--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 16:41:47 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip71B-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4748.32         -4762.48
2      -4748.28         -4761.32
--------------------------------------
TOTAL    -4748.30         -4762.06
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.612712    0.002612    0.519512    0.718324    0.610323   1240.11   1301.94    1.000
r(A<->C){all}   0.090960    0.000277    0.059507    0.123299    0.090254    936.68   1129.61    1.000
r(A<->G){all}   0.261587    0.000813    0.207424    0.316488    0.260391    871.79    984.30    1.000
r(A<->T){all}   0.120591    0.000374    0.083189    0.157791    0.119802   1089.85   1181.12    1.000
r(C<->G){all}   0.066555    0.000195    0.041481    0.095862    0.065516    977.26   1118.24    1.000
r(C<->T){all}   0.392370    0.001058    0.329575    0.456536    0.391199    942.90    977.31    1.001
r(G<->T){all}   0.067936    0.000201    0.040502    0.095751    0.067178   1005.37   1042.16    1.000
pi(A){all}      0.238056    0.000089    0.220270    0.257637    0.237799   1029.82   1077.98    1.001
pi(C){all}      0.266125    0.000093    0.247222    0.284583    0.266030   1149.47   1194.59    1.000
pi(G){all}      0.247392    0.000093    0.228832    0.265888    0.247438   1212.92   1250.74    1.000
pi(T){all}      0.248427    0.000090    0.228822    0.266052    0.248388   1183.20   1201.09    1.000
alpha{1,2}      0.088380    0.001659    0.001782    0.148258    0.095614    960.06   1054.71    1.000
alpha{3}        3.019386    0.841961    1.451766    4.801168    2.891589   1213.28   1298.92    1.000
pinvar{all}     0.194088    0.005347    0.055214    0.333811    0.193966    962.65   1009.93    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4463.603074
Model 2: PositiveSelection	-4463.603074
Model 0: one-ratio	-4509.334605
Model 3: discrete	-4462.520186
Model 7: beta	-4463.553777
Model 8: beta&w>1	-4462.484934


Model 0 vs 1	91.46306200000072

Model 2 vs 1	0.0

Model 8 vs 7	2.1376860000000306
>C1
MAQKQVLVLNLFCLGSLFFKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQISPRGNHSNSQSEAEVPEFLEIHDPKHRHPRESSEPVAACLS
PKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGVHNSEEEYNEFINSVR
ITPRAFMKLCPALLAQIDNGVCKQPAVRSVNLNDKNQKIWYAWIYASITM
LILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHAL
FKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPLL
KGGKPGHGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEAKL
DEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVL
CHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIGD
GMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKGIIIQIFGILL
GGLIMLAIALNEHDLEGLFKSFo
>C2
MAKKQVLVLTLICLGSLFLKTVPASTEYNEYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHETNVTYYFEPTRVNAT
DEEALELQISPRGNRSKSESENEIPEFLEMHDSKHRHPRESSEPVAACLS
PKSLLSLIVNHNDLHKNIAYRTLLIKNDVSSTDGIHNSEEEYNEFINSVR
ITPRAFMKLCPALLAQIDNGVCKQPTARSENLNDKNQKIWYAWIYASITM
FILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLSGDALMHLLPHAL
FKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPLL
KGTKPGHGHSHGHGHSHGYSHGHMEKPAAKDAIDLPAPRELNVMLQEANL
DEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVL
CHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIGD
GMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGILL
GGLIMLAIALNEHDLEGLFKSFo
>C3
MAKKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQISPRGNRSKSESEAEVPEFLEMHDPKHRHPRESSEPVAACLS
PKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGIHNSEEEYNEFINSVR
ITPRAFMKLCPALLAQIDNGVCKQPAARSENLNDKNQKIWYAWIYASITM
LILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHAL
FKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPLL
KGSKPGHGHSHGHGHSHGHSHGHMEKPAAKDAIDLPAPRELNVMLQEAKL
DEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVL
CHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIGD
GMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGILL
GGLIMLAIALNEHDLEGLFKSFo
>C4
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNQRTRGSNVTYYFEPTQVNTT
DEEALEVQISPPGNRSKAESEAEVPEFLEMHDPKHRHPRESSEPVAACLS
PKSLLSLIVNHNDLHKNIAYRKLLIKNDASATDAIHNSEEEYNEFINSVR
ITPRAFMKLCPALLAQIDNGVCKQPAARSENLNNKNQKIWYAWIYASITM
FILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHAL
FKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPLL
KGGKPGGHGHSHGHGHSHSHGHMEKPAAKDAVELPLPRELNVMLQEAKLD
EKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVLC
HELPHELGDFALLLQTGVSMRRAIYMNIVSSVLSFVGMSVGLFIAGIGDG
MTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGILLG
GLIMLAIALNEHDLEGLFKSFoo
>C5
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFEPSHTIDQHRPQGYSNQTTRCINGTYYLEPRANATD
EEALEVQISPPGNRSKSEWNAQVPEFLEMHDPKHRHPRESSEPVASCLSP
KSLLSLLVNHNDLHKNNAYRTLLIKNDVSSTDAIHNSEEEYNKFINSVRI
TPQAFMKLCPALLAQIDNGVCKQPAVRSESLNDKNQKIWYAWIYASITML
LLSVCGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHALF
KEEQHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPLLK
GGKPGHGHSHGHGHSHGHSHEHMEKPAAQNAIDLPTPRELNVMLQEATLD
EKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVLC
HELPHELGDFALLLQTGVSIRRAVYLNIVSSVLSFVGMSVGLFIAGIGDG
MTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGILLG
GLIMLTIALNEHDLEGLFKSFoo
>C6
MAQRQVLVLTLFCLGLLFFPTVQTATEYNRYLAEIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSQEVAHPTNATYYFEPTRVSAT
DEEALEVQISTPSSNLSKPETGPEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLLVDHNDLHKNIAYQKLFKKEGFSGTDTMHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAPRSENLSDKKQKIWNAWIYASIT
MLILSACGLLGILLVPLMKTAAYQEILKFLVSVAVGTLAGDALMHLLPHA
LFKEEKHEEDVTGINPLESDHKHSNEAALLCGCSFLAALFMYMLENLIPL
LKGGKTGHGHSHGHGHSHGQSHGHMEKPASHDTPELPAPRELNVMLQEAK
LDEKTPDRPLTPVAFMVVIGDGLHNLTDGLAIGAAFASDPVTGFATAFAV
LCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIG
DGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGIL
LGGLIMLVIALNEHDLEGLFKSF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=576 

C1              MAQKQVLVLNLFCLGSLFFKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
C2              MAKKQVLVLTLICLGSLFLKTVPASTEYNEYVAQIFQKYGNGGTINFEGL
C3              MAKKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
C4              MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
C5              MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
C6              MAQRQVLVLTLFCLGLLFFPTVQTATEYNRYLAEIFQKYGNGGTINFEGL
                **::*****.*:*** **: ** ::****.*:*:****************

C1              EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
C2              EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHETNVTYYFEPTRVNAT
C3              EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
C4              EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNQRTRGSNVTYYFEPTQVNTT
C5              EHLMFSLNLGQIQFEPSHTIDQHRPQGYSNQTTRCINGTYYLEP-RANAT
C6              EHLMFSLNLGQIQFDPSHTIDQHRPQGYSQEVAHPTNATYYFEPTRVSAT
                **************:**************:: .:  * ***:** :..:*

C1              DEEALELQIS-PRGNHSNSQSEAEVPEFLEIHDPKHRHPRESSEPVAACL
C2              DEEALELQIS-PRGNRSKSESENEIPEFLEMHDSKHRHPRESSEPVAACL
C3              DEEALELQIS-PRGNRSKSESEAEVPEFLEMHDPKHRHPRESSEPVAACL
C4              DEEALEVQIS-PPGNRSKAESEAEVPEFLEMHDPKHRHPRESSEPVAACL
C5              DEEALEVQIS-PPGNRSKSEWNAQVPEFLEMHDPKHRHPRESSEPVASCL
C6              DEEALEVQISTPSSNLSKPETGPEVPEFLEIHDPKHRHPRESSEPVAACL
                ******:*** * .* *:.:   ::*****:**.*************:**

C1              SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGVHNSEEEYNEFINSV
C2              SPKSLLSLIVNHNDLHKNIAYRTLLIKNDVSSTDGIHNSEEEYNEFINSV
C3              SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGIHNSEEEYNEFINSV
C4              SPKSLLSLIVNHNDLHKNIAYRKLLIKNDASATDAIHNSEEEYNEFINSV
C5              SPKSLLSLLVNHNDLHKNNAYRTLLIKNDVSSTDAIHNSEEEYNKFINSV
C6              SPKSLLSLLVDHNDLHKNIAYQKLFKKEGFSGTDTMHNSEEEYNEFINSV
                ********:*:******* **:.*: *:. *.** :********:*****

C1              RITPRAFMKLCPALLAQIDNGVCKQPAVRSVNLNDKNQKIWYAWIYASIT
C2              RITPRAFMKLCPALLAQIDNGVCKQPTARSENLNDKNQKIWYAWIYASIT
C3              RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNDKNQKIWYAWIYASIT
C4              RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNNKNQKIWYAWIYASIT
C5              RITPQAFMKLCPALLAQIDNGVCKQPAVRSESLNDKNQKIWYAWIYASIT
C6              RITPRAFMKLCPALLAQIDNGVCKQPAPRSENLSDKKQKIWNAWIYASIT
                ****:*********************: ** .*.:*:**** ********

C1              MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
C2              MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLSGDALMHLLPHA
C3              MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
C4              MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
C5              MLLLSVCGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
C6              MLILSACGLLGILLVPLMKTAAYQEILKFLVSVAVGTLAGDALMHLLPHA
                *::**.*************:************:*****:***********

C1              LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
C2              LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
C3              LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
C4              LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
C5              LFKEEQHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
C6              LFKEEKHEEDVTGINPLESDHKHSNEAALLCGCSFLAALFMYMLENLIPL
                *****:***:***********************:****************

C1              LKGGKPG-HGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEA
C2              LKGTKPG-HGHSHGHGHSHGYSHGHMEKPAAKDAIDLPAPRELNVMLQEA
C3              LKGSKPG-HGHSHGHGHSHGHSHGHMEKPAAKDAIDLPAPRELNVMLQEA
C4              LKGGKPGGHGHSHGHGHSH--SHGHMEKPAAKDAVELPLPRELNVMLQEA
C5              LKGGKPG-HGHSHGHGHSHGHSHEHMEKPAAQNAIDLPTPRELNVMLQEA
C6              LKGGKTG-HGHSHGHGHSHGQSHGHMEKPASHDTPELPAPRELNVMLQEA
                *** *.* ***********  ** ******:::: :** ***********

C1              KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
C2              NLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
C3              KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
C4              KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
C5              TLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
C6              KLDEKTPDRPLTPVAFMVVIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
                .*****************:*******************************

C1              VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
C2              VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
C3              VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
C4              VLCHELPHELGDFALLLQTGVSMRRAIYMNIVSSVLSFVGMSVGLFIAGI
C5              VLCHELPHELGDFALLLQTGVSIRRAVYLNIVSSVLSFVGMSVGLFIAGI
C6              VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
                **********************:***:*:*********************

C1              GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKGIIIQIFGI
C2              GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
C3              GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
C4              GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
C5              GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
C6              GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
                *********************************** ***********.**

C1              LLGGLIMLAIALNEHDLEGLFKSFo-
C2              LLGGLIMLAIALNEHDLEGLFKSFo-
C3              LLGGLIMLAIALNEHDLEGLFKSFo-
C4              LLGGLIMLAIALNEHDLEGLFKSFoo
C5              LLGGLIMLTIALNEHDLEGLFKSFoo
C6              LLGGLIMLVIALNEHDLEGLFKSF--
                ********.***************  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  573 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  573 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [17524]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [17524]--->[17494]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip71B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.415 Mb, Max= 31.036 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAQKQVLVLNLFCLGSLFFKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQIS-PRGNHSNSQSEAEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGVHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAVRSVNLNDKNQKIWYAWIYASIT
MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPG-HGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSFo-
>C2
MAKKQVLVLTLICLGSLFLKTVPASTEYNEYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHETNVTYYFEPTRVNAT
DEEALELQIS-PRGNRSKSESENEIPEFLEMHDSKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRTLLIKNDVSSTDGIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPTARSENLNDKNQKIWYAWIYASIT
MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLSGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGTKPG-HGHSHGHGHSHGYSHGHMEKPAAKDAIDLPAPRELNVMLQEA
NLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSFo-
>C3
MAKKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQIS-PRGNRSKSESEAEVPEFLEMHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNDKNQKIWYAWIYASIT
MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGSKPG-HGHSHGHGHSHGHSHGHMEKPAAKDAIDLPAPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSFo-
>C4
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNQRTRGSNVTYYFEPTQVNTT
DEEALEVQIS-PPGNRSKAESEAEVPEFLEMHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDASATDAIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNNKNQKIWYAWIYASIT
MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPGGHGHSHGHGHSH--SHGHMEKPAAKDAVELPLPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAIYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
LLGGLIMLAIALNEHDLEGLFKSFoo
>C5
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFEPSHTIDQHRPQGYSNQTTRCINGTYYLEP-RANAT
DEEALEVQIS-PPGNRSKSEWNAQVPEFLEMHDPKHRHPRESSEPVASCL
SPKSLLSLLVNHNDLHKNNAYRTLLIKNDVSSTDAIHNSEEEYNKFINSV
RITPQAFMKLCPALLAQIDNGVCKQPAVRSESLNDKNQKIWYAWIYASIT
MLLLSVCGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEQHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPG-HGHSHGHGHSHGHSHEHMEKPAAQNAIDLPTPRELNVMLQEA
TLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSIRRAVYLNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLTIALNEHDLEGLFKSFoo
>C6
MAQRQVLVLTLFCLGLLFFPTVQTATEYNRYLAEIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSQEVAHPTNATYYFEPTRVSAT
DEEALEVQISTPSSNLSKPETGPEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLLVDHNDLHKNIAYQKLFKKEGFSGTDTMHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAPRSENLSDKKQKIWNAWIYASIT
MLILSACGLLGILLVPLMKTAAYQEILKFLVSVAVGTLAGDALMHLLPHA
LFKEEKHEEDVTGINPLESDHKHSNEAALLCGCSFLAALFMYMLENLIPL
LKGGKTG-HGHSHGHGHSHGQSHGHMEKPASHDTPELPAPRELNVMLQEA
KLDEKTPDRPLTPVAFMVVIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
LLGGLIMLVIALNEHDLEGLFKSF--

FORMAT of file /tmp/tmp3670267672079803318aln Not Supported[FATAL:T-COFFEE]
>C1
MAQKQVLVLNLFCLGSLFFKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQIS-PRGNHSNSQSEAEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGVHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAVRSVNLNDKNQKIWYAWIYASIT
MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPG-HGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSFo-
>C2
MAKKQVLVLTLICLGSLFLKTVPASTEYNEYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHETNVTYYFEPTRVNAT
DEEALELQIS-PRGNRSKSESENEIPEFLEMHDSKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRTLLIKNDVSSTDGIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPTARSENLNDKNQKIWYAWIYASIT
MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLSGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGTKPG-HGHSHGHGHSHGYSHGHMEKPAAKDAIDLPAPRELNVMLQEA
NLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSFo-
>C3
MAKKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQIS-PRGNRSKSESEAEVPEFLEMHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNDKNQKIWYAWIYASIT
MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGSKPG-HGHSHGHGHSHGHSHGHMEKPAAKDAIDLPAPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSFo-
>C4
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNQRTRGSNVTYYFEPTQVNTT
DEEALEVQIS-PPGNRSKAESEAEVPEFLEMHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDASATDAIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNNKNQKIWYAWIYASIT
MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPGGHGHSHGHGHSH--SHGHMEKPAAKDAVELPLPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAIYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
LLGGLIMLAIALNEHDLEGLFKSFoo
>C5
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFEPSHTIDQHRPQGYSNQTTRCINGTYYLEP-RANAT
DEEALEVQIS-PPGNRSKSEWNAQVPEFLEMHDPKHRHPRESSEPVASCL
SPKSLLSLLVNHNDLHKNNAYRTLLIKNDVSSTDAIHNSEEEYNKFINSV
RITPQAFMKLCPALLAQIDNGVCKQPAVRSESLNDKNQKIWYAWIYASIT
MLLLSVCGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEQHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPG-HGHSHGHGHSHGHSHEHMEKPAAQNAIDLPTPRELNVMLQEA
TLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSIRRAVYLNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLTIALNEHDLEGLFKSFoo
>C6
MAQRQVLVLTLFCLGLLFFPTVQTATEYNRYLAEIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSQEVAHPTNATYYFEPTRVSAT
DEEALEVQISTPSSNLSKPETGPEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLLVDHNDLHKNIAYQKLFKKEGFSGTDTMHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAPRSENLSDKKQKIWNAWIYASIT
MLILSACGLLGILLVPLMKTAAYQEILKFLVSVAVGTLAGDALMHLLPHA
LFKEEKHEEDVTGINPLESDHKHSNEAALLCGCSFLAALFMYMLENLIPL
LKGGKTG-HGHSHGHGHSHGQSHGHMEKPASHDTPELPAPRELNVMLQEA
KLDEKTPDRPLTPVAFMVVIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
LLGGLIMLVIALNEHDLEGLFKSF--
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:576 S:99 BS:576
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.64 C1	 C2	 95.64
TOP	    1    0	 95.64 C2	 C1	 95.64
BOT	    0    2	 97.38 C1	 C3	 97.38
TOP	    2    0	 97.38 C3	 C1	 97.38
BOT	    0    3	 94.40 C1	 C4	 94.40
TOP	    3    0	 94.40 C4	 C1	 94.40
BOT	    0    4	 92.13 C1	 C5	 92.13
TOP	    4    0	 92.13 C5	 C1	 92.13
BOT	    0    5	 89.86 C1	 C6	 89.86
TOP	    5    0	 89.86 C6	 C1	 89.86
BOT	    1    2	 97.91 C2	 C3	 97.91
TOP	    2    1	 97.91 C3	 C2	 97.91
BOT	    1    3	 94.75 C2	 C4	 94.75
TOP	    3    1	 94.75 C4	 C2	 94.75
BOT	    1    4	 92.31 C2	 C5	 92.31
TOP	    4    1	 92.31 C5	 C2	 92.31
BOT	    1    5	 88.81 C2	 C6	 88.81
TOP	    5    1	 88.81 C6	 C2	 88.81
BOT	    2    3	 95.97 C3	 C4	 95.97
TOP	    3    2	 95.97 C4	 C3	 95.97
BOT	    2    4	 93.53 C3	 C5	 93.53
TOP	    4    2	 93.53 C5	 C3	 93.53
BOT	    2    5	 90.03 C3	 C6	 90.03
TOP	    5    2	 90.03 C6	 C3	 90.03
BOT	    3    4	 92.99 C4	 C5	 92.99
TOP	    4    3	 92.99 C5	 C4	 92.99
BOT	    3    5	 89.47 C4	 C6	 89.47
TOP	    5    3	 89.47 C6	 C4	 89.47
BOT	    4    5	 86.87 C5	 C6	 86.87
TOP	    5    4	 86.87 C6	 C5	 86.87
AVG	 0	 C1	  *	 93.88
AVG	 1	 C2	  *	 93.88
AVG	 2	 C3	  *	 94.97
AVG	 3	 C4	  *	 93.52
AVG	 4	 C5	  *	 91.57
AVG	 5	 C6	  *	 89.01
TOT	 TOT	  *	 92.80
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCCCAAAAGCAGGTGCTAGTCTTAAACCTATTTTGCCTGGGCTCACT
C2              ATGGCCAAAAAGCAGGTGCTAGTCTTAACCCTAATTTGCCTGGGTTCGCT
C3              ATGGCCAAAAAGCAGGTGCTAGTCTTAACCCTAATTTGCCTGGGTTCGCT
C4              ATGGCCCAAAAGCAGGTGCTAGTCTTAACCCTAATTTGCCTGGGTTCGCT
C5              ATGGCCCAAAAGCAGGTGCTAGTCCTAACCCTAATATGCCTGGGTTCGCT
C6              ATGGCCCAAAGGCAGGTGCTAGTTTTAACCCTCTTCTGCCTGGGTTTGTT
                ******.***.************  ***.***.:* ******** * . *

C1              ATTTTTCAAAACAGTGCCAGCTTCCACGGAATACAACAAATACGTGGCGC
C2              ATTTTTGAAAACAGTGCCGGCTTCCACGGAATACAACGAATACGTGGCGC
C3              ATTTTTGAAAACAGTGCCGGCTTCCACGGAATACAACAAATACGTGGCGC
C4              ATTTTTGAAAACGGTGCCGGCTTCCACGGAATACAACAAGTACGTGGCGC
C5              GTTTCTCAAAACAGTGCCGGCTTCCACGGAATACAACAAATACGTGGCGC
C6              GTTTTTCCCAACTGTGCAGACGGCCACGGAATACAATCGCTATTTGGCCG
                .*** * ..*** ****...*  *************  . **  ****  

C1              AGATATTTCAAAAATACGGCAACGGCGGGACAATCAACTTTGAGGGTCTT
C2              AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
C3              AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
C4              AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
C5              AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
C6              AGATATTCCAAAAATACGGCAACGGCGGGACCATCAACTTTGAGGGTCTT
                ******* ************** ********.******************

C1              GAGCATTTGATGTTCAGCCTGAACTTGGGTCAAATCCAATTCGATCCCTC
C2              GAGCATCTGATGTTCAGCCTGAACTTGGGTCAAATCCAATTCGATCCCTC
C3              GAGCATCTGATGTTCAGCCTGAACTTGGGTCAAATCCAATTCGATCCCTC
C4              GAGCATTTGATGTTCAGCCTGAACCTGGGTCAAATCCAATTCGATCCCTC
C5              GAGCATTTGATGTTCAGCCTGAACCTGGGTCAAATCCAATTCGAGCCCTC
C6              GAGCATTTGATGTTCAGCTTGAACTTGGGCCAAATCCAGTTCGATCCCTC
                ****** *********** ***** **** ********.***** *****

C1              GCACACGATCGATCAGCATCGACCTCAGGGATACTCGAACGAGATGCCGC
C2              GCACACGATCGATCAGCATCGACCTCAGGGATACTCCAACGAGATGCCGC
C3              GCACACGATTGATCAGCATCGACCTCAGGGATACTCCAACGAGATGCCGC
C4              GCACACGATCGATCAGCATCGACCTCAGGGATACTCCAACCAAAGAACAC
C5              GCACACGATCGATCAGCATCGACCTCAGGGATACTCCAACCAGACAACGC
C6              GCACACGATCGATCAGCATCGACCCCAGGGATACTCCCAGGAGGTGGCGC
                ********* ************** *********** .*  *.. . *.*

C1              ATGCCACAAATGTAACGTATTACTTTGAGCCGACACGAGTCAATGCCACC
C2              ATGAAACAAATGTCACGTACTACTTTGAGCCGACACGAGTCAATGCCACC
C3              ATGCCACAAATGTCACGTACTACTTTGAGCCGACACGAGTCAATGCCACC
C4              GTGGCTCCAATGTCACTTATTACTTTGAGCCAACACAAGTCAATACCACC
C5              GTTGCATCAATGGCACGTATTACTTGGAGCCG---CGAGCTAACGCCACG
C6              ACCCCACAAATGCCACATACTACTTCGAGCCGACACGAGTTAGTGCCACC
                .   .: .**** .** ** ***** *****.   *.**  *. .**** 

C1              GATGAGGAAGCTTTGGAGCTGCAAATCTCT---CCTCGTGGCAATCACTC
C2              GACGAGGAAGCTTTGGAGCTGCAAATCTCT---CCTCGTGGCAATCGCTC
C3              GACGAGGAAGCTTTGGAGCTGCAAATCTCT---CCACGTGGCAATCGCTC
C4              GATGAGGAGGCTTTGGAGGTGCAAATCTCT---CCACCTGGCAATCGCTC
C5              GATGAGGAGGCTTTGGAGGTGCAAATCTCT---CCGCCTGGCAATCGCTC
C6              GATGAGGAAGCTTTGGAGGTGCAGATCTCGACGCCATCCAGTAATCTCTC
                ** *****.********* ****.*****    **    .* **** ***

C1              AAATTCACAGTCGGAGGCCGAGGTTCCGGAGTTCCTAGAAATTCATGACC
C2              AAAGTCGGAGTCGGAGAACGAGATTCCGGAGTTCCTAGAAATGCATGACT
C3              AAAGTCGGAGTCGGAGGCCGAGGTTCCGGAGTTCCTAGAAATGCATGACC
C4              AAAGGCGGAGTCGGAGGCCGAGGTTCCTGAATTCCTGGAAATGCATGATC
C5              AAAGTCAGAGTGGAACGCCCAGGTTCCGGAATTCCTTGAAATGCATGACC
C6              TAAGCCAGAGACGGGCCCTGAGGTACCGGAGTTCCTGGAAATTCATGACC
                :**  *. **: *..  .  **.*:** **.***** ***** *****  

C1              CCAAGCACCGACATCCGAGGGAGAGTTCTGAACCTGTTGCCGCTTGCTTA
C2              CCAAGCACCGACATCCGAGGGAGAGTTCTGAACCTGTTGCCGCTTGCTTA
C3              CCAAGCACCGACATCCGAGGGAGAGTTCTGAACCTGTTGCCGCTTGCTTA
C4              CCAAGCACCGCCATCCGAGGGAGAGTTCAGAACCTGTTGCAGCTTGCTTA
C5              CCAAGCACCGGCACCCGAGGGAGAGTTCAGAACCTGTTGCATCTTGCTTA
C6              CCAAGCACCGGCACCCAAGGGAGAGCTCTGAACCTGTTGCCGCTTGCTTA
                ********** ** **.******** **:***********. ********

C1              TCACCGAAGTCTTTACTTTCCCTCATCGTGAACCACAACGATCTCCACAA
C2              TCACCAAAGTCGCTGCTTTCCCTCATCGTGAACCACAACGATCTCCACAA
C3              TCACCAAAGTCGCTGCTTTCCCTCATCGTGAACCACAACGATCTCCACAA
C4              TCGCCCAAGTCGTTGCTTTCCCTCATCGTAAACCACAACGATCTCCACAA
C5              TCACCCAAGTCGTTGCTTTCTCTCCTCGTTAACCACAACGACCTCCACAA
C6              TCCCCCAAGTCATTGCTTTCCCTGCTCGTGGACCACAATGATCTCCACAA
                ** ** *****  *.***** ** .**** .******* ** ********

C1              AAACATTGCCTACCGCAAGCTGCTCATTAAGAATGACGTTAGCTCAACTG
C2              AAACATTGCCTACCGAACACTGCTCATTAAGAATGACGTTAGCTCAACTG
C3              AAACATTGCCTACCGCAAGCTGCTCATTAAGAATGACGTTAGCTCAACTG
C4              AAACATTGCCTACCGCAAATTGCTCATTAAGAATGACGCTAGTGCAACTG
C5              AAACAATGCCTACCGCACACTGCTCATTAAGAATGATGTTAGTTCAACGG
C6              GAACATTGCCTACCAAAAATTGTTCAAGAAGGAAGGCTTCTCTGGAACAG
                .****:********..*.. ** ***: ***.*:*.    :    *** *

C1              ATGGCGTCCACAATTCTGAAGAGGAATACAACGAATTCATCAACTCGGTG
C2              ATGGCATCCACAATTCGGAAGAGGAATACAACGAATTCATCAACTCGGTG
C3              ATGGCATCCACAATTCTGAAGAGGAATACAACGAATTCATCAACTCGGTG
C4              ATGCCATCCACAATTCTGAAGAGGAATACAACGAATTCATCAACTCGGTG
C5              ATGCCATTCATAATTCTGAAGAGGAATACAACAAATTCATCAACTCGGTG
C6              ACACCATGCACAACTCTGAGGAGGAGTACAACGAGTTCATCAACTCGGTG
                * . *.* ** ** ** **.*****.******.*.***************

C1              CGGATCACTCCGCGAGCTTTTATGAAACTCTGTCCAGCTCTATTAGCCCA
C2              CGGATCACTCCGCGAGCTTTTATGAAACTCTGTCCAGCTCTATTAGCCCA
C3              CGGATCACTCCGCGAGCTTTTATGAAACTCTGTCCAGCTCTTTTAGCCCA
C4              CGGATCACTCCGCGAGCTTTTATGAAACTCTGCCCAGCTCTATTAGCCCA
C5              CGGATCACTCCGCAAGCTTTTATGAAACTCTGCCCAGCTCTATTAGCCCA
C6              CGGATTACTCCTCGGGCTTTTATGAAACTCTGCCCAGCTCTATTGGCTCA
                ***** ***** *..***************** ********:**.** **

C1              GATCGATAATGGAGTTTGCAAGCAACCAGCTGTACGATCAGTAAACCTTA
C2              GATCGATAATGGAGTTTGCAAGCAACCAACTGCACGATCAGAAAACCTTA
C3              GATCGATAATGGAGTTTGCAAGCAACCAGCTGCACGATCAGAAAACCTAA
C4              AATCGATAATGGAGTGTGCAAGCAACCAGCTGCTCGATCGGAAAACCTTA
C5              AATCGATAATGGAGTGTGCAAGCAACCAGCTGTTCGATCAGAAAGCCTTA
C6              AATCGATAATGGAGTTTGCAAGCAACCAGCTCCGCGTTCCGAGAATCTTA
                .************** ************.**   **:** *:.*. **:*

C1              ACGATAAGAACCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACT
C2              ACGATAAGAACCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACC
C3              ACGATAAGAACCAAAAGATATGGTATGCTTGGATCTATGCCAGCATCACT
C4              ACAATAAGAACCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACC
C5              ACGATAAGAATCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACC
C6              GCGATAAGAAGCAAAAGATTTGGAATGCGTGGATCTATGCCAGCATCACC
                .*.******* **.*****:***:* ** ******************** 

C1              ATGCTTATACTGTCCGCTTGCGGATTGCTGGGCATTCTTCTGGTTCCTTT
C2              ATGTTTATACTGTCCGCTTGCGGATTGCTGGGCATTCTTCTGGTTCCTTT
C3              ATGCTTATACTGTCCGCTTGCGGATTACTGGGCATTCTTCTGGTTCCTTT
C4              ATGTTTATACTCTCCGCTTGCGGTTTGCTGGGAATTCTTCTGGTTCCTCT
C5              ATGCTTCTACTCTCCGTCTGCGGTCTGCTGGGAATTCTTCTGGTTCCCTT
C6              ATGCTGATTCTCTCTGCTTGCGGTTTGCTGGGAATTCTTCTGGTTCCTCT
                *** * .*:** ** *  *****: *.*****.**************  *

C1              GATGAAGTCGGCTGCCTATCAGGAAATTCTCAAGTTCCTAGTTTCCATCG
C2              GATGAAGTCGGCTGCCTATCAGGAAATTCTCAAGTTCCTGGTTTCCATCG
C3              GATGAAGTCGGCTGCCTATCAGGAAATTCTCAAGTTCCTGGTTTCCATCG
C4              GATGAAGTCAGCTGCCTACCAGGAAATCCTCAAGTTCCTGGTCTCTATCG
C5              GATGAAGTCAGCTGCCTATCAAGAAATCCTCAAGTTCCTGGTTTCCATCG
C6              GATGAAGACAGCTGCCTACCAGGAGATCCTCAAGTTCCTAGTCTCTGTTG
                *******:*.******** **.**.** ***********.** ** .* *

C1              CTGTGGGCACTTTAGCTGGCGATGCCCTGATGCACTTGCTCCCCCATGCC
C2              CTGTGGGTACTTTATCTGGCGATGCCCTGATGCACTTGCTCCCCCATGCT
C3              CTGTGGGCACTTTAGCTGGCGATGCCCTGATGCACTTGCTCCCCCATGCT
C4              CTGTGGGCACTTTGGCTGGCGATGCCCTCATGCACTTGCTGCCACATGCT
C5              CTGTGGGCACTTTAGCTGGCGATGCCCTCATGCACTTGCTCCCACATGCT
C6              CCGTGGGCACTTTAGCCGGTGACGCCCTGATGCACTTGCTGCCCCACGCT
                * ***** *****. * ** ** ***** *********** **.** ** 

C1              CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGTATCAATCCCTT
C2              CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGTATCAATCCCTT
C3              CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGTATCAATCCCTT
C4              CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGCATTAATCCCTT
C5              CTTTTCAAGGAGGAACAGCACGAGGAGGAAGTCACTGGTATTAATCCTTT
C6              CTTTTTAAGGAAGAGAAGCATGAGGAGGACGTGACGGGCATCAATCCCCT
                ***** *****.**..**** ********.** ** ** ** *****  *

C1              GGAATCTGATCACAAACATAGCAATGAGGCGGCTCTGCTATGTGGTTGTA
C2              GGAATCTGATCACAAACATAGCAATGAGGCGGCTCTGCTTTGTGGTTGTA
C3              GGAATCAGATCACAAACATAGCAATGAGGCGGCTCTGCTATGTGGTTGTA
C4              GGAATCAGATCACAAGCATAGCAATGAGGCGGCTCTGCTATGTGGTTGTA
C5              GGAATCAGATCACAAACATAGCAATGAGGCGGCTCTGCTTTGTGGTTGTA
C6              GGAATCGGACCACAAACATAGCAATGAGGCTGCCCTGCTTTGTGGTTGCT
                ****** ** *****.************** ** *****:******** :

C1              CTTTCCTGGCTGCTCTATTCATGTATATGCTGGAGAACCTGATTCCGCTG
C2              CTTTCCTGGCGGCACTATTCATGTATATGCTGGAGAACTTGATTCCGCTG
C3              CTTTCCTAGCGGCGCTATTCATGTACATGCTAGAGAACCTGATTCCGCTG
C4              CTTTCCTGGCGGCGCTATTCATGTATATGCTGGAGAACCTGATACCGCTT
C5              CTTTCCTGGCGGCACTATTCATGTATATGCTGGAGAACCTGATTCCGCTG
C6              CTTTCCTGGCGGCCCTCTTCATGTACATGTTGGAGAACCTAATTCCCTTG
                *******.** ** **.******** *** *.****** *.**:**  * 

C1              CTAAAGGGCGGTAAGCCGGGT---CATGGACATAGCCACGGACATGGTCA
C2              CTAAAGGGAACCAAGCCAGGT---CATGGACATAGCCATGGTCATGGTCA
C3              CTAAAGGGAAGCAAGCCAGGT---CATGGACACAGCCACGGACATGGTCA
C4              CTCAAGGGAGGTAAGCCAGGTGGCCATGGACATAGCCATGGACATGGTCA
C5              CTGAAAGGGGGTAAGCCAGGC---CATGGACATAGCCATGGACATGGTCA
C6              CTAAAAGGAGGTAAAACAGGT---CATGGTCATAGCCACGGACATGGTCA
                ** **.** .  **..*.**    *****:** ***** **:********

C1              CAGCCACGGCCGCAGTCATGGACATATGGAGAAGCCAGCTGCAAAGGATG
C2              CAGCCACGGCTACAGTCATGGACATATGGAAAAGCCCGCTGCGAAGGATG
C3              CAGCCACGGCCACAGTCATGGACATATGGAGAAGCCCGCTGCGAAGGATG
C4              CAGCCAC------AGTCACGGACATATGGAGAAGCCCGCTGCCAAGGATG
C5              CAGCCACGGCCACAGTCATGAACATATGGAGAAGCCCGCTGCCCAGAATG
C6              CAGTCACGGCCAAAGCCATGGTCACATGGAGAAGCCAGCTTCACACGACA
                *** ***      ** ** *.:** *****.*****.*** * .* .* .

C1              CTATTGATCTGCCACCTCCTCGAGAGCTCAATGTGATGTTGCAGGAGGCC
C2              CTATTGATTTGCCAGCTCCTCGGGAGCTCAATGTGATGCTGCAGGAAGCC
C3              CTATTGATCTGCCAGCTCCTCGAGAGCTCAATGTGATGCTGCAGGAAGCC
C4              CTGTTGAACTCCCCCTTCCGCGAGAACTCAATGTGATGCTGCAGGAGGCC
C5              CCATTGATCTGCCAACTCCTCGAGAACTAAATGTGATGCTGCAGGAAGCC
C6              CTCCCGAACTCCCAGCTCCTCGAGAACTCAATGTAATGCTGCAGGAGGCC
                *    **: * **.  *** **.**.**.*****.*** *******.***

C1              AAGCTGGATGAGAAGACCCCCGATCGACCGCTCACCCCAGTAGCCTTCAT
C2              AATCTGGATGAGAAGACCCCCGATCGACCGCTCACCCCAGTAGCCTTTAT
C3              AAGCTGGATGAGAAGACTCCCGATCGACCGCTCACCCCAGTAGCCTTCAT
C4              AAGCTGGACGAGAAGACCCCTGATCGACCGCTCACTCCAGTAGCCTTCAT
C5              ACGCTGGATGAGAAGACTCCTGATCGACCGCTCACCCCAGTAGCCTTCAT
C6              AAGCTGGATGAGAAGACTCCCGATCGTCCACTGACGCCGGTGGCTTTTAT
                *. ***** ******** ** *****:**.** ** **.**.** ** **

C1              GGTAATCATCGGAGATGGCTTGCACAATCTGACCGATGGTCTGGCCATAG
C2              GGTAATCATCGGAGATGGCTTGCACAATCTGACCGACGGTCTGGCCATAG
C3              GGTAATCATCGGAGATGGTTTGCACAATCTGACCGACGGTCTGGCCATAG
C4              GGTAATCATCGGAGATGGCTTGCACAATCTGACCGACGGTTTGGCCATAG
C5              GGTAATCATCGGAGATGGCTTGCACAATCTGACCGACGGTCTGGCCATAG
C6              GGTAGTCATCGGCGATGGTCTCCACAACCTAACCGATGGCTTGGCCATTG
                ****.*******.*****  * ***** **.***** **  *******:*

C1              GTGCAGCCTTCGCAAGTGATCCGGTCACTGGATTTGCTACCGCCTTTGCC
C2              GTGCAGCCTTCGCAAGTGATCCGGTCACTGGATTTGCTACCGCCTTTGCC
C3              GTGCAGCCTTCGCAAGTGATCCGGTCACTGGATTTGCTACCGCCTTTGCC
C4              GTGCAGCCTTTGCAAGTGATCCGGTCACTGGATTTGCTACAGCCTTTGCC
C5              GTGCAGCCTTTGCAAGTGATCCGGTCACTGGTTTCGCTACTGCCTTCGCC
C6              GTGCAGCGTTTGCCAGTGATCCGGTCACTGGGTTCGCCACCGCTTTTGCA
                ******* ** **.***************** ** ** ** ** ** **.

C1              GTTCTCTGCCATGAGTTGCCACACGAACTGGGCGACTTTGCTCTGTTGCT
C2              GTTCTCTGCCATGAGTTGCCCCACGAACTGGGCGACTTCGCACTGTTGCT
C3              GTACTCTGCCATGAGTTGCCCCACGAACTGGGCGACTTTGCTCTGTTGCT
C4              GTTCTCTGCCATGAGTTGCCACACGAACTAGGCGACTTCGCACTGTTGCT
C5              GTTCTCTGCCATGAGTTGCCACACGAACTAGGCGACTTCGCTCTGCTGCT
C6              GTCCTTTGCCACGAGTTGCCCCACGAGCTAGGCGATTTCGCTCTGCTCCT
                ** ** ***** ********.*****.**.***** ** **:*** * **

C1              GCAAACAGGTGTCTCCATGCGAAGAGCCGTCTATATGAACATTGTTAGCT
C2              CCAAACAGGTGTCTCCATGCGAAGAGCCGTCTATATGAACATTGTTAGCT
C3              CCAAACAGGTGTCTCCATGCGAAGAGCCGTCTATATGAATATTGTTAGCT
C4              CCAAACAGGTGTCTCCATGCGAAGAGCCATCTATATGAACATTGTTAGCT
C5              CCAAACAGGTGTCTCCATTCGAAGAGCCGTCTATTTGAACATTGTTAGTT
C6              CCAAACTGGTGTATCCATGAGAAGAGCCGTCTACATGAACATTGTAAGCT
                 *****:*****.***** .********.**** :**** *****:** *

C1              CAGTTCTTAGCTTTGTGGGCATGTCGGTGGGTCTCTTTATTGCTGGAATT
C2              CAGTTCTTAGCTTTGTGGGCATGTCCGTGGGCCTGTTTATTGCGGGAATT
C3              CAGTTCTTAGCTTTGTGGGCATGTCCGTGGGCCTGTTTATTGCGGGAATT
C4              CAGTTCTCAGCTTTGTGGGCATGTCCGTGGGTCTGTTTATCGCGGGAATT
C5              CAGTTCTCAGCTTTGTGGGCATGTCCGTGGGTCTGTTTATCGCGGGAATT
C6              CAGTTCTCAGCTTTGTGGGCATGTCTGTGGGTCTTTTCATTGCCGGCATT
                ******* ***************** ***** ** ** ** ** **.***

C1              GGAGACGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
C2              GGAGATGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
C3              GGAGATGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
C4              GGAGATGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
C5              GGAGATGGGATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
C6              GGTGATGGAATGACTCAATGGATTTATGCAGCCACTGCTGGTTCCTTCCT
                **:** ** ***** ******************** **************

C1              GTATATTGCTTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
C2              GTATATTGCCTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
C3              GTATATTGCCTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
C4              TTATATTGCCTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
C5              GTACATTGCCTTTGCCGATCTGGTGCCCACCATGAGTGTGGCCCACAATC
C6              GTACATCGCCTTTGCCGATTTGGTGCCCACGATGAGTGTGGCCCACAATC
                 ** ** ** ********* ********** *******************

C1              CGGAAAAGGCCAAAGATCCAAAGGGTATAATAATACAAATTTTTGGTATC
C2              CGGAGATGGCCAAAGATCCAAAGGGTATAATTATACAAATTTTTGGCATC
C3              CGGAGATGGCCAAAGATCCAAAGGGTATAATTATACAAATTTTTGGCATC
C4              CGGAGATGGCCAAAGATCCAAAGGGTATAATAATACAAATTGTTGGTATC
C5              CGGAGATGGCCAAAGACCCAAAGGGTATAATAATACAAATATTTGGTATC
C6              CGGAGATGGCCAAAGATCCAAAGGGTATTATTATTCAAATTGTTGGAATC
                ****.*:********* ***********:**:**:*****: **** ***

C1              CTTCTGGGTGGACTGATAATGTTGGCTATTGCCCTCAATGAACACGATTT
C2              CTTCTGGGTGGACTGATTATGTTGGCTATTGCCCTTAATGAGCACGATTT
C3              CTTCTGGGTGGACTGATAATGTTGGCTATTGCCCTTAATGAGCACGATTT
C4              CTTCTGGGTGGACTGATAATGCTAGCTATTGCCCTAAACGAACACGATTT
C5              CTTCTGGGTGGACTGATAATGTTGACTATTGCCCTTAATGAGCACGATTT
C6              CTCCTGGGTGGTCTGATAATGTTGGTTATTGCCCTGAACGAGCACGATTT
                ** ********:*****:*** *.. ********* ** **.********

C1              AGAGGGCCTGTTCAAGAGCTTT------
C2              AGAGGGCTTGTTCAAGAGCTTT------
C3              AGAGGGCTTGTTCAAGAGCTTT------
C4              AGAGGGTCTGTTCAAGAGCTTT------
C5              AGAGGGTCTGTTCAAGAGCTTT------
C6              GGAGGGTCTGTTTAAGAGCTTT------
                .*****  **** *********      



>C1
ATGGCCCAAAAGCAGGTGCTAGTCTTAAACCTATTTTGCCTGGGCTCACT
ATTTTTCAAAACAGTGCCAGCTTCCACGGAATACAACAAATACGTGGCGC
AGATATTTCAAAAATACGGCAACGGCGGGACAATCAACTTTGAGGGTCTT
GAGCATTTGATGTTCAGCCTGAACTTGGGTCAAATCCAATTCGATCCCTC
GCACACGATCGATCAGCATCGACCTCAGGGATACTCGAACGAGATGCCGC
ATGCCACAAATGTAACGTATTACTTTGAGCCGACACGAGTCAATGCCACC
GATGAGGAAGCTTTGGAGCTGCAAATCTCT---CCTCGTGGCAATCACTC
AAATTCACAGTCGGAGGCCGAGGTTCCGGAGTTCCTAGAAATTCATGACC
CCAAGCACCGACATCCGAGGGAGAGTTCTGAACCTGTTGCCGCTTGCTTA
TCACCGAAGTCTTTACTTTCCCTCATCGTGAACCACAACGATCTCCACAA
AAACATTGCCTACCGCAAGCTGCTCATTAAGAATGACGTTAGCTCAACTG
ATGGCGTCCACAATTCTGAAGAGGAATACAACGAATTCATCAACTCGGTG
CGGATCACTCCGCGAGCTTTTATGAAACTCTGTCCAGCTCTATTAGCCCA
GATCGATAATGGAGTTTGCAAGCAACCAGCTGTACGATCAGTAAACCTTA
ACGATAAGAACCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACT
ATGCTTATACTGTCCGCTTGCGGATTGCTGGGCATTCTTCTGGTTCCTTT
GATGAAGTCGGCTGCCTATCAGGAAATTCTCAAGTTCCTAGTTTCCATCG
CTGTGGGCACTTTAGCTGGCGATGCCCTGATGCACTTGCTCCCCCATGCC
CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGTATCAATCCCTT
GGAATCTGATCACAAACATAGCAATGAGGCGGCTCTGCTATGTGGTTGTA
CTTTCCTGGCTGCTCTATTCATGTATATGCTGGAGAACCTGATTCCGCTG
CTAAAGGGCGGTAAGCCGGGT---CATGGACATAGCCACGGACATGGTCA
CAGCCACGGCCGCAGTCATGGACATATGGAGAAGCCAGCTGCAAAGGATG
CTATTGATCTGCCACCTCCTCGAGAGCTCAATGTGATGTTGCAGGAGGCC
AAGCTGGATGAGAAGACCCCCGATCGACCGCTCACCCCAGTAGCCTTCAT
GGTAATCATCGGAGATGGCTTGCACAATCTGACCGATGGTCTGGCCATAG
GTGCAGCCTTCGCAAGTGATCCGGTCACTGGATTTGCTACCGCCTTTGCC
GTTCTCTGCCATGAGTTGCCACACGAACTGGGCGACTTTGCTCTGTTGCT
GCAAACAGGTGTCTCCATGCGAAGAGCCGTCTATATGAACATTGTTAGCT
CAGTTCTTAGCTTTGTGGGCATGTCGGTGGGTCTCTTTATTGCTGGAATT
GGAGACGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
GTATATTGCTTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
CGGAAAAGGCCAAAGATCCAAAGGGTATAATAATACAAATTTTTGGTATC
CTTCTGGGTGGACTGATAATGTTGGCTATTGCCCTCAATGAACACGATTT
AGAGGGCCTGTTCAAGAGCTTT------
>C2
ATGGCCAAAAAGCAGGTGCTAGTCTTAACCCTAATTTGCCTGGGTTCGCT
ATTTTTGAAAACAGTGCCGGCTTCCACGGAATACAACGAATACGTGGCGC
AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
GAGCATCTGATGTTCAGCCTGAACTTGGGTCAAATCCAATTCGATCCCTC
GCACACGATCGATCAGCATCGACCTCAGGGATACTCCAACGAGATGCCGC
ATGAAACAAATGTCACGTACTACTTTGAGCCGACACGAGTCAATGCCACC
GACGAGGAAGCTTTGGAGCTGCAAATCTCT---CCTCGTGGCAATCGCTC
AAAGTCGGAGTCGGAGAACGAGATTCCGGAGTTCCTAGAAATGCATGACT
CCAAGCACCGACATCCGAGGGAGAGTTCTGAACCTGTTGCCGCTTGCTTA
TCACCAAAGTCGCTGCTTTCCCTCATCGTGAACCACAACGATCTCCACAA
AAACATTGCCTACCGAACACTGCTCATTAAGAATGACGTTAGCTCAACTG
ATGGCATCCACAATTCGGAAGAGGAATACAACGAATTCATCAACTCGGTG
CGGATCACTCCGCGAGCTTTTATGAAACTCTGTCCAGCTCTATTAGCCCA
GATCGATAATGGAGTTTGCAAGCAACCAACTGCACGATCAGAAAACCTTA
ACGATAAGAACCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACC
ATGTTTATACTGTCCGCTTGCGGATTGCTGGGCATTCTTCTGGTTCCTTT
GATGAAGTCGGCTGCCTATCAGGAAATTCTCAAGTTCCTGGTTTCCATCG
CTGTGGGTACTTTATCTGGCGATGCCCTGATGCACTTGCTCCCCCATGCT
CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGTATCAATCCCTT
GGAATCTGATCACAAACATAGCAATGAGGCGGCTCTGCTTTGTGGTTGTA
CTTTCCTGGCGGCACTATTCATGTATATGCTGGAGAACTTGATTCCGCTG
CTAAAGGGAACCAAGCCAGGT---CATGGACATAGCCATGGTCATGGTCA
CAGCCACGGCTACAGTCATGGACATATGGAAAAGCCCGCTGCGAAGGATG
CTATTGATTTGCCAGCTCCTCGGGAGCTCAATGTGATGCTGCAGGAAGCC
AATCTGGATGAGAAGACCCCCGATCGACCGCTCACCCCAGTAGCCTTTAT
GGTAATCATCGGAGATGGCTTGCACAATCTGACCGACGGTCTGGCCATAG
GTGCAGCCTTCGCAAGTGATCCGGTCACTGGATTTGCTACCGCCTTTGCC
GTTCTCTGCCATGAGTTGCCCCACGAACTGGGCGACTTCGCACTGTTGCT
CCAAACAGGTGTCTCCATGCGAAGAGCCGTCTATATGAACATTGTTAGCT
CAGTTCTTAGCTTTGTGGGCATGTCCGTGGGCCTGTTTATTGCGGGAATT
GGAGATGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
GTATATTGCCTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
CGGAGATGGCCAAAGATCCAAAGGGTATAATTATACAAATTTTTGGCATC
CTTCTGGGTGGACTGATTATGTTGGCTATTGCCCTTAATGAGCACGATTT
AGAGGGCTTGTTCAAGAGCTTT------
>C3
ATGGCCAAAAAGCAGGTGCTAGTCTTAACCCTAATTTGCCTGGGTTCGCT
ATTTTTGAAAACAGTGCCGGCTTCCACGGAATACAACAAATACGTGGCGC
AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
GAGCATCTGATGTTCAGCCTGAACTTGGGTCAAATCCAATTCGATCCCTC
GCACACGATTGATCAGCATCGACCTCAGGGATACTCCAACGAGATGCCGC
ATGCCACAAATGTCACGTACTACTTTGAGCCGACACGAGTCAATGCCACC
GACGAGGAAGCTTTGGAGCTGCAAATCTCT---CCACGTGGCAATCGCTC
AAAGTCGGAGTCGGAGGCCGAGGTTCCGGAGTTCCTAGAAATGCATGACC
CCAAGCACCGACATCCGAGGGAGAGTTCTGAACCTGTTGCCGCTTGCTTA
TCACCAAAGTCGCTGCTTTCCCTCATCGTGAACCACAACGATCTCCACAA
AAACATTGCCTACCGCAAGCTGCTCATTAAGAATGACGTTAGCTCAACTG
ATGGCATCCACAATTCTGAAGAGGAATACAACGAATTCATCAACTCGGTG
CGGATCACTCCGCGAGCTTTTATGAAACTCTGTCCAGCTCTTTTAGCCCA
GATCGATAATGGAGTTTGCAAGCAACCAGCTGCACGATCAGAAAACCTAA
ACGATAAGAACCAAAAGATATGGTATGCTTGGATCTATGCCAGCATCACT
ATGCTTATACTGTCCGCTTGCGGATTACTGGGCATTCTTCTGGTTCCTTT
GATGAAGTCGGCTGCCTATCAGGAAATTCTCAAGTTCCTGGTTTCCATCG
CTGTGGGCACTTTAGCTGGCGATGCCCTGATGCACTTGCTCCCCCATGCT
CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGTATCAATCCCTT
GGAATCAGATCACAAACATAGCAATGAGGCGGCTCTGCTATGTGGTTGTA
CTTTCCTAGCGGCGCTATTCATGTACATGCTAGAGAACCTGATTCCGCTG
CTAAAGGGAAGCAAGCCAGGT---CATGGACACAGCCACGGACATGGTCA
CAGCCACGGCCACAGTCATGGACATATGGAGAAGCCCGCTGCGAAGGATG
CTATTGATCTGCCAGCTCCTCGAGAGCTCAATGTGATGCTGCAGGAAGCC
AAGCTGGATGAGAAGACTCCCGATCGACCGCTCACCCCAGTAGCCTTCAT
GGTAATCATCGGAGATGGTTTGCACAATCTGACCGACGGTCTGGCCATAG
GTGCAGCCTTCGCAAGTGATCCGGTCACTGGATTTGCTACCGCCTTTGCC
GTACTCTGCCATGAGTTGCCCCACGAACTGGGCGACTTTGCTCTGTTGCT
CCAAACAGGTGTCTCCATGCGAAGAGCCGTCTATATGAATATTGTTAGCT
CAGTTCTTAGCTTTGTGGGCATGTCCGTGGGCCTGTTTATTGCGGGAATT
GGAGATGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
GTATATTGCCTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
CGGAGATGGCCAAAGATCCAAAGGGTATAATTATACAAATTTTTGGCATC
CTTCTGGGTGGACTGATAATGTTGGCTATTGCCCTTAATGAGCACGATTT
AGAGGGCTTGTTCAAGAGCTTT------
>C4
ATGGCCCAAAAGCAGGTGCTAGTCTTAACCCTAATTTGCCTGGGTTCGCT
ATTTTTGAAAACGGTGCCGGCTTCCACGGAATACAACAAGTACGTGGCGC
AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
GAGCATTTGATGTTCAGCCTGAACCTGGGTCAAATCCAATTCGATCCCTC
GCACACGATCGATCAGCATCGACCTCAGGGATACTCCAACCAAAGAACAC
GTGGCTCCAATGTCACTTATTACTTTGAGCCAACACAAGTCAATACCACC
GATGAGGAGGCTTTGGAGGTGCAAATCTCT---CCACCTGGCAATCGCTC
AAAGGCGGAGTCGGAGGCCGAGGTTCCTGAATTCCTGGAAATGCATGATC
CCAAGCACCGCCATCCGAGGGAGAGTTCAGAACCTGTTGCAGCTTGCTTA
TCGCCCAAGTCGTTGCTTTCCCTCATCGTAAACCACAACGATCTCCACAA
AAACATTGCCTACCGCAAATTGCTCATTAAGAATGACGCTAGTGCAACTG
ATGCCATCCACAATTCTGAAGAGGAATACAACGAATTCATCAACTCGGTG
CGGATCACTCCGCGAGCTTTTATGAAACTCTGCCCAGCTCTATTAGCCCA
AATCGATAATGGAGTGTGCAAGCAACCAGCTGCTCGATCGGAAAACCTTA
ACAATAAGAACCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACC
ATGTTTATACTCTCCGCTTGCGGTTTGCTGGGAATTCTTCTGGTTCCTCT
GATGAAGTCAGCTGCCTACCAGGAAATCCTCAAGTTCCTGGTCTCTATCG
CTGTGGGCACTTTGGCTGGCGATGCCCTCATGCACTTGCTGCCACATGCT
CTTTTCAAGGAGGAAAAGCACGAGGAGGAAGTCACTGGCATTAATCCCTT
GGAATCAGATCACAAGCATAGCAATGAGGCGGCTCTGCTATGTGGTTGTA
CTTTCCTGGCGGCGCTATTCATGTATATGCTGGAGAACCTGATACCGCTT
CTCAAGGGAGGTAAGCCAGGTGGCCATGGACATAGCCATGGACATGGTCA
CAGCCAC------AGTCACGGACATATGGAGAAGCCCGCTGCCAAGGATG
CTGTTGAACTCCCCCTTCCGCGAGAACTCAATGTGATGCTGCAGGAGGCC
AAGCTGGACGAGAAGACCCCTGATCGACCGCTCACTCCAGTAGCCTTCAT
GGTAATCATCGGAGATGGCTTGCACAATCTGACCGACGGTTTGGCCATAG
GTGCAGCCTTTGCAAGTGATCCGGTCACTGGATTTGCTACAGCCTTTGCC
GTTCTCTGCCATGAGTTGCCACACGAACTAGGCGACTTCGCACTGTTGCT
CCAAACAGGTGTCTCCATGCGAAGAGCCATCTATATGAACATTGTTAGCT
CAGTTCTCAGCTTTGTGGGCATGTCCGTGGGTCTGTTTATCGCGGGAATT
GGAGATGGCATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
TTATATTGCCTTTGCCGATCTGGTGCCCACAATGAGTGTGGCCCACAATC
CGGAGATGGCCAAAGATCCAAAGGGTATAATAATACAAATTGTTGGTATC
CTTCTGGGTGGACTGATAATGCTAGCTATTGCCCTAAACGAACACGATTT
AGAGGGTCTGTTCAAGAGCTTT------
>C5
ATGGCCCAAAAGCAGGTGCTAGTCCTAACCCTAATATGCCTGGGTTCGCT
GTTTCTCAAAACAGTGCCGGCTTCCACGGAATACAACAAATACGTGGCGC
AGATATTTCAAAAATACGGCAATGGCGGGACAATCAACTTTGAGGGTCTT
GAGCATTTGATGTTCAGCCTGAACCTGGGTCAAATCCAATTCGAGCCCTC
GCACACGATCGATCAGCATCGACCTCAGGGATACTCCAACCAGACAACGC
GTTGCATCAATGGCACGTATTACTTGGAGCCG---CGAGCTAACGCCACG
GATGAGGAGGCTTTGGAGGTGCAAATCTCT---CCGCCTGGCAATCGCTC
AAAGTCAGAGTGGAACGCCCAGGTTCCGGAATTCCTTGAAATGCATGACC
CCAAGCACCGGCACCCGAGGGAGAGTTCAGAACCTGTTGCATCTTGCTTA
TCACCCAAGTCGTTGCTTTCTCTCCTCGTTAACCACAACGACCTCCACAA
AAACAATGCCTACCGCACACTGCTCATTAAGAATGATGTTAGTTCAACGG
ATGCCATTCATAATTCTGAAGAGGAATACAACAAATTCATCAACTCGGTG
CGGATCACTCCGCAAGCTTTTATGAAACTCTGCCCAGCTCTATTAGCCCA
AATCGATAATGGAGTGTGCAAGCAACCAGCTGTTCGATCAGAAAGCCTTA
ACGATAAGAATCAGAAGATATGGTACGCTTGGATCTATGCCAGCATCACC
ATGCTTCTACTCTCCGTCTGCGGTCTGCTGGGAATTCTTCTGGTTCCCTT
GATGAAGTCAGCTGCCTATCAAGAAATCCTCAAGTTCCTGGTTTCCATCG
CTGTGGGCACTTTAGCTGGCGATGCCCTCATGCACTTGCTCCCACATGCT
CTTTTCAAGGAGGAACAGCACGAGGAGGAAGTCACTGGTATTAATCCTTT
GGAATCAGATCACAAACATAGCAATGAGGCGGCTCTGCTTTGTGGTTGTA
CTTTCCTGGCGGCACTATTCATGTATATGCTGGAGAACCTGATTCCGCTG
CTGAAAGGGGGTAAGCCAGGC---CATGGACATAGCCATGGACATGGTCA
CAGCCACGGCCACAGTCATGAACATATGGAGAAGCCCGCTGCCCAGAATG
CCATTGATCTGCCAACTCCTCGAGAACTAAATGTGATGCTGCAGGAAGCC
ACGCTGGATGAGAAGACTCCTGATCGACCGCTCACCCCAGTAGCCTTCAT
GGTAATCATCGGAGATGGCTTGCACAATCTGACCGACGGTCTGGCCATAG
GTGCAGCCTTTGCAAGTGATCCGGTCACTGGTTTCGCTACTGCCTTCGCC
GTTCTCTGCCATGAGTTGCCACACGAACTAGGCGACTTCGCTCTGCTGCT
CCAAACAGGTGTCTCCATTCGAAGAGCCGTCTATTTGAACATTGTTAGTT
CAGTTCTCAGCTTTGTGGGCATGTCCGTGGGTCTGTTTATCGCGGGAATT
GGAGATGGGATGACCCAATGGATTTATGCAGCCACCGCTGGTTCCTTCCT
GTACATTGCCTTTGCCGATCTGGTGCCCACCATGAGTGTGGCCCACAATC
CGGAGATGGCCAAAGACCCAAAGGGTATAATAATACAAATATTTGGTATC
CTTCTGGGTGGACTGATAATGTTGACTATTGCCCTTAATGAGCACGATTT
AGAGGGTCTGTTCAAGAGCTTT------
>C6
ATGGCCCAAAGGCAGGTGCTAGTTTTAACCCTCTTCTGCCTGGGTTTGTT
GTTTTTCCCAACTGTGCAGACGGCCACGGAATACAATCGCTATTTGGCCG
AGATATTCCAAAAATACGGCAACGGCGGGACCATCAACTTTGAGGGTCTT
GAGCATTTGATGTTCAGCTTGAACTTGGGCCAAATCCAGTTCGATCCCTC
GCACACGATCGATCAGCATCGACCCCAGGGATACTCCCAGGAGGTGGCGC
ACCCCACAAATGCCACATACTACTTCGAGCCGACACGAGTTAGTGCCACC
GATGAGGAAGCTTTGGAGGTGCAGATCTCGACGCCATCCAGTAATCTCTC
TAAGCCAGAGACGGGCCCTGAGGTACCGGAGTTCCTGGAAATTCATGACC
CCAAGCACCGGCACCCAAGGGAGAGCTCTGAACCTGTTGCCGCTTGCTTA
TCCCCCAAGTCATTGCTTTCCCTGCTCGTGGACCACAATGATCTCCACAA
GAACATTGCCTACCAAAAATTGTTCAAGAAGGAAGGCTTCTCTGGAACAG
ACACCATGCACAACTCTGAGGAGGAGTACAACGAGTTCATCAACTCGGTG
CGGATTACTCCTCGGGCTTTTATGAAACTCTGCCCAGCTCTATTGGCTCA
AATCGATAATGGAGTTTGCAAGCAACCAGCTCCGCGTTCCGAGAATCTTA
GCGATAAGAAGCAAAAGATTTGGAATGCGTGGATCTATGCCAGCATCACC
ATGCTGATTCTCTCTGCTTGCGGTTTGCTGGGAATTCTTCTGGTTCCTCT
GATGAAGACAGCTGCCTACCAGGAGATCCTCAAGTTCCTAGTCTCTGTTG
CCGTGGGCACTTTAGCCGGTGACGCCCTGATGCACTTGCTGCCCCACGCT
CTTTTTAAGGAAGAGAAGCATGAGGAGGACGTGACGGGCATCAATCCCCT
GGAATCGGACCACAAACATAGCAATGAGGCTGCCCTGCTTTGTGGTTGCT
CTTTCCTGGCGGCCCTCTTCATGTACATGTTGGAGAACCTAATTCCCTTG
CTAAAAGGAGGTAAAACAGGT---CATGGTCATAGCCACGGACATGGTCA
CAGTCACGGCCAAAGCCATGGTCACATGGAGAAGCCAGCTTCACACGACA
CTCCCGAACTCCCAGCTCCTCGAGAACTCAATGTAATGCTGCAGGAGGCC
AAGCTGGATGAGAAGACTCCCGATCGTCCACTGACGCCGGTGGCTTTTAT
GGTAGTCATCGGCGATGGTCTCCACAACCTAACCGATGGCTTGGCCATTG
GTGCAGCGTTTGCCAGTGATCCGGTCACTGGGTTCGCCACCGCTTTTGCA
GTCCTTTGCCACGAGTTGCCCCACGAGCTAGGCGATTTCGCTCTGCTCCT
CCAAACTGGTGTATCCATGAGAAGAGCCGTCTACATGAACATTGTAAGCT
CAGTTCTCAGCTTTGTGGGCATGTCTGTGGGTCTTTTCATTGCCGGCATT
GGTGATGGAATGACTCAATGGATTTATGCAGCCACTGCTGGTTCCTTCCT
GTACATCGCCTTTGCCGATTTGGTGCCCACGATGAGTGTGGCCCACAATC
CGGAGATGGCCAAAGATCCAAAGGGTATTATTATTCAAATTGTTGGAATC
CTCCTGGGTGGTCTGATAATGTTGGTTATTGCCCTGAACGAGCACGATTT
GGAGGGTCTGTTTAAGAGCTTT------
>C1
MAQKQVLVLNLFCLGSLFFKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQISoPRGNHSNSQSEAEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGVHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAVRSVNLNDKNQKIWYAWIYASIT
MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPGoHGHSHGHGHSHGRSHGHMEKPAAKDAIDLPPPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSF
>C2
MAKKQVLVLTLICLGSLFLKTVPASTEYNEYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHETNVTYYFEPTRVNAT
DEEALELQISoPRGNRSKSESENEIPEFLEMHDSKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRTLLIKNDVSSTDGIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPTARSENLNDKNQKIWYAWIYASIT
MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLSGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGTKPGoHGHSHGHGHSHGYSHGHMEKPAAKDAIDLPAPRELNVMLQEA
NLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSF
>C3
MAKKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMPHATNVTYYFEPTRVNAT
DEEALELQISoPRGNRSKSESEAEVPEFLEMHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNDKNQKIWYAWIYASIT
MLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGSKPGoHGHSHGHGHSHGHSHGHMEKPAAKDAIDLPAPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLAIALNEHDLEGLFKSF
>C4
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSNQRTRGSNVTYYFEPTQVNTT
DEEALEVQISoPPGNRSKAESEAEVPEFLEMHDPKHRHPRESSEPVAACL
SPKSLLSLIVNHNDLHKNIAYRKLLIKNDASATDAIHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAARSENLNNKNQKIWYAWIYASIT
MFILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEKHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPGGHGHSHGHGHSHooSHGHMEKPAAKDAVELPLPRELNVMLQEA
KLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAIYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
LLGGLIMLAIALNEHDLEGLFKSF
>C5
MAQKQVLVLTLICLGSLFLKTVPASTEYNKYVAQIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFEPSHTIDQHRPQGYSNQTTRCINGTYYLEPoRANAT
DEEALEVQISoPPGNRSKSEWNAQVPEFLEMHDPKHRHPRESSEPVASCL
SPKSLLSLLVNHNDLHKNNAYRTLLIKNDVSSTDAIHNSEEEYNKFINSV
RITPQAFMKLCPALLAQIDNGVCKQPAVRSESLNDKNQKIWYAWIYASIT
MLLLSVCGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHA
LFKEEQHEEEVTGINPLESDHKHSNEAALLCGCTFLAALFMYMLENLIPL
LKGGKPGoHGHSHGHGHSHGHSHEHMEKPAAQNAIDLPTPRELNVMLQEA
TLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSIRRAVYLNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIFGI
LLGGLIMLTIALNEHDLEGLFKSF
>C6
MAQRQVLVLTLFCLGLLFFPTVQTATEYNRYLAEIFQKYGNGGTINFEGL
EHLMFSLNLGQIQFDPSHTIDQHRPQGYSQEVAHPTNATYYFEPTRVSAT
DEEALEVQISTPSSNLSKPETGPEVPEFLEIHDPKHRHPRESSEPVAACL
SPKSLLSLLVDHNDLHKNIAYQKLFKKEGFSGTDTMHNSEEEYNEFINSV
RITPRAFMKLCPALLAQIDNGVCKQPAPRSENLSDKKQKIWNAWIYASIT
MLILSACGLLGILLVPLMKTAAYQEILKFLVSVAVGTLAGDALMHLLPHA
LFKEEKHEEDVTGINPLESDHKHSNEAALLCGCSFLAALFMYMLENLIPL
LKGGKTGoHGHSHGHGHSHGQSHGHMEKPASHDTPELPAPRELNVMLQEA
KLDEKTPDRPLTPVAFMVVIGDGLHNLTDGLAIGAAFASDPVTGFATAFA
VLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI
GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEMAKDPKGIIIQIVGI
LLGGLIMLVIALNEHDLEGLFKSF


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1728 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481301122
      Setting output file names to "/opt/ADOPS/443/Zip71B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1267166073
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 2150537714
      Seed = 391723254
      Swapseed = 1481301122
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 58 unique site patterns
      Division 2 has 42 unique site patterns
      Division 3 has 136 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5731.540136 -- -24.965149
         Chain 2 -- -5677.834518 -- -24.965149
         Chain 3 -- -5725.061553 -- -24.965149
         Chain 4 -- -5746.955400 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5730.507931 -- -24.965149
         Chain 2 -- -5626.956446 -- -24.965149
         Chain 3 -- -5676.452345 -- -24.965149
         Chain 4 -- -5711.272922 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5731.540] (-5677.835) (-5725.062) (-5746.955) * [-5730.508] (-5626.956) (-5676.452) (-5711.273) 
        500 -- (-4872.531) (-4874.092) [-4849.145] (-4880.251) * (-4868.654) (-4855.916) (-4876.126) [-4858.346] -- 0:33:19
       1000 -- (-4837.518) (-4836.217) [-4777.513] (-4861.796) * (-4834.929) [-4814.630] (-4842.706) (-4841.944) -- 0:16:39
       1500 -- (-4817.387) (-4804.615) [-4777.341] (-4822.265) * (-4812.394) (-4794.181) (-4816.479) [-4785.891] -- 0:11:05
       2000 -- (-4778.568) (-4767.251) [-4763.534] (-4783.843) * (-4803.902) (-4763.649) (-4813.224) [-4770.607] -- 0:08:19
       2500 -- (-4757.720) (-4763.371) [-4755.820] (-4759.240) * [-4754.332] (-4756.410) (-4783.465) (-4754.351) -- 0:06:39
       3000 -- (-4752.340) (-4757.495) [-4747.865] (-4759.180) * (-4752.960) [-4754.715] (-4767.477) (-4755.264) -- 0:11:04
       3500 -- (-4755.215) (-4754.388) (-4753.825) [-4755.806] * (-4757.073) (-4747.363) [-4746.274] (-4749.961) -- 0:09:29
       4000 -- (-4752.368) (-4751.972) [-4753.673] (-4754.361) * [-4752.736] (-4747.289) (-4751.714) (-4750.379) -- 0:08:18
       4500 -- (-4750.785) (-4749.322) (-4753.689) [-4748.270] * (-4752.557) [-4747.871] (-4756.316) (-4751.022) -- 0:07:22
       5000 -- (-4747.395) [-4750.900] (-4754.908) (-4759.073) * (-4752.713) [-4750.634] (-4749.399) (-4753.276) -- 0:09:57

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-4755.786] (-4748.581) (-4755.159) (-4751.088) * (-4762.528) [-4750.993] (-4752.918) (-4750.518) -- 0:09:02
       6000 -- (-4759.569) (-4752.113) (-4750.209) [-4746.243] * (-4751.487) (-4752.261) (-4755.340) [-4758.294] -- 0:08:17
       6500 -- [-4753.317] (-4753.312) (-4747.360) (-4750.704) * (-4755.595) [-4753.032] (-4758.075) (-4758.228) -- 0:07:38
       7000 -- (-4755.678) [-4751.813] (-4751.340) (-4757.558) * (-4754.945) (-4750.910) [-4749.337] (-4752.639) -- 0:07:05
       7500 -- (-4757.587) [-4752.077] (-4751.929) (-4750.868) * [-4760.597] (-4753.307) (-4749.512) (-4755.945) -- 0:08:49
       8000 -- (-4762.237) [-4754.681] (-4750.248) (-4748.533) * [-4756.900] (-4749.108) (-4760.218) (-4749.174) -- 0:08:16
       8500 -- (-4752.686) (-4752.050) (-4753.233) [-4751.553] * (-4759.303) (-4757.200) [-4750.432] (-4746.753) -- 0:07:46
       9000 -- (-4758.199) (-4754.699) (-4750.068) [-4749.335] * (-4752.612) [-4749.054] (-4754.020) (-4751.883) -- 0:07:20
       9500 -- [-4755.640] (-4749.103) (-4751.916) (-4748.467) * [-4752.360] (-4750.304) (-4756.815) (-4754.885) -- 0:06:57
      10000 -- (-4747.908) (-4761.891) (-4751.887) [-4748.759] * (-4756.797) (-4753.103) (-4754.083) [-4746.927] -- 0:08:15

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-4756.170) (-4753.158) [-4752.500] (-4750.392) * (-4751.653) (-4758.654) (-4754.917) [-4748.850] -- 0:07:51
      11000 -- (-4754.335) (-4753.373) [-4749.626] (-4750.785) * (-4753.156) (-4749.794) [-4749.593] (-4754.724) -- 0:07:29
      11500 -- (-4750.301) [-4749.032] (-4753.209) (-4750.878) * (-4748.890) (-4750.491) [-4747.794] (-4753.133) -- 0:07:09
      12000 -- (-4754.566) [-4751.872] (-4746.112) (-4747.301) * (-4749.194) [-4746.957] (-4750.369) (-4755.713) -- 0:06:51
      12500 -- (-4763.885) (-4761.376) (-4749.139) [-4750.961] * (-4753.739) (-4755.613) [-4749.445] (-4753.469) -- 0:07:54
      13000 -- (-4760.548) [-4756.993] (-4746.476) (-4750.719) * (-4751.040) (-4752.630) [-4753.097] (-4751.521) -- 0:07:35
      13500 -- (-4757.659) [-4751.429] (-4758.733) (-4750.280) * (-4750.950) (-4762.291) [-4751.927] (-4747.346) -- 0:07:18
      14000 -- (-4754.390) (-4750.983) [-4752.934] (-4751.742) * (-4756.364) (-4764.786) (-4751.295) [-4749.267] -- 0:07:02
      14500 -- (-4753.306) (-4752.907) (-4748.123) [-4752.494] * (-4755.106) (-4758.128) (-4763.096) [-4747.799] -- 0:07:55
      15000 -- (-4747.868) [-4756.009] (-4752.169) (-4757.711) * (-4755.311) (-4753.382) [-4749.421] (-4753.019) -- 0:07:39

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-4756.623) (-4754.029) [-4748.096] (-4761.340) * (-4750.716) [-4755.882] (-4758.410) (-4756.670) -- 0:07:24
      16000 -- [-4752.165] (-4754.028) (-4759.044) (-4760.808) * (-4750.418) (-4753.070) [-4752.420] (-4747.484) -- 0:07:10
      16500 -- [-4755.119] (-4754.172) (-4754.187) (-4762.677) * [-4749.806] (-4752.718) (-4755.421) (-4751.195) -- 0:06:57
      17000 -- (-4752.900) (-4751.853) [-4748.313] (-4758.815) * [-4752.856] (-4750.816) (-4761.021) (-4761.730) -- 0:07:42
      17500 -- (-4750.539) [-4749.545] (-4750.521) (-4751.226) * (-4749.512) (-4754.171) [-4752.959] (-4748.891) -- 0:07:29
      18000 -- [-4750.699] (-4752.587) (-4748.471) (-4752.950) * (-4750.932) [-4751.526] (-4748.056) (-4754.422) -- 0:07:16
      18500 -- (-4748.620) (-4756.670) (-4752.505) [-4752.631] * [-4750.721] (-4758.758) (-4753.301) (-4763.664) -- 0:07:04
      19000 -- (-4748.461) [-4751.290] (-4756.454) (-4750.552) * [-4748.496] (-4759.707) (-4750.913) (-4756.493) -- 0:06:53
      19500 -- (-4756.535) (-4750.967) (-4755.452) [-4746.945] * (-4747.868) (-4759.811) [-4752.539] (-4754.215) -- 0:07:32
      20000 -- (-4753.447) (-4752.178) (-4754.433) [-4750.994] * (-4752.666) [-4753.839] (-4750.901) (-4747.854) -- 0:07:21

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-4760.766) (-4754.095) (-4752.997) [-4749.823] * [-4747.258] (-4758.324) (-4751.012) (-4748.248) -- 0:07:10
      21000 -- (-4749.792) (-4750.496) [-4748.013] (-4760.712) * [-4744.568] (-4756.366) (-4749.141) (-4757.869) -- 0:06:59
      21500 -- (-4749.875) [-4747.538] (-4753.382) (-4754.121) * [-4749.559] (-4760.739) (-4754.605) (-4759.090) -- 0:06:49
      22000 -- [-4754.958] (-4749.572) (-4748.284) (-4754.367) * [-4748.309] (-4753.513) (-4748.640) (-4756.323) -- 0:07:24
      22500 -- [-4751.925] (-4760.254) (-4752.429) (-4749.428) * (-4749.599) (-4751.510) [-4748.355] (-4750.598) -- 0:07:14
      23000 -- (-4749.419) (-4753.354) (-4752.279) [-4756.962] * [-4747.457] (-4745.758) (-4756.104) (-4754.174) -- 0:07:04
      23500 -- (-4758.284) (-4752.984) [-4752.295] (-4753.114) * (-4752.185) [-4750.701] (-4755.479) (-4755.020) -- 0:06:55
      24000 -- (-4757.273) (-4754.664) [-4753.053] (-4750.259) * (-4759.673) (-4754.032) [-4753.216] (-4754.451) -- 0:06:46
      24500 -- (-4755.251) (-4754.470) (-4750.774) [-4750.557] * (-4750.352) (-4751.318) [-4754.943] (-4758.395) -- 0:07:17
      25000 -- [-4757.572] (-4760.972) (-4747.879) (-4751.912) * [-4749.929] (-4760.975) (-4753.994) (-4756.513) -- 0:07:09

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-4755.924) (-4751.765) (-4756.672) [-4752.012] * (-4750.761) [-4753.657] (-4752.333) (-4747.736) -- 0:07:00
      26000 -- (-4753.825) (-4750.304) [-4755.718] (-4759.544) * (-4754.430) (-4752.430) [-4745.817] (-4760.340) -- 0:06:52
      26500 -- (-4751.983) (-4750.317) [-4758.999] (-4753.653) * (-4750.785) [-4751.034] (-4758.167) (-4747.091) -- 0:06:44
      27000 -- (-4754.338) (-4754.976) (-4756.488) [-4754.714] * (-4752.044) (-4755.139) [-4751.451] (-4752.129) -- 0:07:12
      27500 -- (-4758.807) (-4754.201) [-4758.093] (-4751.357) * (-4753.915) [-4750.318] (-4756.873) (-4747.157) -- 0:07:04
      28000 -- (-4752.322) (-4752.647) (-4754.188) [-4751.883] * (-4759.729) (-4749.679) (-4755.017) [-4748.707] -- 0:06:56
      28500 -- (-4750.310) (-4751.149) [-4758.051] (-4755.950) * [-4752.904] (-4755.812) (-4752.844) (-4753.884) -- 0:06:49
      29000 -- (-4746.973) (-4750.572) (-4760.224) [-4749.387] * [-4748.032] (-4755.015) (-4767.066) (-4758.266) -- 0:07:15
      29500 -- (-4749.893) (-4750.243) (-4750.800) [-4748.615] * (-4753.552) [-4751.595] (-4760.697) (-4751.766) -- 0:07:07
      30000 -- [-4750.912] (-4758.213) (-4751.338) (-4751.592) * [-4753.481] (-4753.968) (-4761.634) (-4750.214) -- 0:07:00

      Average standard deviation of split frequencies: 0.005124

      30500 -- [-4750.090] (-4751.851) (-4752.728) (-4753.716) * (-4752.077) [-4752.177] (-4770.545) (-4753.692) -- 0:06:53
      31000 -- [-4749.439] (-4746.393) (-4752.497) (-4751.993) * (-4752.648) [-4747.908] (-4755.346) (-4751.976) -- 0:06:46
      31500 -- [-4751.808] (-4763.223) (-4757.665) (-4755.527) * (-4754.414) (-4754.369) (-4762.745) [-4748.454] -- 0:07:10
      32000 -- (-4759.320) [-4748.123] (-4754.050) (-4753.560) * (-4752.160) (-4751.613) (-4754.541) [-4760.860] -- 0:07:03
      32500 -- (-4760.174) (-4759.235) [-4753.453] (-4757.468) * [-4749.289] (-4754.433) (-4755.284) (-4753.014) -- 0:06:56
      33000 -- (-4753.627) (-4756.595) [-4751.549] (-4755.184) * (-4745.234) (-4753.973) [-4751.559] (-4752.945) -- 0:06:50
      33500 -- (-4754.223) (-4752.753) (-4753.490) [-4752.485] * (-4749.504) (-4752.637) [-4760.990] (-4753.110) -- 0:06:43
      34000 -- (-4763.566) (-4749.732) [-4748.264] (-4760.120) * (-4754.791) (-4761.517) [-4755.499] (-4750.946) -- 0:07:06
      34500 -- [-4748.813] (-4749.983) (-4749.716) (-4749.937) * (-4756.944) (-4755.679) [-4753.681] (-4754.485) -- 0:06:59
      35000 -- [-4755.257] (-4756.063) (-4749.930) (-4751.957) * (-4748.217) (-4752.592) (-4756.974) [-4751.777] -- 0:06:53

      Average standard deviation of split frequencies: 0.004365

      35500 -- [-4757.744] (-4755.257) (-4757.876) (-4753.996) * [-4750.295] (-4748.163) (-4748.198) (-4747.706) -- 0:06:47
      36000 -- (-4754.426) (-4753.933) [-4751.611] (-4753.406) * (-4752.157) [-4751.661] (-4749.890) (-4751.422) -- 0:06:41
      36500 -- (-4751.433) (-4752.989) (-4759.597) [-4751.317] * (-4751.199) [-4752.845] (-4757.420) (-4758.398) -- 0:07:02
      37000 -- (-4757.495) [-4750.185] (-4761.489) (-4763.562) * (-4754.603) (-4761.367) (-4756.810) [-4756.967] -- 0:06:56
      37500 -- (-4756.319) (-4756.108) [-4753.780] (-4759.350) * (-4755.937) (-4753.940) [-4754.789] (-4750.085) -- 0:06:50
      38000 -- (-4753.805) (-4760.533) (-4749.737) [-4750.930] * (-4755.414) [-4753.150] (-4751.906) (-4750.829) -- 0:06:45
      38500 -- (-4749.148) (-4758.375) [-4751.350] (-4751.861) * (-4749.733) [-4753.716] (-4761.506) (-4758.460) -- 0:06:39
      39000 -- (-4752.985) [-4748.776] (-4752.017) (-4755.115) * (-4758.893) [-4753.828] (-4759.273) (-4752.673) -- 0:06:58
      39500 -- [-4753.056] (-4748.549) (-4750.063) (-4753.089) * (-4759.672) (-4754.214) [-4747.048] (-4747.720) -- 0:06:53
      40000 -- (-4752.989) [-4749.651] (-4751.088) (-4754.932) * [-4756.803] (-4758.174) (-4753.429) (-4751.882) -- 0:06:48

      Average standard deviation of split frequencies: 0.003864

      40500 -- (-4756.425) (-4756.585) [-4748.966] (-4759.843) * (-4760.308) (-4754.637) [-4751.678] (-4754.918) -- 0:06:42
      41000 -- [-4760.505] (-4752.075) (-4763.608) (-4762.926) * (-4752.800) (-4750.718) [-4753.352] (-4748.634) -- 0:06:37
      41500 -- (-4756.223) (-4753.471) (-4748.806) [-4755.445] * (-4753.233) (-4756.357) (-4750.464) [-4753.161] -- 0:06:55
      42000 -- (-4749.045) (-4755.019) [-4753.214] (-4758.608) * (-4751.827) (-4758.410) (-4757.292) [-4753.356] -- 0:06:50
      42500 -- (-4749.081) (-4750.082) (-4763.781) [-4752.537] * (-4755.417) [-4747.852] (-4751.410) (-4756.478) -- 0:06:45
      43000 -- [-4752.876] (-4763.686) (-4754.288) (-4765.553) * (-4755.796) (-4748.158) (-4753.486) [-4753.168] -- 0:06:40
      43500 -- (-4752.790) [-4748.513] (-4748.794) (-4768.548) * [-4750.637] (-4750.013) (-4753.387) (-4751.855) -- 0:06:57
      44000 -- (-4758.499) [-4753.074] (-4747.831) (-4754.677) * (-4753.667) [-4747.338] (-4746.666) (-4753.584) -- 0:06:52
      44500 -- [-4754.686] (-4757.670) (-4750.262) (-4753.570) * [-4756.397] (-4748.559) (-4758.812) (-4753.834) -- 0:06:47
      45000 -- (-4755.869) (-4754.385) (-4752.024) [-4751.114] * (-4754.576) (-4753.173) (-4760.764) [-4752.782] -- 0:06:43

      Average standard deviation of split frequencies: 0.003416

      45500 -- (-4748.209) (-4751.009) (-4750.529) [-4750.296] * (-4763.498) (-4752.943) (-4753.823) [-4748.382] -- 0:06:38
      46000 -- (-4750.689) [-4753.755] (-4748.541) (-4765.317) * (-4757.461) (-4751.096) (-4748.711) [-4752.445] -- 0:06:54
      46500 -- (-4754.332) [-4758.821] (-4751.985) (-4761.603) * (-4758.662) (-4748.370) [-4745.931] (-4753.082) -- 0:06:50
      47000 -- (-4744.094) [-4750.440] (-4755.113) (-4759.316) * (-4747.224) (-4751.671) [-4749.004] (-4758.357) -- 0:06:45
      47500 -- [-4756.014] (-4749.658) (-4746.944) (-4760.590) * [-4752.890] (-4753.171) (-4753.384) (-4753.213) -- 0:06:41
      48000 -- (-4749.991) (-4752.508) [-4752.939] (-4754.968) * (-4752.362) (-4751.839) [-4751.368] (-4757.147) -- 0:06:36
      48500 -- [-4757.042] (-4755.260) (-4750.839) (-4754.119) * (-4751.273) [-4754.186] (-4744.929) (-4751.647) -- 0:06:51
      49000 -- (-4758.539) (-4752.859) [-4752.912] (-4753.428) * (-4756.664) [-4755.553] (-4749.747) (-4753.796) -- 0:06:47
      49500 -- (-4749.926) [-4751.494] (-4753.492) (-4750.387) * (-4748.564) (-4761.209) [-4752.110] (-4751.346) -- 0:06:43
      50000 -- (-4755.604) (-4751.772) [-4753.002] (-4751.545) * (-4757.556) (-4755.807) (-4751.809) [-4757.279] -- 0:06:39

      Average standard deviation of split frequencies: 0.003101

      50500 -- (-4747.562) [-4750.075] (-4756.074) (-4760.501) * (-4749.135) [-4755.187] (-4760.445) (-4749.053) -- 0:06:34
      51000 -- [-4750.261] (-4752.954) (-4753.014) (-4751.764) * (-4754.929) [-4747.720] (-4751.826) (-4750.718) -- 0:06:49
      51500 -- (-4752.808) (-4758.109) [-4752.577] (-4759.429) * (-4755.894) [-4749.241] (-4752.147) (-4752.790) -- 0:06:45
      52000 -- (-4759.648) (-4753.149) [-4752.926] (-4751.622) * (-4759.832) (-4752.501) [-4748.182] (-4755.365) -- 0:06:41
      52500 -- (-4759.075) (-4746.549) (-4749.613) [-4752.695] * (-4759.731) (-4748.549) [-4756.268] (-4766.744) -- 0:06:37
      53000 -- (-4748.377) [-4749.740] (-4755.645) (-4749.231) * (-4757.266) [-4754.383] (-4750.836) (-4752.200) -- 0:06:33
      53500 -- (-4748.973) [-4750.379] (-4750.879) (-4753.565) * (-4763.214) (-4756.208) [-4751.930] (-4751.136) -- 0:06:46
      54000 -- (-4757.276) [-4751.585] (-4751.909) (-4751.766) * (-4758.340) (-4752.798) [-4751.492] (-4753.991) -- 0:06:42
      54500 -- [-4752.261] (-4758.176) (-4756.289) (-4755.546) * (-4754.677) (-4755.112) (-4749.583) [-4748.398] -- 0:06:39
      55000 -- [-4753.772] (-4753.995) (-4746.234) (-4750.254) * (-4756.389) (-4751.663) (-4751.293) [-4751.707] -- 0:06:35

      Average standard deviation of split frequencies: 0.002806

      55500 -- (-4746.697) (-4753.796) (-4748.137) [-4757.765] * (-4752.228) (-4750.293) [-4757.598] (-4750.157) -- 0:06:48
      56000 -- [-4748.181] (-4749.467) (-4748.573) (-4758.445) * (-4756.903) [-4748.004] (-4752.817) (-4751.551) -- 0:06:44
      56500 -- (-4760.928) (-4751.755) [-4749.438] (-4764.564) * [-4752.177] (-4751.336) (-4754.065) (-4748.098) -- 0:06:40
      57000 -- [-4751.253] (-4760.840) (-4747.740) (-4754.389) * (-4756.632) [-4748.319] (-4747.439) (-4754.220) -- 0:06:37
      57500 -- [-4748.512] (-4745.447) (-4761.844) (-4764.578) * (-4755.478) (-4748.094) (-4752.530) [-4757.879] -- 0:06:33
      58000 -- (-4755.838) [-4749.037] (-4752.626) (-4765.790) * [-4752.791] (-4758.775) (-4757.958) (-4752.991) -- 0:06:46
      58500 -- (-4756.640) (-4751.098) [-4750.181] (-4765.021) * (-4763.302) (-4754.390) (-4753.769) [-4755.827] -- 0:06:42
      59000 -- (-4756.595) (-4754.656) (-4747.287) [-4752.775] * (-4766.345) (-4747.235) [-4745.472] (-4754.070) -- 0:06:38
      59500 -- (-4748.364) (-4750.857) [-4749.323] (-4762.410) * [-4762.020] (-4751.181) (-4750.172) (-4758.076) -- 0:06:35
      60000 -- (-4751.091) (-4759.443) [-4750.543] (-4759.998) * (-4749.186) [-4755.828] (-4755.347) (-4747.781) -- 0:06:31

      Average standard deviation of split frequencies: 0.002590

      60500 -- (-4752.519) (-4759.031) [-4749.899] (-4762.363) * [-4753.179] (-4753.001) (-4752.441) (-4749.893) -- 0:06:43
      61000 -- (-4761.245) [-4753.748] (-4749.961) (-4753.348) * [-4747.948] (-4754.925) (-4753.412) (-4754.081) -- 0:06:40
      61500 -- [-4755.672] (-4752.531) (-4756.232) (-4754.851) * (-4749.345) (-4751.286) [-4752.857] (-4755.860) -- 0:06:36
      62000 -- (-4754.780) (-4754.879) [-4758.327] (-4751.359) * (-4753.075) [-4747.655] (-4757.699) (-4751.365) -- 0:06:33
      62500 -- [-4757.679] (-4751.121) (-4755.873) (-4761.026) * (-4747.163) [-4752.704] (-4751.782) (-4751.993) -- 0:06:30
      63000 -- (-4755.854) (-4755.690) [-4753.919] (-4745.588) * (-4750.387) [-4748.793] (-4747.179) (-4759.825) -- 0:06:41
      63500 -- (-4749.078) (-4760.196) (-4759.426) [-4754.779] * (-4752.530) (-4755.859) [-4749.134] (-4752.660) -- 0:06:38
      64000 -- [-4753.169] (-4750.801) (-4758.462) (-4753.604) * (-4749.920) (-4754.583) (-4758.336) [-4751.510] -- 0:06:34
      64500 -- (-4757.310) (-4744.329) (-4755.408) [-4746.186] * (-4754.059) (-4749.482) (-4752.898) [-4747.824] -- 0:06:31
      65000 -- (-4751.058) [-4747.522] (-4754.628) (-4748.674) * (-4749.552) (-4751.791) (-4746.796) [-4750.713] -- 0:06:28

      Average standard deviation of split frequencies: 0.002381

      65500 -- (-4755.445) (-4755.021) [-4758.106] (-4758.685) * [-4752.520] (-4747.429) (-4749.220) (-4752.146) -- 0:06:39
      66000 -- (-4752.207) [-4749.909] (-4757.030) (-4753.324) * (-4759.426) [-4748.768] (-4764.517) (-4763.154) -- 0:06:36
      66500 -- [-4751.418] (-4752.969) (-4751.289) (-4754.220) * [-4753.142] (-4749.182) (-4758.476) (-4755.868) -- 0:06:33
      67000 -- (-4751.172) (-4752.014) (-4754.408) [-4755.060] * [-4750.193] (-4755.174) (-4759.749) (-4762.620) -- 0:06:29
      67500 -- (-4752.859) [-4754.346] (-4752.235) (-4756.306) * (-4757.649) (-4753.747) (-4755.654) [-4752.978] -- 0:06:26
      68000 -- (-4751.257) (-4759.793) (-4759.695) [-4752.384] * [-4754.354] (-4757.355) (-4756.298) (-4765.009) -- 0:06:37
      68500 -- (-4753.300) (-4752.007) [-4748.341] (-4755.759) * (-4756.977) (-4754.572) (-4760.698) [-4752.720] -- 0:06:34
      69000 -- (-4751.229) (-4757.593) [-4751.675] (-4751.800) * (-4751.020) (-4758.051) [-4749.483] (-4753.528) -- 0:06:31
      69500 -- (-4750.788) (-4752.521) (-4752.379) [-4749.749] * [-4751.261] (-4753.602) (-4752.785) (-4751.093) -- 0:06:28
      70000 -- (-4753.360) [-4755.111] (-4752.279) (-4748.762) * [-4748.911] (-4754.046) (-4757.871) (-4752.207) -- 0:06:25

      Average standard deviation of split frequencies: 0.002224

      70500 -- (-4750.588) [-4751.564] (-4755.136) (-4749.361) * [-4753.521] (-4749.811) (-4752.782) (-4754.181) -- 0:06:35
      71000 -- [-4751.415] (-4751.435) (-4761.155) (-4749.220) * (-4750.924) [-4751.425] (-4753.443) (-4753.764) -- 0:06:32
      71500 -- (-4748.599) [-4751.710] (-4753.575) (-4752.948) * [-4754.705] (-4754.307) (-4754.887) (-4747.559) -- 0:06:29
      72000 -- (-4746.464) (-4753.110) (-4756.757) [-4754.714] * [-4755.896] (-4756.709) (-4750.736) (-4747.452) -- 0:06:26
      72500 -- [-4752.715] (-4749.766) (-4753.452) (-4755.022) * [-4754.118] (-4756.629) (-4749.844) (-4751.287) -- 0:06:23
      73000 -- [-4746.572] (-4753.020) (-4753.990) (-4755.668) * [-4755.485] (-4759.204) (-4751.707) (-4755.838) -- 0:06:33
      73500 -- [-4756.770] (-4752.719) (-4760.072) (-4755.709) * (-4748.882) [-4752.040] (-4751.745) (-4760.799) -- 0:06:30
      74000 -- [-4763.661] (-4748.610) (-4753.656) (-4756.528) * (-4752.456) (-4760.782) [-4756.579] (-4750.098) -- 0:06:27
      74500 -- [-4747.028] (-4750.966) (-4750.613) (-4747.926) * [-4755.012] (-4751.815) (-4758.590) (-4754.265) -- 0:06:25
      75000 -- (-4747.515) (-4750.423) (-4751.636) [-4751.150] * (-4758.735) [-4751.668] (-4755.118) (-4751.583) -- 0:06:22

      Average standard deviation of split frequencies: 0.004135

      75500 -- [-4747.652] (-4756.977) (-4758.667) (-4756.073) * (-4755.444) (-4747.699) [-4754.846] (-4755.016) -- 0:06:31
      76000 -- [-4749.828] (-4753.400) (-4756.370) (-4746.969) * (-4747.040) [-4750.775] (-4753.928) (-4752.211) -- 0:06:29
      76500 -- (-4754.671) [-4753.435] (-4751.828) (-4754.382) * [-4746.990] (-4749.517) (-4756.566) (-4756.175) -- 0:06:26
      77000 -- [-4745.818] (-4749.560) (-4754.623) (-4749.853) * (-4754.413) [-4746.716] (-4749.563) (-4758.891) -- 0:06:23
      77500 -- [-4747.718] (-4744.673) (-4750.715) (-4752.098) * (-4750.532) (-4746.851) (-4747.045) [-4754.183] -- 0:06:32
      78000 -- (-4753.994) (-4751.265) [-4758.311] (-4754.866) * (-4748.794) (-4753.331) [-4748.819] (-4750.746) -- 0:06:30
      78500 -- (-4754.763) [-4747.076] (-4750.809) (-4755.293) * [-4748.710] (-4746.479) (-4751.189) (-4750.194) -- 0:06:27
      79000 -- (-4760.889) (-4749.545) [-4760.821] (-4756.788) * [-4746.990] (-4756.571) (-4752.089) (-4754.690) -- 0:06:24
      79500 -- (-4754.618) (-4750.001) [-4760.451] (-4751.472) * (-4750.685) [-4755.631] (-4752.286) (-4756.535) -- 0:06:22
      80000 -- (-4753.291) (-4750.619) [-4754.112] (-4754.243) * (-4763.470) (-4748.944) [-4746.889] (-4750.881) -- 0:06:31

      Average standard deviation of split frequencies: 0.001948

      80500 -- (-4753.305) [-4750.483] (-4753.065) (-4749.810) * [-4754.092] (-4754.211) (-4744.263) (-4753.771) -- 0:06:28
      81000 -- [-4750.849] (-4751.644) (-4752.042) (-4754.638) * (-4758.157) [-4752.675] (-4750.269) (-4752.052) -- 0:06:25
      81500 -- [-4747.804] (-4755.963) (-4758.799) (-4750.965) * (-4747.141) [-4752.749] (-4751.961) (-4751.439) -- 0:06:23
      82000 -- (-4757.178) (-4755.493) [-4755.536] (-4751.306) * [-4749.034] (-4752.625) (-4751.513) (-4750.849) -- 0:06:20
      82500 -- (-4751.702) (-4761.908) (-4748.223) [-4750.251] * (-4752.485) (-4752.807) (-4758.790) [-4745.552] -- 0:06:29
      83000 -- [-4751.232] (-4752.929) (-4757.376) (-4762.853) * (-4749.471) [-4747.704] (-4751.822) (-4751.671) -- 0:06:26
      83500 -- (-4751.215) (-4760.289) (-4757.383) [-4750.928] * (-4750.726) [-4752.684] (-4747.974) (-4748.494) -- 0:06:24
      84000 -- (-4747.443) (-4751.695) (-4746.793) [-4753.433] * (-4748.183) (-4749.463) (-4755.857) [-4749.771] -- 0:06:21
      84500 -- (-4753.884) (-4754.137) (-4751.675) [-4756.619] * (-4758.087) (-4752.681) [-4753.361] (-4750.380) -- 0:06:19
      85000 -- [-4749.916] (-4754.077) (-4758.174) (-4763.585) * (-4757.151) (-4746.278) (-4757.151) [-4746.890] -- 0:06:27

      Average standard deviation of split frequencies: 0.001827

      85500 -- (-4754.988) [-4751.129] (-4753.160) (-4748.833) * (-4755.815) (-4746.618) (-4756.010) [-4753.670] -- 0:06:25
      86000 -- (-4757.411) (-4754.967) (-4753.494) [-4750.947] * [-4756.231] (-4752.475) (-4751.640) (-4746.555) -- 0:06:22
      86500 -- (-4750.084) (-4756.401) (-4754.693) [-4749.611] * (-4748.792) [-4753.890] (-4759.385) (-4750.884) -- 0:06:20
      87000 -- (-4749.788) (-4761.682) [-4751.599] (-4757.513) * (-4751.771) [-4751.222] (-4756.022) (-4754.264) -- 0:06:17
      87500 -- (-4756.565) (-4758.219) [-4754.884] (-4764.961) * (-4755.034) (-4751.118) (-4756.336) [-4751.858] -- 0:06:25
      88000 -- (-4753.896) [-4748.778] (-4748.147) (-4755.038) * (-4754.036) (-4755.398) [-4747.765] (-4759.588) -- 0:06:23
      88500 -- (-4758.868) (-4757.504) [-4754.235] (-4752.569) * (-4748.172) [-4756.132] (-4752.512) (-4750.684) -- 0:06:21
      89000 -- (-4761.187) (-4751.960) (-4754.443) [-4749.643] * (-4756.936) (-4756.513) (-4764.064) [-4751.142] -- 0:06:18
      89500 -- (-4755.108) [-4748.999] (-4758.540) (-4750.439) * [-4747.368] (-4749.883) (-4750.756) (-4753.332) -- 0:06:16
      90000 -- (-4766.064) [-4749.067] (-4757.966) (-4753.564) * [-4750.482] (-4753.113) (-4751.985) (-4751.943) -- 0:06:24

      Average standard deviation of split frequencies: 0.001733

      90500 -- [-4747.069] (-4751.691) (-4760.366) (-4752.324) * (-4751.195) (-4755.704) [-4751.839] (-4750.780) -- 0:06:21
      91000 -- (-4750.218) (-4753.906) (-4759.263) [-4748.942] * (-4752.430) (-4752.625) (-4747.573) [-4751.167] -- 0:06:19
      91500 -- (-4768.511) (-4750.929) (-4752.278) [-4746.741] * (-4754.730) (-4751.360) (-4753.814) [-4756.485] -- 0:06:17
      92000 -- (-4748.837) [-4755.562] (-4751.257) (-4747.713) * (-4753.616) (-4750.177) (-4749.160) [-4752.753] -- 0:06:15
      92500 -- (-4758.121) (-4757.648) [-4750.536] (-4758.728) * (-4751.902) (-4753.341) [-4748.199] (-4752.272) -- 0:06:22
      93000 -- (-4757.376) (-4751.471) (-4753.294) [-4749.225] * (-4750.314) [-4753.018] (-4747.243) (-4749.878) -- 0:06:20
      93500 -- [-4749.659] (-4749.557) (-4749.181) (-4751.583) * (-4755.410) [-4751.422] (-4754.140) (-4751.818) -- 0:06:18
      94000 -- (-4750.928) (-4754.473) (-4752.500) [-4748.499] * [-4752.287] (-4754.848) (-4755.789) (-4753.276) -- 0:06:15
      94500 -- (-4746.467) (-4753.550) (-4761.469) [-4749.068] * [-4751.882] (-4755.729) (-4755.066) (-4761.645) -- 0:06:13
      95000 -- (-4755.007) [-4749.024] (-4750.212) (-4756.201) * [-4750.734] (-4749.018) (-4754.561) (-4766.165) -- 0:06:21

      Average standard deviation of split frequencies: 0.001637

      95500 -- [-4753.797] (-4751.336) (-4754.213) (-4754.457) * (-4755.117) (-4760.082) (-4753.889) [-4755.184] -- 0:06:18
      96000 -- [-4747.540] (-4755.652) (-4755.452) (-4750.124) * (-4747.972) (-4753.701) (-4754.419) [-4749.095] -- 0:06:16
      96500 -- (-4748.419) [-4752.926] (-4759.936) (-4753.972) * [-4750.682] (-4751.451) (-4747.904) (-4754.094) -- 0:06:14
      97000 -- (-4755.381) [-4753.774] (-4758.329) (-4745.715) * [-4755.439] (-4746.118) (-4751.470) (-4747.690) -- 0:06:21
      97500 -- [-4751.208] (-4752.399) (-4757.149) (-4751.195) * (-4761.153) [-4749.439] (-4755.191) (-4752.567) -- 0:06:19
      98000 -- (-4757.284) [-4750.138] (-4769.083) (-4754.860) * (-4758.220) (-4756.060) [-4757.209] (-4752.260) -- 0:06:17
      98500 -- [-4748.334] (-4749.604) (-4755.436) (-4751.761) * (-4755.725) (-4750.221) [-4753.358] (-4752.945) -- 0:06:15
      99000 -- (-4754.283) (-4749.088) [-4754.341] (-4750.652) * (-4758.805) (-4756.997) [-4758.757] (-4759.836) -- 0:06:13
      99500 -- (-4750.484) (-4753.411) (-4752.883) [-4751.608] * (-4754.001) (-4762.602) [-4748.833] (-4752.499) -- 0:06:20
      100000 -- (-4758.312) (-4759.926) [-4761.855] (-4754.598) * (-4759.102) (-4749.234) [-4748.856] (-4754.036) -- 0:06:18

      Average standard deviation of split frequencies: 0.001561

      100500 -- [-4747.296] (-4754.798) (-4763.991) (-4757.112) * [-4758.914] (-4757.192) (-4756.536) (-4752.409) -- 0:06:15
      101000 -- [-4753.834] (-4751.791) (-4751.221) (-4765.898) * [-4752.318] (-4754.445) (-4751.588) (-4749.652) -- 0:06:13
      101500 -- [-4748.995] (-4748.680) (-4759.549) (-4753.652) * (-4752.590) (-4751.842) [-4750.138] (-4753.601) -- 0:06:11
      102000 -- (-4759.955) (-4759.451) [-4752.677] (-4759.856) * (-4749.581) (-4751.955) [-4751.525] (-4753.944) -- 0:06:18
      102500 -- [-4752.922] (-4755.719) (-4747.475) (-4757.049) * (-4748.505) (-4754.617) [-4747.215] (-4755.831) -- 0:06:16
      103000 -- (-4757.965) [-4750.719] (-4750.346) (-4754.846) * (-4756.880) [-4757.257] (-4751.395) (-4758.093) -- 0:06:14
      103500 -- (-4750.845) (-4749.256) (-4750.661) [-4753.256] * (-4752.545) (-4756.444) [-4749.339] (-4756.750) -- 0:06:12
      104000 -- (-4751.842) [-4752.578] (-4755.200) (-4752.020) * (-4756.580) [-4749.961] (-4756.831) (-4761.119) -- 0:06:10
      104500 -- (-4759.213) [-4749.198] (-4759.507) (-4752.034) * [-4751.859] (-4750.213) (-4751.931) (-4754.113) -- 0:06:17
      105000 -- (-4755.792) (-4748.380) (-4753.076) [-4752.629] * (-4763.927) (-4753.319) [-4751.898] (-4755.346) -- 0:06:15

      Average standard deviation of split frequencies: 0.001482

      105500 -- (-4759.786) (-4756.617) (-4754.952) [-4751.161] * (-4753.724) (-4760.413) (-4754.036) [-4749.766] -- 0:06:13
      106000 -- (-4749.233) (-4749.629) [-4748.679] (-4749.819) * (-4752.585) (-4750.988) [-4747.982] (-4755.661) -- 0:06:11
      106500 -- (-4747.057) (-4758.096) (-4752.334) [-4747.536] * (-4755.390) [-4752.099] (-4754.341) (-4764.184) -- 0:06:09
      107000 -- (-4751.603) (-4753.060) [-4748.663] (-4750.201) * (-4756.905) (-4749.141) [-4750.848] (-4755.928) -- 0:06:15
      107500 -- (-4753.505) (-4753.673) [-4749.652] (-4754.114) * (-4759.496) [-4750.499] (-4753.168) (-4757.930) -- 0:06:13
      108000 -- [-4751.540] (-4749.974) (-4757.955) (-4757.944) * (-4753.573) (-4753.770) [-4756.605] (-4753.916) -- 0:06:11
      108500 -- [-4756.241] (-4750.716) (-4747.605) (-4755.378) * [-4755.989] (-4756.801) (-4754.179) (-4749.240) -- 0:06:09
      109000 -- (-4754.830) [-4755.101] (-4749.188) (-4751.825) * (-4757.056) (-4750.839) (-4750.705) [-4750.166] -- 0:06:16
      109500 -- (-4758.158) [-4752.151] (-4747.912) (-4753.794) * (-4750.015) (-4751.863) (-4746.568) [-4748.206] -- 0:06:14
      110000 -- (-4753.942) (-4753.737) (-4753.524) [-4752.673] * (-4757.176) (-4754.181) (-4755.872) [-4756.653] -- 0:06:12

      Average standard deviation of split frequencies: 0.001420

      110500 -- (-4755.515) (-4754.208) (-4754.669) [-4753.325] * [-4750.014] (-4751.246) (-4753.051) (-4750.471) -- 0:06:10
      111000 -- (-4751.752) (-4761.216) [-4749.016] (-4756.451) * (-4753.181) (-4756.998) [-4758.351] (-4757.099) -- 0:06:08
      111500 -- (-4750.866) (-4759.426) (-4757.155) [-4752.197] * (-4750.197) [-4748.430] (-4759.843) (-4754.342) -- 0:06:14
      112000 -- (-4761.820) [-4754.252] (-4749.956) (-4754.694) * (-4748.753) (-4757.671) [-4753.258] (-4752.142) -- 0:06:12
      112500 -- (-4758.671) (-4756.851) (-4756.946) [-4751.112] * (-4750.059) [-4754.616] (-4757.350) (-4756.041) -- 0:06:10
      113000 -- (-4753.197) (-4751.686) [-4754.906] (-4753.238) * (-4752.833) (-4757.099) (-4751.571) [-4760.305] -- 0:06:08
      113500 -- (-4757.174) (-4752.931) (-4757.935) [-4749.740] * (-4749.600) (-4760.313) (-4747.613) [-4751.609] -- 0:06:07
      114000 -- (-4758.210) (-4755.055) (-4752.810) [-4755.746] * (-4754.840) (-4763.046) (-4756.575) [-4750.724] -- 0:06:13
      114500 -- [-4756.580] (-4748.299) (-4760.587) (-4756.737) * (-4751.708) (-4755.118) (-4749.375) [-4751.279] -- 0:06:11
      115000 -- (-4754.724) (-4755.006) (-4753.629) [-4754.150] * (-4753.837) (-4754.109) (-4751.386) [-4752.101] -- 0:06:09

      Average standard deviation of split frequencies: 0.001355

      115500 -- (-4759.961) [-4759.622] (-4756.367) (-4747.720) * (-4757.621) (-4752.165) [-4756.036] (-4754.848) -- 0:06:07
      116000 -- [-4754.742] (-4759.069) (-4757.044) (-4751.723) * [-4747.491] (-4761.877) (-4750.385) (-4752.982) -- 0:06:05
      116500 -- [-4747.036] (-4766.149) (-4755.559) (-4749.255) * [-4756.716] (-4757.867) (-4749.670) (-4756.428) -- 0:06:11
      117000 -- [-4749.941] (-4757.819) (-4754.368) (-4755.258) * (-4770.148) (-4760.610) (-4754.360) [-4752.216] -- 0:06:09
      117500 -- (-4755.195) [-4756.948] (-4754.488) (-4755.147) * (-4750.758) [-4755.172] (-4751.432) (-4753.399) -- 0:06:08
      118000 -- (-4753.451) (-4756.031) (-4751.794) [-4754.817] * (-4750.121) (-4748.377) [-4747.418] (-4751.603) -- 0:06:06
      118500 -- (-4748.581) [-4754.946] (-4752.317) (-4756.904) * (-4754.093) (-4762.810) [-4748.490] (-4751.772) -- 0:06:04
      119000 -- [-4750.488] (-4762.092) (-4754.700) (-4758.705) * (-4753.990) (-4755.520) (-4758.546) [-4752.813] -- 0:06:10
      119500 -- [-4751.197] (-4753.537) (-4749.584) (-4759.002) * [-4750.335] (-4755.278) (-4753.627) (-4750.560) -- 0:06:08
      120000 -- (-4749.527) (-4757.372) (-4755.188) [-4752.487] * (-4750.568) (-4752.352) (-4750.230) [-4753.822] -- 0:06:06

      Average standard deviation of split frequencies: 0.001302

      120500 -- (-4747.711) (-4748.215) (-4747.662) [-4752.472] * (-4762.565) [-4748.264] (-4759.373) (-4748.297) -- 0:06:04
      121000 -- (-4748.987) [-4754.133] (-4750.304) (-4755.750) * (-4756.268) (-4756.396) (-4749.309) [-4744.225] -- 0:06:10
      121500 -- (-4752.030) (-4750.866) (-4752.092) [-4754.500] * [-4750.286] (-4759.280) (-4750.973) (-4752.893) -- 0:06:08
      122000 -- (-4752.835) (-4749.418) [-4748.460] (-4755.397) * [-4755.154] (-4748.220) (-4758.012) (-4760.508) -- 0:06:07
      122500 -- [-4752.040] (-4760.717) (-4755.304) (-4749.352) * (-4751.469) (-4757.147) [-4748.717] (-4753.025) -- 0:06:05
      123000 -- (-4760.154) [-4756.771] (-4753.749) (-4753.912) * (-4755.439) (-4760.140) [-4748.953] (-4757.680) -- 0:06:03
      123500 -- (-4753.998) [-4752.951] (-4756.903) (-4752.173) * (-4758.685) (-4756.453) [-4751.582] (-4750.193) -- 0:06:09
      124000 -- (-4748.271) (-4751.541) [-4748.631] (-4760.536) * (-4747.333) [-4752.903] (-4748.957) (-4753.740) -- 0:06:07
      124500 -- [-4754.146] (-4754.878) (-4748.348) (-4754.097) * [-4750.628] (-4758.390) (-4747.136) (-4760.020) -- 0:06:05
      125000 -- (-4750.719) (-4761.814) [-4752.976] (-4751.014) * (-4748.268) (-4753.322) (-4753.942) [-4752.000] -- 0:06:04

      Average standard deviation of split frequencies: 0.001247

      125500 -- (-4755.890) (-4755.634) (-4749.816) [-4757.126] * (-4758.907) (-4758.307) (-4755.639) [-4748.053] -- 0:06:02
      126000 -- (-4760.273) (-4757.755) (-4746.379) [-4756.625] * (-4747.866) [-4754.458] (-4757.218) (-4748.082) -- 0:06:07
      126500 -- (-4752.226) [-4749.478] (-4748.003) (-4752.578) * [-4748.782] (-4748.805) (-4758.942) (-4750.238) -- 0:06:05
      127000 -- (-4748.695) [-4752.229] (-4748.188) (-4755.374) * [-4747.940] (-4755.910) (-4751.623) (-4753.530) -- 0:06:04
      127500 -- [-4751.735] (-4751.803) (-4751.654) (-4750.226) * (-4748.326) (-4749.730) [-4753.751] (-4752.945) -- 0:06:02
      128000 -- (-4751.014) [-4754.383] (-4749.296) (-4753.985) * [-4748.719] (-4754.009) (-4759.979) (-4748.582) -- 0:06:01
      128500 -- (-4757.447) [-4755.377] (-4767.564) (-4751.681) * (-4750.475) (-4755.668) [-4751.528] (-4754.944) -- 0:06:06
      129000 -- (-4754.069) (-4763.308) (-4774.379) [-4747.183] * (-4749.719) (-4756.004) (-4749.209) [-4749.116] -- 0:06:04
      129500 -- [-4754.194] (-4753.584) (-4754.059) (-4753.372) * (-4749.185) [-4756.921] (-4759.122) (-4749.622) -- 0:06:02
      130000 -- (-4751.206) (-4748.064) [-4755.912] (-4760.928) * [-4753.128] (-4753.432) (-4749.850) (-4759.577) -- 0:06:01

      Average standard deviation of split frequencies: 0.001203

      130500 -- (-4755.626) (-4759.258) [-4750.405] (-4756.228) * [-4756.385] (-4750.817) (-4748.654) (-4753.181) -- 0:05:59
      131000 -- (-4754.338) (-4750.758) [-4750.013] (-4758.494) * (-4753.367) [-4755.540] (-4745.879) (-4759.304) -- 0:06:04
      131500 -- (-4751.919) [-4754.126] (-4749.407) (-4756.764) * (-4766.132) [-4754.764] (-4755.219) (-4746.252) -- 0:06:03
      132000 -- [-4761.772] (-4755.641) (-4757.750) (-4760.962) * (-4757.825) (-4751.801) [-4747.962] (-4748.020) -- 0:06:01
      132500 -- [-4750.106] (-4748.941) (-4754.711) (-4756.905) * (-4749.573) [-4751.812] (-4751.238) (-4752.375) -- 0:06:00
      133000 -- [-4748.912] (-4752.170) (-4758.271) (-4764.345) * (-4748.390) (-4748.969) [-4747.354] (-4754.127) -- 0:06:05
      133500 -- (-4759.649) [-4749.677] (-4755.992) (-4755.912) * [-4751.710] (-4754.799) (-4754.851) (-4751.817) -- 0:06:03
      134000 -- [-4751.048] (-4752.324) (-4752.609) (-4764.972) * [-4752.454] (-4760.157) (-4750.142) (-4749.102) -- 0:06:01
      134500 -- (-4756.019) (-4756.118) [-4757.650] (-4760.782) * [-4748.535] (-4759.124) (-4755.136) (-4751.813) -- 0:06:00
      135000 -- [-4750.939] (-4748.968) (-4752.962) (-4753.138) * [-4753.923] (-4762.886) (-4752.352) (-4755.176) -- 0:05:58

      Average standard deviation of split frequencies: 0.001155

      135500 -- (-4747.457) [-4748.599] (-4758.116) (-4765.822) * (-4753.702) (-4752.283) [-4754.259] (-4752.893) -- 0:06:03
      136000 -- [-4748.281] (-4748.835) (-4754.666) (-4757.823) * (-4753.911) [-4750.986] (-4750.387) (-4756.509) -- 0:06:02
      136500 -- (-4758.472) [-4746.972] (-4754.204) (-4749.185) * (-4748.763) (-4753.335) [-4761.066] (-4748.275) -- 0:06:00
      137000 -- (-4748.764) [-4750.530] (-4757.230) (-4759.998) * (-4750.714) (-4753.465) (-4758.750) [-4746.844] -- 0:05:59
      137500 -- (-4750.342) (-4754.971) [-4758.566] (-4747.878) * (-4748.901) (-4751.510) (-4755.355) [-4754.716] -- 0:05:57
      138000 -- [-4750.666] (-4750.289) (-4753.144) (-4757.133) * (-4754.002) (-4751.662) [-4751.636] (-4753.403) -- 0:06:02
      138500 -- (-4759.312) [-4752.746] (-4750.248) (-4750.942) * (-4757.230) (-4763.912) [-4749.592] (-4757.583) -- 0:06:00
      139000 -- [-4750.471] (-4755.141) (-4760.437) (-4751.786) * (-4752.592) (-4750.755) [-4749.511] (-4750.773) -- 0:05:59
      139500 -- (-4752.538) (-4752.008) (-4754.516) [-4754.395] * (-4752.590) (-4754.206) (-4751.761) [-4751.846] -- 0:05:57
      140000 -- [-4753.439] (-4752.036) (-4756.617) (-4760.834) * (-4747.554) (-4749.668) [-4752.254] (-4748.840) -- 0:06:02

      Average standard deviation of split frequencies: 0.001117

      140500 -- (-4749.912) (-4751.364) [-4755.680] (-4753.433) * [-4751.427] (-4747.105) (-4753.311) (-4750.545) -- 0:06:00
      141000 -- (-4759.956) [-4757.264] (-4764.316) (-4748.939) * (-4752.531) (-4749.677) (-4753.287) [-4758.121] -- 0:05:59
      141500 -- (-4754.210) [-4756.387] (-4752.650) (-4748.988) * [-4756.209] (-4750.107) (-4755.243) (-4749.354) -- 0:05:57
      142000 -- [-4758.355] (-4757.313) (-4757.419) (-4751.446) * (-4752.259) [-4755.853] (-4746.648) (-4757.007) -- 0:05:56
      142500 -- (-4756.024) [-4750.478] (-4755.799) (-4749.488) * (-4755.886) (-4755.073) [-4750.543] (-4758.092) -- 0:06:01
      143000 -- [-4751.341] (-4757.479) (-4755.074) (-4757.139) * [-4750.408] (-4755.439) (-4761.459) (-4751.490) -- 0:05:59
      143500 -- [-4744.210] (-4751.436) (-4744.330) (-4763.934) * (-4751.824) [-4748.987] (-4765.218) (-4756.069) -- 0:05:58
      144000 -- (-4752.290) (-4756.812) [-4750.474] (-4757.001) * (-4752.402) [-4754.254] (-4762.547) (-4756.690) -- 0:05:56
      144500 -- [-4754.093] (-4759.212) (-4747.573) (-4760.595) * (-4749.549) [-4752.846] (-4761.185) (-4752.731) -- 0:06:01
      145000 -- (-4753.108) (-4764.497) [-4747.699] (-4754.502) * (-4755.65