811.677) (-2810.121) (-2810.763) [-2812.131] -- 0:01:19
      527000 -- [-2805.316] (-2810.478) (-2816.560) (-2810.354) * (-2805.892) (-2812.607) (-2808.593) [-2807.982] -- 0:01:18
      527500 -- (-2814.182) (-2811.884) (-2813.930) [-2806.886] * (-2807.356) (-2809.255) (-2814.106) [-2814.215] -- 0:01:19
      528000 -- (-2814.456) (-2806.323) [-2809.048] (-2812.329) * [-2808.691] (-2815.209) (-2810.275) (-2809.302) -- 0:01:19
      528500 -- (-2809.537) [-2811.028] (-2810.541) (-2809.891) * (-2806.934) (-2806.989) [-2809.298] (-2808.476) -- 0:01:19
      529000 -- (-2822.919) (-2810.302) (-2808.380) [-2814.342] * (-2810.691) (-2810.308) (-2812.094) [-2809.965] -- 0:01:19
      529500 -- [-2807.925] (-2811.623) (-2809.326) (-2807.608) * (-2806.103) (-2811.600) (-2809.811) [-2806.515] -- 0:01:19
      530000 -- (-2809.582) (-2809.009) [-2811.366] (-2817.563) * (-2815.798) (-2809.981) [-2808.115] (-2821.007) -- 0:01:18

      Average standard deviation of split frequencies: 0.038494

      530500 -- [-2807.298] (-2811.582) (-2808.673) (-2812.010) * (-2808.030) (-2813.176) (-2805.233) [-2807.296] -- 0:01:18
      531000 -- (-2807.805) [-2810.348] (-2814.302) (-2809.312) * (-2810.936) (-2810.960) (-2808.491) [-2809.657] -- 0:01:18
      531500 -- (-2807.077) (-2821.384) [-2804.646] (-2804.009) * (-2809.938) (-2811.333) [-2810.106] (-2807.765) -- 0:01:18
      532000 -- [-2809.988] (-2811.112) (-2816.147) (-2809.826) * [-2807.762] (-2810.114) (-2810.226) (-2815.152) -- 0:01:18
      532500 -- [-2809.779] (-2812.693) (-2813.768) (-2810.471) * (-2811.984) [-2809.582] (-2816.397) (-2810.042) -- 0:01:18
      533000 -- (-2816.757) (-2810.110) (-2812.368) [-2815.239] * (-2816.803) (-2812.135) [-2816.346] (-2814.908) -- 0:01:17
      533500 -- (-2805.619) [-2806.932] (-2809.531) (-2810.303) * (-2808.013) (-2815.951) (-2823.352) [-2814.540] -- 0:01:18
      534000 -- (-2814.905) [-2807.303] (-2814.910) (-2819.319) * (-2806.364) (-2809.682) [-2807.752] (-2814.178) -- 0:01:18
      534500 -- (-2812.197) [-2811.509] (-2806.191) (-2809.320) * (-2814.911) (-2808.374) (-2814.544) [-2811.006] -- 0:01:18
      535000 -- (-2808.223) (-2806.842) (-2811.821) [-2809.142] * (-2812.482) (-2811.395) [-2808.143] (-2816.500) -- 0:01:18

      Average standard deviation of split frequencies: 0.039870

      535500 -- (-2810.804) (-2809.686) (-2817.773) [-2808.469] * (-2808.692) [-2814.717] (-2806.977) (-2818.109) -- 0:01:18
      536000 -- (-2808.059) [-2812.357] (-2811.056) (-2808.223) * (-2812.849) (-2813.375) [-2805.118] (-2811.574) -- 0:01:17
      536500 -- (-2810.616) (-2811.537) (-2812.438) [-2815.047] * [-2807.554] (-2817.459) (-2819.926) (-2809.228) -- 0:01:17
      537000 -- [-2808.230] (-2807.774) (-2808.916) (-2811.732) * (-2812.316) [-2812.624] (-2816.197) (-2814.679) -- 0:01:17
      537500 -- [-2808.168] (-2808.693) (-2814.718) (-2809.966) * [-2812.247] (-2815.303) (-2813.321) (-2810.982) -- 0:01:17
      538000 -- (-2810.580) (-2809.311) (-2810.327) [-2804.810] * (-2808.738) (-2820.145) (-2814.367) [-2810.696] -- 0:01:17
      538500 -- (-2806.991) (-2806.831) [-2811.422] (-2810.167) * [-2810.010] (-2817.200) (-2810.832) (-2810.934) -- 0:01:17
      539000 -- [-2805.076] (-2811.003) (-2810.434) (-2809.681) * [-2804.849] (-2809.413) (-2810.264) (-2811.105) -- 0:01:16
      539500 -- (-2809.175) [-2813.146] (-2813.328) (-2811.506) * [-2808.004] (-2805.099) (-2806.608) (-2810.788) -- 0:01:17
      540000 -- (-2811.177) (-2818.434) [-2804.246] (-2808.342) * [-2804.994] (-2807.042) (-2816.483) (-2802.779) -- 0:01:17

      Average standard deviation of split frequencies: 0.039526

      540500 -- (-2809.772) [-2811.416] (-2809.945) (-2809.586) * (-2810.982) [-2809.306] (-2804.215) (-2810.537) -- 0:01:17
      541000 -- [-2804.339] (-2817.276) (-2809.901) (-2815.026) * (-2813.859) [-2805.448] (-2808.276) (-2813.057) -- 0:01:17
      541500 -- (-2809.672) (-2816.215) [-2809.026] (-2807.198) * (-2812.211) [-2809.594] (-2805.948) (-2818.767) -- 0:01:17
      542000 -- [-2808.574] (-2811.447) (-2811.463) (-2809.977) * (-2814.474) (-2809.957) (-2811.439) [-2806.503] -- 0:01:16
      542500 -- (-2809.929) (-2811.286) (-2806.881) [-2808.094] * (-2811.897) (-2811.898) [-2810.210] (-2813.505) -- 0:01:16
      543000 -- [-2806.815] (-2808.642) (-2804.671) (-2804.566) * (-2804.528) [-2810.745] (-2808.605) (-2811.353) -- 0:01:16
      543500 -- (-2811.793) (-2812.902) [-2812.899] (-2809.777) * (-2809.795) [-2812.108] (-2808.306) (-2813.613) -- 0:01:16
      544000 -- [-2808.082] (-2809.216) (-2811.126) (-2808.007) * (-2810.474) (-2807.702) (-2807.275) [-2807.499] -- 0:01:16
      544500 -- [-2809.667] (-2813.762) (-2814.068) (-2812.361) * (-2809.230) (-2808.982) [-2807.923] (-2804.033) -- 0:01:16
      545000 -- (-2810.520) [-2808.780] (-2815.133) (-2806.972) * [-2807.721] (-2810.605) (-2804.280) (-2809.006) -- 0:01:15

      Average standard deviation of split frequencies: 0.038564

      545500 -- (-2812.697) [-2803.724] (-2814.286) (-2812.332) * [-2805.514] (-2811.222) (-2809.355) (-2814.219) -- 0:01:16
      546000 -- (-2809.394) (-2803.621) (-2815.895) [-2809.849] * (-2805.708) (-2811.435) [-2807.096] (-2810.509) -- 0:01:16
      546500 -- (-2818.658) (-2807.813) [-2813.742] (-2811.628) * [-2813.588] (-2810.574) (-2812.474) (-2810.762) -- 0:01:16
      547000 -- (-2809.878) (-2815.259) (-2813.190) [-2807.770] * (-2813.061) (-2808.620) (-2814.641) [-2809.235] -- 0:01:16
      547500 -- (-2809.058) [-2809.436] (-2814.574) (-2810.651) * (-2808.752) (-2811.578) [-2813.225] (-2813.109) -- 0:01:16
      548000 -- (-2810.966) (-2812.458) [-2811.942] (-2814.515) * (-2807.767) (-2806.976) [-2812.258] (-2808.879) -- 0:01:15
      548500 -- [-2810.543] (-2818.918) (-2822.298) (-2805.973) * (-2807.968) (-2805.785) [-2809.665] (-2815.482) -- 0:01:15
      549000 -- (-2809.648) (-2810.485) (-2817.664) [-2805.877] * (-2812.232) (-2807.687) (-2812.166) [-2809.414] -- 0:01:15
      549500 -- (-2811.988) (-2811.095) (-2807.598) [-2809.287] * (-2816.433) [-2805.604] (-2809.417) (-2807.996) -- 0:01:15
      550000 -- (-2817.750) [-2809.021] (-2808.312) (-2814.305) * [-2809.026] (-2809.341) (-2809.913) (-2816.361) -- 0:01:15

      Average standard deviation of split frequencies: 0.035955

      550500 -- (-2807.716) (-2811.425) (-2807.334) [-2813.094] * (-2805.596) (-2807.587) [-2811.389] (-2814.734) -- 0:01:15
      551000 -- (-2809.933) (-2805.953) [-2804.326] (-2808.517) * (-2811.773) [-2812.121] (-2815.351) (-2807.887) -- 0:01:14
      551500 -- (-2813.038) (-2813.771) (-2809.100) [-2808.247] * [-2811.930] (-2810.162) (-2808.082) (-2805.571) -- 0:01:15
      552000 -- (-2810.985) (-2810.989) [-2809.087] (-2810.969) * [-2812.116] (-2813.629) (-2813.166) (-2809.882) -- 0:01:15
      552500 -- (-2815.241) (-2813.535) [-2808.170] (-2808.658) * (-2806.176) [-2807.536] (-2807.481) (-2806.976) -- 0:01:15
      553000 -- (-2808.460) (-2811.208) [-2817.111] (-2816.429) * (-2816.242) [-2806.614] (-2811.081) (-2813.027) -- 0:01:15
      553500 -- (-2814.156) [-2807.297] (-2810.674) (-2812.888) * (-2809.349) (-2807.331) [-2804.571] (-2807.713) -- 0:01:15
      554000 -- (-2809.965) (-2809.172) [-2808.961] (-2805.243) * [-2808.078] (-2812.148) (-2814.924) (-2811.166) -- 0:01:14
      554500 -- [-2809.215] (-2811.037) (-2815.859) (-2811.978) * (-2810.261) (-2813.528) (-2809.016) [-2814.363] -- 0:01:14
      555000 -- (-2812.425) (-2808.406) (-2817.246) [-2807.367] * (-2806.163) [-2807.921] (-2814.343) (-2806.546) -- 0:01:14

      Average standard deviation of split frequencies: 0.035610

      555500 -- (-2813.726) (-2808.651) (-2812.239) [-2808.885] * [-2806.844] (-2809.267) (-2813.250) (-2808.621) -- 0:01:14
      556000 -- [-2808.557] (-2807.838) (-2812.206) (-2809.230) * (-2805.356) (-2810.553) (-2814.923) [-2806.826] -- 0:01:14
      556500 -- [-2809.170] (-2813.577) (-2814.272) (-2808.597) * (-2816.177) [-2804.890] (-2811.218) (-2806.732) -- 0:01:14
      557000 -- (-2807.588) [-2804.171] (-2810.421) (-2815.404) * (-2805.731) (-2809.348) [-2807.922] (-2809.656) -- 0:01:13
      557500 -- [-2814.741] (-2811.039) (-2808.643) (-2811.939) * (-2812.675) [-2806.984] (-2811.155) (-2809.474) -- 0:01:14
      558000 -- (-2811.465) (-2815.726) (-2808.053) [-2807.858] * [-2809.458] (-2809.273) (-2814.500) (-2811.121) -- 0:01:14
      558500 -- [-2809.356] (-2819.871) (-2809.148) (-2808.257) * (-2813.040) [-2804.377] (-2806.573) (-2810.046) -- 0:01:14
      559000 -- [-2814.135] (-2811.009) (-2813.972) (-2809.435) * (-2812.491) (-2806.735) (-2811.836) [-2805.303] -- 0:01:14
      559500 -- [-2811.720] (-2815.077) (-2809.727) (-2805.540) * (-2809.924) (-2808.868) (-2809.535) [-2809.744] -- 0:01:14
      560000 -- (-2825.452) (-2806.159) [-2807.140] (-2807.581) * [-2810.344] (-2818.645) (-2816.241) (-2810.676) -- 0:01:13

      Average standard deviation of split frequencies: 0.035874

      560500 -- (-2810.006) (-2812.368) [-2813.353] (-2809.201) * [-2808.612] (-2814.445) (-2807.244) (-2813.535) -- 0:01:13
      561000 -- (-2816.341) (-2816.632) [-2806.496] (-2815.883) * (-2806.680) (-2807.825) (-2808.082) [-2805.834] -- 0:01:13
      561500 -- (-2810.823) (-2812.463) [-2806.116] (-2810.926) * (-2807.821) (-2813.136) (-2813.285) [-2809.367] -- 0:01:13
      562000 -- (-2806.619) (-2814.123) (-2810.170) [-2816.181] * [-2810.902] (-2812.132) (-2811.567) (-2808.916) -- 0:01:13
      562500 -- (-2811.290) (-2811.125) [-2817.522] (-2812.441) * [-2804.130] (-2809.787) (-2812.508) (-2813.389) -- 0:01:13
      563000 -- (-2808.282) (-2811.314) [-2807.071] (-2810.120) * [-2811.354] (-2809.811) (-2808.197) (-2811.168) -- 0:01:12
      563500 -- (-2814.574) (-2813.507) [-2809.533] (-2808.247) * [-2809.372] (-2815.898) (-2813.915) (-2808.191) -- 0:01:13
      564000 -- (-2813.332) (-2808.015) (-2809.568) [-2809.216] * [-2814.961] (-2810.148) (-2813.017) (-2811.003) -- 0:01:13
      564500 -- (-2810.947) (-2811.060) [-2814.366] (-2810.262) * (-2816.615) [-2808.780] (-2816.254) (-2814.220) -- 0:01:13
      565000 -- (-2813.286) (-2818.745) (-2811.117) [-2809.148] * (-2811.270) (-2818.819) (-2812.607) [-2813.241] -- 0:01:13

      Average standard deviation of split frequencies: 0.036646

      565500 -- (-2806.413) [-2809.276] (-2813.756) (-2815.703) * (-2811.677) (-2811.000) (-2811.744) [-2809.804] -- 0:01:12
      566000 -- (-2809.530) [-2807.527] (-2810.600) (-2814.303) * [-2807.185] (-2806.836) (-2807.119) (-2810.621) -- 0:01:12
      566500 -- (-2807.906) (-2812.152) (-2815.772) [-2806.666] * (-2812.200) (-2809.125) [-2805.842] (-2807.329) -- 0:01:12
      567000 -- (-2813.335) [-2808.780] (-2805.349) (-2809.547) * (-2822.688) (-2816.402) (-2812.862) [-2810.386] -- 0:01:12
      567500 -- (-2809.902) [-2808.212] (-2806.286) (-2808.904) * (-2807.890) (-2810.446) (-2809.449) [-2809.284] -- 0:01:12
      568000 -- (-2807.080) (-2807.673) (-2811.933) [-2803.891] * (-2816.560) (-2805.206) [-2812.594] (-2806.173) -- 0:01:12
      568500 -- (-2809.823) (-2806.865) [-2810.248] (-2810.291) * (-2805.935) [-2809.980] (-2806.014) (-2811.424) -- 0:01:12
      569000 -- [-2807.129] (-2810.083) (-2817.015) (-2808.934) * (-2807.690) (-2823.582) [-2811.787] (-2804.420) -- 0:01:11
      569500 -- (-2811.618) [-2812.786] (-2812.967) (-2809.615) * (-2811.370) (-2809.401) [-2810.158] (-2813.315) -- 0:01:12
      570000 -- [-2812.641] (-2807.028) (-2804.586) (-2808.959) * (-2810.679) [-2808.411] (-2806.390) (-2807.487) -- 0:01:12

      Average standard deviation of split frequencies: 0.035796

      570500 -- (-2810.440) (-2809.419) (-2813.396) [-2807.491] * (-2811.896) (-2810.996) [-2805.412] (-2808.955) -- 0:01:12
      571000 -- (-2807.600) (-2808.745) [-2808.134] (-2808.106) * (-2814.412) (-2811.982) [-2811.584] (-2806.459) -- 0:01:12
      571500 -- (-2807.106) (-2807.142) [-2814.406] (-2809.122) * [-2809.708] (-2814.424) (-2814.946) (-2810.045) -- 0:01:11
      572000 -- (-2812.821) (-2806.807) [-2806.973] (-2822.685) * (-2808.129) (-2813.694) [-2807.798] (-2818.510) -- 0:01:11
      572500 -- (-2815.347) (-2807.651) [-2807.558] (-2804.888) * (-2811.719) (-2813.960) [-2809.817] (-2812.312) -- 0:01:11
      573000 -- [-2814.182] (-2812.812) (-2818.883) (-2814.152) * [-2809.152] (-2812.098) (-2803.772) (-2809.840) -- 0:01:11
      573500 -- [-2811.780] (-2805.761) (-2808.619) (-2811.893) * [-2808.257] (-2811.122) (-2815.554) (-2806.309) -- 0:01:11
      574000 -- (-2809.049) (-2810.000) (-2816.185) [-2811.888] * (-2808.219) (-2812.147) (-2813.319) [-2808.990] -- 0:01:11
      574500 -- (-2808.817) [-2816.383] (-2811.205) (-2804.746) * (-2806.621) (-2812.402) (-2813.061) [-2808.993] -- 0:01:11
      575000 -- (-2810.935) (-2819.926) (-2813.850) [-2813.306] * [-2808.773] (-2814.226) (-2811.334) (-2811.723) -- 0:01:10

      Average standard deviation of split frequencies: 0.036556

      575500 -- (-2810.292) (-2827.681) (-2808.865) [-2809.279] * (-2821.989) (-2811.859) (-2809.938) [-2808.569] -- 0:01:11
      576000 -- [-2804.994] (-2815.606) (-2808.933) (-2822.045) * (-2811.635) (-2807.729) [-2820.803] (-2811.968) -- 0:01:11
      576500 -- (-2811.453) [-2812.859] (-2806.138) (-2816.724) * (-2808.211) (-2809.595) (-2811.344) [-2810.611] -- 0:01:11
      577000 -- [-2809.286] (-2808.855) (-2805.063) (-2812.103) * (-2807.072) (-2808.175) (-2811.316) [-2808.009] -- 0:01:11
      577500 -- [-2812.794] (-2813.496) (-2808.120) (-2814.860) * (-2811.623) [-2805.179] (-2811.699) (-2811.867) -- 0:01:10
      578000 -- (-2810.459) [-2808.169] (-2812.265) (-2808.609) * [-2811.565] (-2806.452) (-2811.020) (-2809.222) -- 0:01:10
      578500 -- (-2806.520) [-2812.454] (-2811.442) (-2817.333) * [-2812.212] (-2810.302) (-2816.404) (-2807.188) -- 0:01:10
      579000 -- (-2808.267) (-2810.243) (-2808.770) [-2813.253] * (-2810.953) (-2817.959) [-2808.391] (-2807.908) -- 0:01:10
      579500 -- (-2815.558) (-2816.727) (-2814.543) [-2809.107] * (-2815.709) (-2806.752) (-2812.395) [-2806.882] -- 0:01:10
      580000 -- [-2812.006] (-2822.376) (-2807.960) (-2809.813) * (-2815.982) (-2804.931) [-2811.720] (-2815.090) -- 0:01:10

      Average standard deviation of split frequencies: 0.035721

      580500 -- [-2805.364] (-2817.015) (-2808.294) (-2816.959) * (-2813.994) (-2813.653) [-2811.502] (-2813.655) -- 0:01:10
      581000 -- (-2805.279) (-2813.121) (-2814.301) [-2808.612] * (-2811.092) (-2810.280) [-2809.547] (-2812.829) -- 0:01:10
      581500 -- (-2804.602) (-2810.680) [-2810.068] (-2815.192) * (-2816.439) (-2806.388) (-2812.395) [-2811.502] -- 0:01:10
      582000 -- [-2808.637] (-2809.494) (-2812.071) (-2809.409) * (-2807.619) (-2807.817) [-2807.348] (-2811.340) -- 0:01:10
      582500 -- [-2810.224] (-2807.777) (-2808.893) (-2807.067) * (-2809.910) (-2815.540) (-2811.874) [-2808.678] -- 0:01:10
      583000 -- (-2817.694) [-2810.558] (-2811.493) (-2809.989) * (-2813.446) (-2808.406) (-2813.138) [-2808.223] -- 0:01:10
      583500 -- [-2811.028] (-2809.406) (-2814.435) (-2811.861) * (-2805.170) (-2805.536) (-2810.207) [-2806.832] -- 0:01:09
      584000 -- (-2809.158) (-2810.210) [-2812.321] (-2809.102) * (-2808.250) (-2812.888) (-2822.343) [-2804.681] -- 0:01:09
      584500 -- [-2811.440] (-2806.772) (-2814.608) (-2809.798) * [-2810.194] (-2810.201) (-2817.282) (-2810.376) -- 0:01:09
      585000 -- (-2805.330) (-2809.686) (-2809.700) [-2804.932] * [-2812.214] (-2817.924) (-2813.064) (-2805.765) -- 0:01:09

      Average standard deviation of split frequencies: 0.035932

      585500 -- (-2812.331) (-2806.591) [-2816.142] (-2809.344) * (-2808.797) [-2806.929] (-2807.347) (-2809.156) -- 0:01:09
      586000 -- [-2809.597] (-2810.989) (-2814.135) (-2808.269) * (-2818.884) [-2805.750] (-2804.235) (-2808.731) -- 0:01:09
      586500 -- (-2809.508) [-2810.297] (-2809.618) (-2813.481) * (-2811.117) (-2808.876) [-2808.070] (-2811.300) -- 0:01:09
      587000 -- (-2805.337) (-2805.815) (-2814.855) [-2809.327] * [-2807.277] (-2813.246) (-2811.502) (-2814.452) -- 0:01:09
      587500 -- [-2805.289] (-2811.758) (-2803.836) (-2810.051) * [-2808.340] (-2807.196) (-2806.853) (-2810.580) -- 0:01:09
      588000 -- (-2812.834) [-2806.211] (-2809.237) (-2807.867) * (-2817.802) [-2807.934] (-2812.723) (-2806.928) -- 0:01:09
      588500 -- (-2815.251) (-2809.637) (-2813.296) [-2807.543] * (-2810.233) (-2813.248) [-2812.677] (-2810.433) -- 0:01:09
      589000 -- (-2808.808) (-2813.985) [-2812.701] (-2812.551) * (-2814.719) (-2820.303) [-2808.922] (-2804.305) -- 0:01:09
      589500 -- (-2816.962) [-2812.636] (-2811.961) (-2813.687) * (-2807.103) (-2816.929) (-2817.035) [-2810.411] -- 0:01:08
      590000 -- (-2813.027) (-2813.535) (-2811.242) [-2811.058] * (-2812.741) [-2811.886] (-2814.538) (-2807.012) -- 0:01:08

      Average standard deviation of split frequencies: 0.036180

      590500 -- [-2806.648] (-2813.311) (-2809.148) (-2806.602) * [-2803.308] (-2811.867) (-2813.849) (-2810.930) -- 0:01:08
      591000 -- (-2805.650) (-2813.788) (-2814.637) [-2807.958] * (-2816.320) (-2810.622) [-2809.710] (-2809.321) -- 0:01:08
      591500 -- (-2806.676) [-2811.994] (-2816.582) (-2806.699) * [-2812.351] (-2814.585) (-2820.039) (-2811.115) -- 0:01:08
      592000 -- (-2811.657) (-2805.826) [-2807.797] (-2806.998) * (-2809.089) [-2814.544] (-2812.704) (-2814.615) -- 0:01:08
      592500 -- (-2807.324) (-2809.551) (-2808.617) [-2815.402] * [-2813.056] (-2806.548) (-2813.620) (-2809.584) -- 0:01:08
      593000 -- (-2808.035) [-2805.625] (-2809.123) (-2809.242) * (-2805.525) (-2813.727) (-2819.289) [-2812.088] -- 0:01:08
      593500 -- (-2810.231) [-2805.754] (-2813.135) (-2808.297) * (-2814.294) [-2805.782] (-2818.689) (-2811.019) -- 0:01:08
      594000 -- (-2806.012) (-2812.450) (-2813.128) [-2806.023] * [-2810.282] (-2808.347) (-2810.201) (-2815.184) -- 0:01:08
      594500 -- (-2812.456) [-2811.946] (-2807.563) (-2807.410) * [-2809.022] (-2806.688) (-2810.168) (-2814.444) -- 0:01:08
      595000 -- (-2810.690) (-2815.378) (-2809.552) [-2807.166] * (-2808.410) (-2813.913) (-2806.985) [-2812.903] -- 0:01:08

      Average standard deviation of split frequencies: 0.037965

      595500 -- (-2812.930) (-2807.516) (-2814.455) [-2805.258] * [-2810.859] (-2816.628) (-2809.896) (-2812.031) -- 0:01:07
      596000 -- (-2806.784) (-2810.750) [-2817.839] (-2809.291) * (-2817.385) (-2818.788) [-2810.232] (-2814.536) -- 0:01:07
      596500 -- [-2813.914] (-2805.384) (-2809.474) (-2814.714) * (-2823.798) (-2812.717) [-2809.552] (-2813.892) -- 0:01:07
      597000 -- [-2815.007] (-2809.670) (-2812.606) (-2817.763) * (-2817.746) (-2813.526) [-2807.746] (-2807.275) -- 0:01:07
      597500 -- (-2815.188) [-2810.687] (-2808.303) (-2818.483) * (-2817.210) (-2809.654) [-2805.536] (-2808.177) -- 0:01:07
      598000 -- (-2814.196) [-2809.663] (-2809.171) (-2815.209) * (-2819.999) (-2809.692) [-2808.334] (-2808.725) -- 0:01:07
      598500 -- (-2814.958) (-2809.112) [-2808.385] (-2806.471) * (-2819.169) (-2805.089) (-2810.333) [-2809.349] -- 0:01:07
      599000 -- (-2808.324) [-2801.708] (-2808.175) (-2811.976) * (-2817.834) (-2810.411) [-2810.285] (-2811.310) -- 0:01:07
      599500 -- (-2807.582) (-2813.882) (-2807.155) [-2811.485] * [-2816.638] (-2810.447) (-2818.144) (-2813.537) -- 0:01:07
      600000 -- [-2808.564] (-2808.413) (-2815.101) (-2814.517) * [-2810.324] (-2808.335) (-2823.221) (-2815.272) -- 0:01:07

      Average standard deviation of split frequencies: 0.038717

      600500 -- (-2811.319) (-2806.842) [-2812.050] (-2809.382) * (-2816.092) [-2807.562] (-2805.323) (-2810.395) -- 0:01:07
      601000 -- (-2806.240) [-2810.103] (-2808.914) (-2813.879) * (-2816.640) (-2803.972) [-2805.836] (-2813.002) -- 0:01:07
      601500 -- (-2805.916) (-2811.929) (-2810.788) [-2810.623] * (-2805.170) (-2812.225) [-2807.661] (-2820.486) -- 0:01:06
      602000 -- [-2806.174] (-2809.365) (-2817.713) (-2812.812) * (-2811.820) (-2811.614) [-2810.912] (-2811.123) -- 0:01:06
      602500 -- (-2807.436) (-2816.460) [-2810.361] (-2818.095) * (-2811.266) (-2812.787) [-2806.367] (-2812.227) -- 0:01:06
      603000 -- (-2817.859) (-2815.177) [-2806.725] (-2818.905) * [-2811.224] (-2809.104) (-2807.988) (-2810.794) -- 0:01:06
      603500 -- [-2816.073] (-2816.371) (-2816.862) (-2811.375) * (-2811.052) (-2808.869) [-2809.069] (-2816.459) -- 0:01:06
      604000 -- (-2813.049) [-2809.541] (-2812.831) (-2806.784) * (-2815.246) (-2809.893) [-2805.140] (-2809.819) -- 0:01:06
      604500 -- (-2817.611) (-2814.270) [-2807.621] (-2812.253) * (-2811.158) (-2811.768) [-2811.002] (-2804.206) -- 0:01:06
      605000 -- [-2808.789] (-2815.208) (-2807.475) (-2810.367) * (-2809.656) (-2809.081) (-2804.752) [-2807.746] -- 0:01:06

      Average standard deviation of split frequencies: 0.038895

      605500 -- (-2806.507) (-2821.836) [-2809.317] (-2810.323) * [-2813.320] (-2818.466) (-2814.591) (-2815.797) -- 0:01:06
      606000 -- [-2811.127] (-2808.558) (-2810.222) (-2808.575) * (-2814.577) (-2806.471) [-2811.964] (-2810.910) -- 0:01:06
      606500 -- (-2809.771) [-2807.366] (-2807.531) (-2807.398) * (-2807.541) [-2807.344] (-2818.526) (-2810.992) -- 0:01:06
      607000 -- (-2812.307) (-2808.305) [-2807.133] (-2815.459) * (-2806.742) [-2806.676] (-2811.115) (-2812.955) -- 0:01:06
      607500 -- (-2812.120) (-2808.060) [-2810.738] (-2808.215) * (-2811.951) [-2811.441] (-2816.697) (-2818.044) -- 0:01:05
      608000 -- (-2814.040) (-2806.569) [-2809.592] (-2813.407) * (-2812.947) [-2806.862] (-2817.021) (-2808.270) -- 0:01:05
      608500 -- (-2814.558) (-2811.254) [-2811.577] (-2814.434) * [-2809.608] (-2808.302) (-2816.492) (-2807.062) -- 0:01:05
      609000 -- (-2803.942) [-2806.980] (-2810.148) (-2810.042) * [-2805.292] (-2809.683) (-2816.355) (-2813.540) -- 0:01:05
      609500 -- [-2807.505] (-2814.291) (-2810.724) (-2807.235) * (-2813.890) [-2810.499] (-2808.645) (-2806.607) -- 0:01:05
      610000 -- (-2814.031) [-2807.676] (-2810.264) (-2807.459) * (-2812.356) (-2806.301) [-2809.461] (-2806.920) -- 0:01:05

      Average standard deviation of split frequencies: 0.038083

      610500 -- (-2810.942) [-2806.670] (-2809.968) (-2804.635) * (-2821.611) [-2813.209] (-2807.027) (-2811.385) -- 0:01:05
      611000 -- (-2807.185) [-2814.685] (-2804.000) (-2812.553) * (-2811.538) (-2813.296) (-2810.485) [-2806.260] -- 0:01:05
      611500 -- (-2811.905) (-2806.520) (-2812.195) [-2808.140] * (-2813.272) [-2804.583] (-2817.125) (-2805.921) -- 0:01:05
      612000 -- (-2816.963) (-2809.004) (-2808.517) [-2802.868] * (-2810.277) [-2809.615] (-2815.257) (-2816.401) -- 0:01:05
      612500 -- (-2816.159) (-2807.478) [-2809.420] (-2808.084) * (-2808.153) (-2813.256) [-2811.047] (-2810.372) -- 0:01:05
      613000 -- (-2806.673) (-2819.676) [-2808.751] (-2814.349) * (-2812.240) (-2806.492) (-2810.710) [-2808.865] -- 0:01:05
      613500 -- (-2806.784) [-2817.378] (-2817.061) (-2811.082) * (-2810.939) [-2805.859] (-2808.911) (-2809.604) -- 0:01:04
      614000 -- (-2808.392) (-2808.289) (-2813.451) [-2811.301] * (-2813.013) [-2804.837] (-2812.436) (-2816.714) -- 0:01:04
      614500 -- (-2813.444) [-2807.253] (-2812.145) (-2804.423) * [-2807.212] (-2807.759) (-2811.385) (-2806.173) -- 0:01:04
      615000 -- (-2808.171) (-2811.061) (-2810.237) [-2808.081] * [-2812.590] (-2811.987) (-2807.408) (-2809.179) -- 0:01:04

      Average standard deviation of split frequencies: 0.038263

      615500 -- (-2811.091) (-2807.168) (-2807.260) [-2809.171] * (-2815.614) (-2809.936) [-2816.731] (-2807.755) -- 0:01:04
      616000 -- [-2810.499] (-2811.549) (-2818.321) (-2812.192) * [-2808.660] (-2812.315) (-2812.851) (-2806.619) -- 0:01:04
      616500 -- [-2807.557] (-2808.986) (-2807.833) (-2810.676) * (-2805.565) (-2808.574) [-2813.488] (-2811.657) -- 0:01:04
      617000 -- (-2810.921) (-2810.523) [-2805.207] (-2810.591) * (-2809.963) (-2811.555) (-2805.718) [-2807.716] -- 0:01:04
      617500 -- [-2812.498] (-2817.548) (-2805.787) (-2811.989) * (-2811.936) (-2811.398) [-2809.962] (-2818.166) -- 0:01:04
      618000 -- (-2807.535) (-2809.453) [-2810.867] (-2814.882) * (-2810.937) [-2803.296] (-2807.528) (-2812.740) -- 0:01:04
      618500 -- (-2808.413) [-2810.944] (-2810.232) (-2809.519) * (-2811.485) (-2811.074) (-2814.475) [-2810.344] -- 0:01:04
      619000 -- (-2812.500) (-2822.277) (-2808.897) [-2809.006] * [-2810.275] (-2810.227) (-2811.021) (-2821.029) -- 0:01:04
      619500 -- (-2812.548) (-2813.260) (-2806.703) [-2811.314] * (-2812.858) (-2808.291) (-2806.725) [-2812.131] -- 0:01:03
      620000 -- (-2809.113) (-2814.862) (-2813.279) [-2807.847] * [-2807.110] (-2805.916) (-2809.017) (-2807.659) -- 0:01:03

      Average standard deviation of split frequencies: 0.036457

      620500 -- (-2810.119) (-2808.953) (-2816.069) [-2809.274] * (-2811.919) [-2809.267] (-2812.342) (-2813.605) -- 0:01:03
      621000 -- (-2811.062) [-2810.279] (-2811.044) (-2814.615) * (-2808.699) (-2809.974) [-2808.113] (-2806.399) -- 0:01:03
      621500 -- (-2815.487) (-2812.133) [-2810.388] (-2809.363) * (-2808.010) [-2809.975] (-2806.580) (-2807.125) -- 0:01:03
      622000 -- [-2806.306] (-2807.632) (-2813.296) (-2807.442) * (-2809.630) (-2804.403) (-2808.551) [-2807.806] -- 0:01:03
      622500 -- [-2820.015] (-2811.887) (-2812.597) (-2811.893) * (-2814.914) (-2812.053) [-2814.853] (-2807.651) -- 0:01:03
      623000 -- [-2811.328] (-2816.484) (-2808.831) (-2810.046) * [-2809.733] (-2807.322) (-2806.912) (-2808.082) -- 0:01:03
      623500 -- (-2803.805) [-2805.765] (-2809.287) (-2816.791) * (-2809.830) (-2810.425) [-2806.377] (-2811.184) -- 0:01:03
      624000 -- [-2807.365] (-2811.061) (-2813.608) (-2814.405) * (-2822.539) [-2813.437] (-2805.931) (-2808.527) -- 0:01:03
      624500 -- (-2807.479) (-2814.010) (-2807.546) [-2809.408] * (-2816.214) (-2810.076) (-2808.213) [-2806.065] -- 0:01:03
      625000 -- (-2805.593) (-2825.716) [-2811.834] (-2814.017) * (-2820.700) (-2812.751) (-2807.278) [-2807.959] -- 0:01:03

      Average standard deviation of split frequencies: 0.036146

      625500 -- (-2809.533) (-2811.066) [-2808.559] (-2808.497) * (-2824.816) (-2814.954) [-2806.250] (-2817.186) -- 0:01:02
      626000 -- [-2813.681] (-2813.330) (-2813.376) (-2812.962) * (-2811.646) (-2809.691) [-2809.088] (-2811.143) -- 0:01:02
      626500 -- [-2807.244] (-2809.084) (-2817.285) (-2812.577) * (-2814.874) [-2813.601] (-2807.476) (-2809.215) -- 0:01:02
      627000 -- (-2805.066) (-2814.234) (-2806.627) [-2810.024] * (-2815.536) [-2804.731] (-2811.446) (-2808.499) -- 0:01:02
      627500 -- (-2814.753) (-2808.480) (-2809.463) [-2813.076] * (-2814.789) (-2811.679) [-2813.245] (-2817.019) -- 0:01:02
      628000 -- [-2809.785] (-2811.962) (-2812.248) (-2816.620) * (-2806.354) [-2809.973] (-2806.764) (-2809.537) -- 0:01:02
      628500 -- [-2808.125] (-2813.059) (-2807.554) (-2808.581) * (-2810.070) [-2808.089] (-2807.617) (-2812.818) -- 0:01:02
      629000 -- (-2811.082) (-2807.128) [-2808.307] (-2805.181) * (-2811.151) [-2806.606] (-2811.554) (-2806.816) -- 0:01:02
      629500 -- (-2812.690) (-2806.750) [-2810.474] (-2806.508) * (-2810.454) (-2810.235) [-2804.998] (-2806.215) -- 0:01:02
      630000 -- [-2809.249] (-2810.769) (-2811.090) (-2814.983) * (-2814.883) (-2819.039) (-2816.612) [-2805.145] -- 0:01:02

      Average standard deviation of split frequencies: 0.035879

      630500 -- (-2808.719) (-2809.459) (-2807.848) [-2809.294] * (-2812.469) [-2806.000] (-2809.690) (-2812.629) -- 0:01:02
      631000 -- (-2814.050) (-2811.939) (-2810.151) [-2803.724] * (-2814.475) (-2813.872) (-2812.420) [-2806.631] -- 0:01:01
      631500 -- (-2809.897) (-2808.298) (-2814.694) [-2810.147] * (-2810.496) [-2806.555] (-2813.904) (-2812.830) -- 0:01:01
      632000 -- [-2813.489] (-2807.365) (-2805.531) (-2817.669) * (-2812.300) (-2808.260) (-2817.949) [-2814.778] -- 0:01:01
      632500 -- (-2813.147) [-2810.554] (-2811.827) (-2807.367) * [-2812.274] (-2806.034) (-2812.900) (-2807.647) -- 0:01:01
      633000 -- [-2804.165] (-2815.135) (-2807.706) (-2807.741) * (-2810.057) (-2812.407) (-2815.458) [-2808.425] -- 0:01:01
      633500 -- (-2816.581) [-2809.781] (-2806.626) (-2808.115) * (-2809.101) (-2812.187) (-2807.605) [-2815.532] -- 0:01:01
      634000 -- (-2810.233) [-2805.865] (-2811.469) (-2811.737) * (-2812.625) [-2813.095] (-2810.908) (-2815.074) -- 0:01:01
      634500 -- (-2809.105) (-2809.555) [-2811.531] (-2805.924) * (-2816.060) (-2813.071) [-2815.734] (-2813.942) -- 0:01:01
      635000 -- (-2814.442) (-2807.760) (-2806.801) [-2805.529] * (-2808.902) [-2813.822] (-2806.382) (-2822.368) -- 0:01:01

      Average standard deviation of split frequencies: 0.034095

      635500 -- (-2818.908) (-2806.559) (-2814.265) [-2806.132] * [-2811.043] (-2813.550) (-2814.714) (-2814.456) -- 0:01:01
      636000 -- (-2820.801) [-2809.810] (-2806.469) (-2807.445) * (-2813.441) [-2808.000] (-2806.281) (-2812.846) -- 0:01:01
      636500 -- (-2813.833) (-2816.274) [-2817.724] (-2808.662) * (-2809.298) (-2807.842) (-2810.063) [-2810.357] -- 0:01:01
      637000 -- (-2821.118) (-2813.007) (-2809.966) [-2810.366] * (-2809.369) (-2811.214) (-2805.516) [-2806.086] -- 0:01:00
      637500 -- (-2807.174) [-2813.023] (-2810.033) (-2814.357) * [-2810.380] (-2813.231) (-2807.355) (-2807.919) -- 0:01:00
      638000 -- (-2805.982) (-2813.226) (-2810.461) [-2809.080] * [-2807.261] (-2808.995) (-2807.097) (-2805.176) -- 0:01:00
      638500 -- (-2805.920) (-2813.122) [-2807.485] (-2809.822) * (-2816.210) (-2805.717) [-2807.171] (-2806.452) -- 0:01:00
      639000 -- (-2804.130) [-2811.170] (-2809.734) (-2810.151) * [-2812.976] (-2810.610) (-2809.442) (-2807.001) -- 0:01:00
      639500 -- (-2809.624) [-2808.025] (-2807.231) (-2813.481) * (-2817.124) [-2808.309] (-2818.222) (-2808.539) -- 0:01:00
      640000 -- (-2808.144) (-2807.043) (-2812.586) [-2817.786] * (-2819.091) (-2810.489) [-2812.417] (-2806.694) -- 0:01:00

      Average standard deviation of split frequencies: 0.035319

      640500 -- (-2813.904) [-2807.973] (-2809.068) (-2812.897) * (-2816.249) (-2809.209) [-2810.344] (-2810.998) -- 0:01:00
      641000 -- (-2811.482) (-2806.467) [-2812.226] (-2810.489) * (-2806.838) (-2812.115) (-2815.503) [-2811.024] -- 0:01:00
      641500 -- (-2812.396) (-2807.793) [-2809.502] (-2806.994) * [-2808.721] (-2812.124) (-2808.588) (-2808.247) -- 0:01:00
      642000 -- (-2819.193) (-2809.874) (-2810.435) [-2807.720] * (-2811.772) [-2808.599] (-2808.035) (-2809.395) -- 0:01:00
      642500 -- (-2815.828) [-2810.397] (-2814.065) (-2813.084) * (-2810.298) (-2812.983) [-2807.933] (-2811.288) -- 0:01:00
      643000 -- [-2808.957] (-2807.883) (-2810.190) (-2809.219) * (-2813.486) (-2812.499) [-2813.379] (-2811.783) -- 0:00:59
      643500 -- (-2807.553) [-2806.075] (-2809.545) (-2811.170) * (-2809.747) (-2806.176) (-2808.818) [-2809.292] -- 0:00:59
      644000 -- (-2811.260) (-2808.975) [-2808.714] (-2811.883) * (-2811.646) (-2808.602) (-2805.380) [-2811.219] -- 0:00:59
      644500 -- [-2813.869] (-2808.557) (-2808.141) (-2807.953) * (-2810.584) (-2811.685) [-2806.194] (-2807.801) -- 0:00:59
      645000 -- (-2809.690) (-2810.038) (-2812.292) [-2804.499] * (-2810.158) [-2812.371] (-2809.692) (-2809.014) -- 0:00:59

      Average standard deviation of split frequencies: 0.035027

      645500 -- (-2816.888) [-2810.378] (-2809.319) (-2804.232) * (-2810.885) (-2807.901) [-2807.765] (-2810.319) -- 0:00:59
      646000 -- (-2819.736) [-2810.135] (-2811.782) (-2820.981) * [-2809.805] (-2808.763) (-2810.117) (-2807.616) -- 0:00:59
      646500 -- (-2807.733) (-2808.317) [-2808.697] (-2808.234) * (-2818.444) [-2805.092] (-2805.550) (-2813.209) -- 0:00:59
      647000 -- (-2807.928) (-2808.709) [-2809.926] (-2810.673) * [-2814.799] (-2810.911) (-2807.134) (-2807.873) -- 0:00:59
      647500 -- (-2808.540) (-2810.133) (-2804.596) [-2812.974] * (-2810.470) (-2810.416) (-2811.113) [-2809.222] -- 0:00:59
      648000 -- [-2808.003] (-2807.364) (-2818.747) (-2812.625) * (-2805.800) (-2810.341) [-2809.260] (-2811.419) -- 0:00:59
      648500 -- (-2813.410) (-2806.483) (-2817.062) [-2815.223] * (-2807.276) [-2807.716] (-2815.057) (-2818.116) -- 0:00:59
      649000 -- [-2804.520] (-2805.495) (-2813.390) (-2815.116) * (-2809.413) (-2806.381) (-2807.687) [-2804.227] -- 0:00:58
      649500 -- (-2808.819) (-2807.589) [-2810.957] (-2807.639) * (-2814.720) (-2811.967) [-2808.324] (-2807.489) -- 0:00:58
      650000 -- [-2806.739] (-2812.587) (-2812.531) (-2807.380) * (-2808.317) (-2813.808) (-2811.826) [-2808.248] -- 0:00:58

      Average standard deviation of split frequencies: 0.035259

      650500 -- (-2805.518) (-2811.492) [-2811.530] (-2810.644) * (-2810.476) (-2809.765) [-2807.186] (-2807.618) -- 0:00:58
      651000 -- (-2811.893) [-2805.323] (-2807.683) (-2809.884) * (-2807.152) (-2813.408) [-2810.909] (-2810.111) -- 0:00:58
      651500 -- (-2810.392) (-2808.332) [-2807.989] (-2808.723) * [-2811.282] (-2823.460) (-2809.080) (-2810.257) -- 0:00:58
      652000 -- (-2811.762) (-2806.647) [-2807.273] (-2811.392) * [-2810.754] (-2814.540) (-2806.203) (-2812.571) -- 0:00:58
      652500 -- (-2811.624) (-2811.344) (-2812.968) [-2818.197] * (-2806.375) [-2813.584] (-2807.791) (-2815.438) -- 0:00:58
      653000 -- [-2814.391] (-2815.646) (-2814.244) (-2814.226) * (-2812.025) (-2804.833) [-2806.844] (-2807.584) -- 0:00:58
      653500 -- (-2806.886) (-2806.485) (-2809.387) [-2806.179] * [-2813.183] (-2810.723) (-2810.807) (-2811.570) -- 0:00:58
      654000 -- (-2808.070) (-2805.639) (-2814.682) [-2807.860] * (-2813.477) (-2810.371) (-2809.533) [-2809.512] -- 0:00:58
      654500 -- [-2816.232] (-2813.873) (-2810.238) (-2809.240) * (-2811.076) (-2811.813) (-2808.659) [-2811.513] -- 0:00:58
      655000 -- (-2811.590) [-2807.410] (-2815.861) (-2814.201) * (-2812.272) (-2813.511) [-2810.302] (-2807.387) -- 0:00:57

      Average standard deviation of split frequencies: 0.034493

      655500 -- (-2816.206) (-2809.099) (-2815.246) [-2805.578] * [-2809.147] (-2812.680) (-2812.291) (-2807.755) -- 0:00:57
      656000 -- (-2813.046) [-2812.974] (-2812.886) (-2814.170) * [-2815.017] (-2810.587) (-2812.380) (-2807.515) -- 0:00:57
      656500 -- [-2813.208] (-2809.291) (-2808.407) (-2812.386) * (-2807.664) [-2812.482] (-2811.240) (-2810.657) -- 0:00:57
      657000 -- (-2809.012) (-2807.172) [-2807.071] (-2812.480) * (-2806.319) (-2814.949) [-2810.453] (-2809.094) -- 0:00:57
      657500 -- (-2809.510) [-2804.843] (-2806.091) (-2814.758) * (-2813.731) (-2810.617) (-2806.840) [-2807.378] -- 0:00:57
      658000 -- [-2806.492] (-2811.933) (-2812.432) (-2813.393) * (-2811.599) (-2808.451) (-2809.506) [-2810.751] -- 0:00:57
      658500 -- (-2816.778) (-2809.848) (-2808.951) [-2811.709] * (-2811.678) (-2810.322) [-2811.386] (-2806.889) -- 0:00:57
      659000 -- (-2815.075) [-2809.502] (-2814.743) (-2808.341) * [-2809.879] (-2813.665) (-2805.168) (-2811.474) -- 0:00:57
      659500 -- [-2811.982] (-2811.863) (-2810.023) (-2809.513) * (-2813.750) [-2811.199] (-2814.060) (-2811.116) -- 0:00:57
      660000 -- (-2807.514) (-2814.475) [-2812.261] (-2817.416) * [-2812.297] (-2803.355) (-2821.894) (-2812.212) -- 0:00:57

      Average standard deviation of split frequencies: 0.033774

      660500 -- (-2809.161) (-2805.784) [-2806.401] (-2818.028) * (-2812.519) (-2806.389) [-2809.116] (-2810.693) -- 0:00:57
      661000 -- [-2808.770] (-2811.013) (-2811.957) (-2804.362) * (-2811.606) (-2807.155) [-2809.191] (-2804.707) -- 0:00:56
      661500 -- (-2815.039) [-2816.303] (-2807.939) (-2809.553) * (-2815.893) (-2812.025) (-2816.602) [-2810.640] -- 0:00:56
      662000 -- [-2810.193] (-2812.466) (-2816.764) (-2807.616) * [-2809.445] (-2808.387) (-2805.519) (-2810.521) -- 0:00:56
      662500 -- [-2806.358] (-2811.189) (-2805.986) (-2819.340) * (-2813.539) (-2811.889) [-2808.449] (-2809.531) -- 0:00:56
      663000 -- (-2811.920) [-2812.791] (-2808.853) (-2811.112) * (-2813.104) (-2806.033) [-2810.981] (-2808.823) -- 0:00:56
      663500 -- (-2811.275) (-2810.683) (-2808.819) [-2818.586] * (-2813.549) [-2811.296] (-2813.600) (-2814.912) -- 0:00:56
      664000 -- (-2809.356) (-2819.551) [-2806.566] (-2808.944) * (-2812.843) [-2808.447] (-2816.491) (-2813.361) -- 0:00:56
      664500 -- (-2810.441) (-2808.992) [-2804.670] (-2812.787) * (-2810.701) (-2807.736) [-2808.827] (-2809.648) -- 0:00:56
      665000 -- (-2809.480) (-2816.193) [-2807.600] (-2810.475) * [-2807.785] (-2813.162) (-2814.315) (-2809.097) -- 0:00:56

      Average standard deviation of split frequencies: 0.032559

      665500 -- (-2808.339) [-2812.149] (-2808.968) (-2815.984) * (-2809.480) [-2805.422] (-2818.425) (-2812.209) -- 0:00:56
      666000 -- (-2813.049) (-2810.179) (-2813.925) [-2813.948] * (-2809.192) (-2809.954) [-2811.324] (-2816.063) -- 0:00:56
      666500 -- (-2810.203) (-2811.396) [-2808.768] (-2808.352) * (-2809.654) (-2806.347) [-2813.166] (-2812.142) -- 0:00:56
      667000 -- (-2809.698) [-2817.679] (-2814.750) (-2810.596) * (-2808.354) [-2813.275] (-2814.259) (-2811.127) -- 0:00:55
      667500 -- [-2809.188] (-2812.521) (-2815.834) (-2817.151) * (-2807.908) (-2809.687) (-2810.255) [-2817.705] -- 0:00:55
      668000 -- [-2814.502] (-2819.937) (-2811.175) (-2807.653) * [-2810.694] (-2805.570) (-2816.098) (-2810.659) -- 0:00:55
      668500 -- (-2811.102) (-2805.645) (-2819.284) [-2806.581] * (-2811.689) (-2806.982) (-2808.497) [-2805.862] -- 0:00:55
      669000 -- [-2806.672] (-2806.534) (-2819.383) (-2812.576) * [-2808.912] (-2808.700) (-2809.201) (-2812.946) -- 0:00:55
      669500 -- (-2813.921) [-2813.632] (-2818.038) (-2808.400) * [-2812.767] (-2811.446) (-2808.427) (-2809.036) -- 0:00:55
      670000 -- (-2809.737) (-2816.866) [-2813.926] (-2810.453) * (-2811.419) [-2806.302] (-2813.004) (-2810.944) -- 0:00:55

      Average standard deviation of split frequencies: 0.034676

      670500 -- (-2807.219) (-2808.574) (-2813.088) [-2807.446] * [-2810.761] (-2810.466) (-2815.113) (-2805.523) -- 0:00:55
      671000 -- [-2804.660] (-2819.117) (-2807.144) (-2813.930) * [-2809.093] (-2808.745) (-2809.795) (-2808.026) -- 0:00:55
      671500 -- (-2811.142) (-2811.738) (-2815.621) [-2809.668] * (-2804.174) (-2808.626) [-2813.929] (-2811.271) -- 0:00:55
      672000 -- [-2810.486] (-2813.011) (-2808.226) (-2810.740) * [-2813.405] (-2810.546) (-2813.708) (-2811.993) -- 0:00:55
      672500 -- (-2809.277) [-2813.816] (-2807.947) (-2812.169) * [-2806.176] (-2808.240) (-2813.955) (-2808.879) -- 0:00:55
      673000 -- (-2809.140) (-2807.826) (-2811.861) [-2807.905] * (-2814.396) [-2807.824] (-2813.668) (-2808.370) -- 0:00:54
      673500 -- (-2807.370) (-2806.117) [-2806.161] (-2809.853) * (-2807.328) (-2807.669) (-2811.777) [-2808.405] -- 0:00:54
      674000 -- [-2807.904] (-2810.454) (-2813.377) (-2810.967) * (-2807.973) [-2808.926] (-2813.840) (-2806.513) -- 0:00:54
      674500 -- (-2812.234) (-2810.655) (-2813.496) [-2808.067] * (-2811.408) [-2810.055] (-2811.479) (-2814.822) -- 0:00:54
      675000 -- (-2809.889) [-2806.040] (-2808.608) (-2808.958) * [-2808.284] (-2815.078) (-2812.253) (-2809.242) -- 0:00:54

      Average standard deviation of split frequencies: 0.033008

      675500 -- [-2807.938] (-2813.068) (-2816.906) (-2812.679) * [-2811.918] (-2809.569) (-2809.461) (-2808.642) -- 0:00:54
      676000 -- (-2816.386) [-2806.738] (-2815.733) (-2816.969) * (-2811.800) (-2814.051) (-2807.292) [-2809.384] -- 0:00:54
      676500 -- (-2811.235) (-2810.433) (-2809.442) [-2814.361] * [-2810.167] (-2812.914) (-2807.369) (-2809.581) -- 0:00:54
      677000 -- [-2806.660] (-2811.762) (-2810.883) (-2808.153) * (-2810.543) [-2811.938] (-2810.289) (-2805.725) -- 0:00:54
      677500 -- (-2813.457) (-2807.461) [-2808.578] (-2813.691) * [-2811.890] (-2812.591) (-2809.848) (-2808.576) -- 0:00:54
      678000 -- (-2807.497) (-2811.172) (-2813.220) [-2808.948] * [-2811.148] (-2816.478) (-2819.572) (-2810.082) -- 0:00:54
      678500 -- (-2816.273) (-2810.211) (-2810.492) [-2807.557] * (-2816.249) (-2806.344) (-2813.406) [-2808.225] -- 0:00:54
      679000 -- (-2805.488) (-2812.998) [-2809.219] (-2812.198) * (-2815.098) (-2811.484) (-2809.598) [-2809.500] -- 0:00:53
      679500 -- (-2810.050) (-2815.796) [-2806.202] (-2810.447) * (-2816.050) (-2809.077) [-2809.340] (-2811.639) -- 0:00:53
      680000 -- (-2812.370) (-2809.304) (-2810.865) [-2810.475] * (-2811.549) [-2808.178] (-2818.295) (-2814.290) -- 0:00:53

      Average standard deviation of split frequencies: 0.033243

      680500 -- (-2807.406) (-2810.910) [-2814.249] (-2813.963) * (-2812.403) (-2810.634) (-2812.016) [-2807.324] -- 0:00:53
      681000 -- [-2809.118] (-2812.332) (-2811.344) (-2818.381) * (-2818.643) [-2816.025] (-2811.314) (-2809.297) -- 0:00:53
      681500 -- [-2804.504] (-2813.695) (-2813.693) (-2806.646) * [-2806.343] (-2806.358) (-2814.712) (-2806.985) -- 0:00:53
      682000 -- (-2810.893) (-2807.389) [-2810.183] (-2815.512) * [-2804.750] (-2812.377) (-2815.038) (-2809.750) -- 0:00:53
      682500 -- [-2807.914] (-2814.651) (-2809.900) (-2808.743) * (-2806.979) (-2808.740) (-2815.962) [-2811.269] -- 0:00:53
      683000 -- (-2808.220) (-2817.956) [-2810.035] (-2806.670) * (-2811.779) (-2808.977) (-2807.801) [-2809.120] -- 0:00:53
      683500 -- (-2809.521) (-2813.694) (-2810.677) [-2808.117] * (-2812.299) (-2811.559) (-2812.773) [-2809.265] -- 0:00:53
      684000 -- [-2808.177] (-2808.695) (-2808.824) (-2812.652) * (-2816.906) [-2805.863] (-2809.043) (-2808.554) -- 0:00:53
      684500 -- (-2812.633) [-2806.401] (-2812.713) (-2806.924) * (-2808.775) (-2813.081) [-2808.474] (-2808.921) -- 0:00:53
      685000 -- (-2809.478) [-2805.507] (-2807.350) (-2806.315) * (-2808.616) [-2814.344] (-2807.925) (-2818.805) -- 0:00:52

      Average standard deviation of split frequencies: 0.032985

      685500 -- (-2813.552) [-2808.656] (-2811.077) (-2809.682) * [-2806.993] (-2809.179) (-2814.571) (-2810.162) -- 0:00:52
      686000 -- (-2810.588) (-2809.052) (-2807.719) [-2813.156] * [-2806.767] (-2807.892) (-2807.460) (-2811.256) -- 0:00:52
      686500 -- (-2816.116) (-2807.041) [-2806.313] (-2807.546) * (-2817.011) (-2808.142) [-2808.264] (-2812.265) -- 0:00:52
      687000 -- (-2812.707) (-2807.956) (-2814.679) [-2807.177] * (-2811.074) [-2810.774] (-2807.212) (-2806.293) -- 0:00:52
      687500 -- (-2815.429) (-2821.126) [-2807.339] (-2807.576) * (-2816.813) [-2810.917] (-2807.905) (-2813.957) -- 0:00:52
      688000 -- (-2812.468) (-2809.728) (-2807.630) [-2818.622] * (-2814.833) [-2809.640] (-2804.718) (-2809.100) -- 0:00:52
      688500 -- (-2811.288) (-2806.977) [-2807.161] (-2810.988) * (-2810.371) (-2816.057) (-2813.308) [-2806.184] -- 0:00:52
      689000 -- [-2808.945] (-2808.710) (-2805.238) (-2812.152) * (-2817.155) [-2811.537] (-2816.218) (-2810.903) -- 0:00:52
      689500 -- (-2811.303) (-2808.177) [-2807.715] (-2806.818) * (-2813.078) (-2805.808) [-2814.554] (-2821.028) -- 0:00:52
      690000 -- (-2811.477) (-2810.307) [-2810.591] (-2811.840) * (-2811.921) (-2812.369) (-2811.960) [-2809.349] -- 0:00:52

      Average standard deviation of split frequencies: 0.034127

      690500 -- (-2810.890) [-2808.649] (-2811.274) (-2807.856) * [-2808.158] (-2810.038) (-2807.409) (-2810.976) -- 0:00:51
      691000 -- (-2813.715) (-2811.528) [-2812.529] (-2806.642) * [-2810.188] (-2809.225) (-2805.778) (-2806.816) -- 0:00:51
      691500 -- (-2816.397) [-2812.413] (-2814.041) (-2812.598) * (-2813.987) (-2809.666) [-2807.624] (-2806.291) -- 0:00:51
      692000 -- (-2809.081) (-2808.938) [-2817.460] (-2809.317) * (-2817.674) (-2810.278) [-2804.913] (-2813.817) -- 0:00:51
      692500 -- [-2813.398] (-2811.480) (-2809.361) (-2806.791) * (-2811.907) (-2808.021) [-2809.259] (-2806.745) -- 0:00:51
      693000 -- (-2807.049) (-2807.806) [-2814.004] (-2807.887) * (-2810.499) [-2812.561] (-2807.164) (-2811.525) -- 0:00:51
      693500 -- (-2808.194) (-2811.960) (-2807.033) [-2805.689] * [-2812.378] (-2811.047) (-2815.528) (-2812.818) -- 0:00:51
      694000 -- (-2815.620) (-2811.384) [-2805.373] (-2806.836) * [-2814.202] (-2815.038) (-2812.054) (-2810.531) -- 0:00:51
      694500 -- (-2815.097) (-2810.625) [-2806.398] (-2813.871) * [-2808.547] (-2805.852) (-2805.744) (-2810.273) -- 0:00:51
      695000 -- (-2806.673) (-2817.310) (-2810.032) [-2818.769] * (-2808.583) (-2817.914) (-2814.044) [-2817.521] -- 0:00:51

      Average standard deviation of split frequencies: 0.034768

      695500 -- (-2816.635) [-2808.093] (-2809.002) (-2812.748) * [-2813.221] (-2820.490) (-2816.500) (-2811.454) -- 0:00:51
      696000 -- [-2808.673] (-2815.405) (-2814.356) (-2811.879) * (-2819.922) [-2815.935] (-2811.150) (-2810.079) -- 0:00:51
      696500 -- [-2808.774] (-2810.705) (-2810.956) (-2812.901) * (-2821.765) [-2807.750] (-2812.741) (-2805.587) -- 0:00:50
      697000 -- [-2817.035] (-2810.619) (-2804.405) (-2811.548) * (-2819.098) (-2808.838) [-2807.930] (-2810.680) -- 0:00:50
      697500 -- (-2810.911) (-2813.922) (-2813.378) [-2811.341] * (-2811.420) [-2810.032] (-2810.275) (-2803.202) -- 0:00:50
      698000 -- (-2811.078) (-2815.935) [-2807.779] (-2814.054) * (-2808.771) (-2805.870) (-2809.772) [-2804.590] -- 0:00:50
      698500 -- (-2807.676) (-2812.357) [-2808.437] (-2807.560) * [-2808.675] (-2807.976) (-2813.054) (-2812.957) -- 0:00:50
      699000 -- (-2816.843) (-2804.738) [-2809.269] (-2807.710) * [-2809.621] (-2809.693) (-2808.528) (-2808.797) -- 0:00:50
      699500 -- (-2812.733) (-2811.958) [-2807.663] (-2809.882) * (-2811.026) [-2815.413] (-2818.637) (-2811.854) -- 0:00:50
      700000 -- (-2812.425) (-2810.966) [-2809.501] (-2811.776) * (-2810.859) (-2811.281) [-2813.360] (-2812.177) -- 0:00:50

      Average standard deviation of split frequencies: 0.032294

      700500 -- (-2813.084) (-2806.723) (-2811.342) [-2809.551] * (-2807.449) (-2806.793) [-2810.925] (-2813.638) -- 0:00:50
      701000 -- [-2806.615] (-2808.770) (-2811.022) (-2810.710) * (-2808.346) (-2808.023) [-2804.713] (-2817.697) -- 0:00:50
      701500 -- [-2805.460] (-2811.206) (-2815.424) (-2809.715) * (-2812.845) [-2814.203] (-2806.448) (-2814.943) -- 0:00:50
      702000 -- [-2811.909] (-2810.362) (-2814.751) (-2815.339) * (-2810.574) (-2814.938) (-2808.233) [-2809.589] -- 0:00:50
      702500 -- [-2809.172] (-2808.855) (-2818.673) (-2811.646) * (-2807.759) [-2805.760] (-2817.444) (-2809.830) -- 0:00:49
      703000 -- (-2815.341) (-2809.536) [-2810.331] (-2811.622) * (-2820.766) (-2809.610) [-2808.322] (-2806.934) -- 0:00:49
      703500 -- (-2811.100) (-2815.907) [-2811.199] (-2805.630) * (-2817.286) [-2805.903] (-2807.271) (-2817.693) -- 0:00:49
      704000 -- [-2817.430] (-2813.423) (-2808.386) (-2815.684) * (-2809.015) (-2806.740) (-2811.919) [-2815.423] -- 0:00:49
      704500 -- (-2808.790) (-2813.923) (-2805.884) [-2815.953] * (-2813.152) (-2810.365) [-2810.486] (-2811.858) -- 0:00:49
      705000 -- [-2808.702] (-2818.516) (-2814.856) (-2807.920) * (-2809.879) (-2814.834) [-2810.522] (-2813.165) -- 0:00:49

      Average standard deviation of split frequencies: 0.030270

      705500 -- (-2806.119) [-2812.001] (-2813.196) (-2818.225) * (-2816.169) [-2808.899] (-2822.435) (-2811.969) -- 0:00:49
      706000 -- (-2804.728) [-2816.570] (-2812.699) (-2807.588) * [-2805.630] (-2810.471) (-2816.433) (-2808.701) -- 0:00:49
      706500 -- (-2813.743) (-2813.063) (-2808.627) [-2814.852] * (-2811.843) (-2810.213) (-2811.301) [-2809.852] -- 0:00:49
      707000 -- [-2812.577] (-2809.655) (-2813.713) (-2810.450) * [-2806.509] (-2815.729) (-2814.337) (-2811.287) -- 0:00:49
      707500 -- (-2807.951) (-2809.863) [-2816.270] (-2810.996) * (-2807.014) [-2813.349] (-2813.921) (-2820.471) -- 0:00:49
      708000 -- (-2807.779) (-2816.116) [-2808.195] (-2810.036) * [-2804.790] (-2808.133) (-2813.442) (-2813.769) -- 0:00:49
      708500 -- (-2815.495) (-2809.909) (-2807.576) [-2811.020] * (-2807.716) [-2807.914] (-2816.654) (-2808.431) -- 0:00:48
      709000 -- [-2809.839] (-2808.744) (-2814.869) (-2811.204) * (-2811.662) (-2813.301) [-2818.701] (-2811.298) -- 0:00:48
      709500 -- (-2817.586) [-2811.504] (-2807.205) (-2810.224) * (-2811.784) (-2806.703) [-2810.302] (-2805.232) -- 0:00:48
      710000 -- [-2813.790] (-2815.295) (-2804.418) (-2814.160) * (-2814.884) (-2812.333) (-2814.965) [-2805.586] -- 0:00:48

      Average standard deviation of split frequencies: 0.030955

      710500 -- (-2806.083) [-2813.482] (-2806.250) (-2809.573) * (-2815.151) (-2809.833) (-2812.569) [-2807.309] -- 0:00:48
      711000 -- (-2809.820) [-2810.645] (-2813.540) (-2817.652) * (-2815.801) (-2805.659) (-2814.707) [-2805.711] -- 0:00:48
      711500 -- [-2808.700] (-2811.977) (-2810.252) (-2806.781) * [-2806.703] (-2811.544) (-2812.972) (-2806.660) -- 0:00:48
      712000 -- (-2818.374) [-2806.642] (-2811.292) (-2807.300) * (-2811.889) (-2816.712) [-2806.624] (-2808.960) -- 0:00:48
      712500 -- (-2817.165) (-2814.733) (-2813.135) [-2811.786] * (-2809.606) (-2810.413) [-2806.926] (-2814.428) -- 0:00:48
      713000 -- [-2811.723] (-2811.674) (-2807.806) (-2804.056) * (-2808.344) (-2806.051) [-2807.182] (-2817.631) -- 0:00:48
      713500 -- [-2809.094] (-2816.151) (-2807.706) (-2812.970) * (-2806.792) (-2809.789) (-2807.285) [-2808.445] -- 0:00:48
      714000 -- (-2808.093) (-2804.174) [-2810.642] (-2810.572) * (-2806.072) (-2815.250) [-2813.700] (-2812.018) -- 0:00:48
      714500 -- (-2815.148) (-2805.570) [-2812.745] (-2815.931) * (-2818.833) (-2813.838) (-2808.325) [-2809.305] -- 0:00:47
      715000 -- (-2815.877) (-2810.395) (-2810.312) [-2811.521] * [-2810.724] (-2808.575) (-2805.342) (-2809.352) -- 0:00:47

      Average standard deviation of split frequencies: 0.031603

      715500 -- (-2810.818) (-2807.796) (-2807.348) [-2806.855] * [-2811.309] (-2807.690) (-2810.381) (-2814.730) -- 0:00:47
      716000 -- (-2811.308) (-2809.864) (-2814.238) [-2806.411] * [-2806.946] (-2804.912) (-2819.613) (-2807.269) -- 0:00:47
      716500 -- (-2811.248) (-2818.409) [-2803.786] (-2814.097) * [-2812.599] (-2812.678) (-2810.806) (-2806.932) -- 0:00:47
      717000 -- (-2808.607) [-2808.819] (-2810.262) (-2813.450) * [-2809.545] (-2808.257) (-2809.364) (-2809.745) -- 0:00:47
      717500 -- (-2806.851) [-2807.336] (-2807.879) (-2810.177) * [-2808.602] (-2817.354) (-2807.537) (-2807.161) -- 0:00:47
      718000 -- (-2810.618) (-2805.553) [-2804.694] (-2808.869) * (-2813.886) [-2806.412] (-2806.562) (-2808.574) -- 0:00:47
      718500 -- (-2809.674) [-2808.356] (-2808.324) (-2807.772) * (-2812.833) [-2811.107] (-2807.673) (-2812.231) -- 0:00:47
      719000 -- (-2810.627) [-2812.520] (-2808.161) (-2812.305) * (-2810.937) (-2811.146) (-2809.778) [-2808.711] -- 0:00:47
      719500 -- (-2813.029) [-2810.729] (-2807.593) (-2813.696) * (-2807.832) [-2804.339] (-2810.351) (-2809.407) -- 0:00:47
      720000 -- [-2807.607] (-2805.877) (-2808.167) (-2807.446) * (-2813.015) [-2806.407] (-2810.324) (-2806.267) -- 0:00:47

      Average standard deviation of split frequencies: 0.031398

      720500 -- [-2812.096] (-2809.284) (-2812.781) (-2808.761) * (-2808.470) [-2810.161] (-2806.806) (-2805.349) -- 0:00:46
      721000 -- (-2815.800) (-2816.364) (-2805.824) [-2812.878] * (-2809.378) [-2815.652] (-2810.950) (-2806.413) -- 0:00:46
      721500 -- (-2808.065) (-2806.912) (-2809.659) [-2813.717] * (-2808.932) (-2811.626) (-2806.953) [-2813.730] -- 0:00:46
      722000 -- (-2818.553) (-2814.096) [-2807.734] (-2812.341) * (-2812.769) (-2810.423) [-2808.096] (-2824.535) -- 0:00:46
      722500 -- (-2814.930) (-2817.982) [-2805.541] (-2813.778) * (-2816.855) (-2809.463) (-2805.435) [-2809.394] -- 0:00:46
      723000 -- (-2816.386) (-2808.317) (-2810.040) [-2809.079] * (-2815.276) [-2808.938] (-2804.850) (-2813.707) -- 0:00:46
      723500 -- (-2804.486) (-2809.366) (-2807.969) [-2820.789] * (-2809.474) (-2808.878) (-2810.835) [-2811.307] -- 0:00:46
      724000 -- (-2806.483) (-2811.583) [-2806.943] (-2816.579) * (-2808.157) (-2808.572) [-2812.650] (-2817.856) -- 0:00:46
      724500 -- (-2805.631) [-2815.039] (-2812.761) (-2813.349) * (-2811.705) [-2810.547] (-2806.295) (-2809.504) -- 0:00:46
      725000 -- (-2803.211) [-2809.584] (-2809.692) (-2813.137) * [-2811.059] (-2813.601) (-2810.407) (-2813.323) -- 0:00:46

      Average standard deviation of split frequencies: 0.029869

      725500 -- (-2814.979) [-2810.505] (-2806.759) (-2811.985) * [-2807.739] (-2812.556) (-2809.571) (-2816.550) -- 0:00:46
      726000 -- (-2820.576) [-2810.297] (-2814.363) (-2809.227) * [-2805.919] (-2803.728) (-2809.130) (-2808.425) -- 0:00:46
      726500 -- (-2813.516) [-2811.813] (-2806.625) (-2808.695) * (-2810.634) [-2807.544] (-2808.412) (-2807.921) -- 0:00:45
      727000 -- (-2811.779) [-2805.526] (-2807.197) (-2814.447) * (-2808.007) (-2817.137) [-2818.080] (-2812.142) -- 0:00:45
      727500 -- (-2806.991) (-2809.308) (-2811.380) [-2810.656] * (-2810.359) [-2811.407] (-2809.956) (-2813.496) -- 0:00:45
      728000 -- (-2816.285) [-2804.417] (-2814.647) (-2812.146) * (-2808.622) (-2807.884) (-2808.102) [-2808.748] -- 0:00:45
      728500 -- (-2814.526) [-2808.519] (-2807.672) (-2806.500) * (-2819.191) [-2809.847] (-2807.773) (-2810.181) -- 0:00:45
      729000 -- (-2816.610) [-2807.002] (-2807.584) (-2811.873) * [-2809.345] (-2809.942) (-2813.255) (-2815.355) -- 0:00:45
      729500 -- (-2810.075) [-2809.895] (-2808.213) (-2810.532) * [-2816.329] (-2807.817) (-2809.441) (-2806.024) -- 0:00:45
      730000 -- (-2811.204) (-2806.831) [-2806.953] (-2815.183) * (-2813.955) (-2810.739) [-2809.507] (-2811.080) -- 0:00:45

      Average standard deviation of split frequencies: 0.027527

      730500 -- (-2811.466) (-2806.623) (-2810.806) [-2807.984] * [-2812.776] (-2809.197) (-2806.607) (-2808.753) -- 0:00:45
      731000 -- (-2813.372) (-2805.157) [-2813.122] (-2815.422) * (-2811.978) (-280