--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Dec 09 16:03:34 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/443/Zip102B-PF/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2328.89 -2343.18 2 -2328.98 -2339.51 -------------------------------------- TOTAL -2328.93 -2342.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.638287 0.005842 0.495139 0.788013 0.631348 1369.32 1401.92 1.000 r(A<->C){all} 0.104091 0.000918 0.046755 0.164655 0.101817 889.93 998.65 1.001 r(A<->G){all} 0.263061 0.001631 0.184446 0.339731 0.262263 721.68 942.39 1.001 r(A<->T){all} 0.105191 0.000547 0.060933 0.151164 0.103709 912.53 1105.87 1.001 r(C<->G){all} 0.051428 0.000489 0.012650 0.093778 0.048985 933.16 979.27 1.000 r(C<->T){all} 0.411496 0.002715 0.316031 0.514489 0.411491 898.91 961.32 1.001 r(G<->T){all} 0.064732 0.000339 0.030783 0.100917 0.063739 1142.71 1162.28 1.000 pi(A){all} 0.276166 0.000183 0.251236 0.303265 0.276065 1024.65 1103.55 1.000 pi(C){all} 0.184600 0.000139 0.162051 0.207237 0.184535 1056.44 1178.02 1.000 pi(G){all} 0.234878 0.000166 0.210972 0.261384 0.234523 1196.49 1284.73 1.000 pi(T){all} 0.304355 0.000192 0.276846 0.331488 0.303912 1094.16 1192.03 1.000 alpha{1,2} 0.056951 0.001179 0.000193 0.115211 0.055951 1036.26 1084.86 1.000 alpha{3} 2.869015 0.815578 1.348090 4.647137 2.734590 1303.79 1402.40 1.000 pinvar{all} 0.211430 0.005494 0.061652 0.356929 0.212182 1299.32 1309.27 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2174.517498 Model 2: PositiveSelection -2174.517498 Model 0: one-ratio -2185.115279 Model 3: discrete -2174.055714 Model 7: beta -2174.251159 Model 8: beta&w>1 -2174.251203 Model 0 vs 1 21.19556199999988 Model 2 vs 1 0.0 Model 8 vs 7 8.799999977782136E-5
>C1 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH >C2 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH >C3 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH >C4 MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY HLLEESRDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo >C5 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY HLLEESRDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo >C6 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALAVIIPEGIRSLYMGNGRPQDLTPEHQDYSQTIGLSLVLGFVFMMLVDI SQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVFLA IMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGIGQ EQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDYRL LEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=299 C1 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT C2 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT C3 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT C4 MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT C5 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT C6 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT *:******:***************************************** C1 ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV C2 ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV C3 ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV C4 ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV C5 ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV C6 ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV ** ***********:* . :. * **: ******************** C1 DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF C2 DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF C3 DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF C4 DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF C5 DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF C6 DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF **.***:*.* :************************************** C1 LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI C2 LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI C3 LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI C4 LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI C5 LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI C6 LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI *************************:******.********:******** C1 GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY C2 GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY C3 GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY C4 GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY C5 GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY C6 GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY *****:***********************************:::****:* C1 CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH-- C2 CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- C3 CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- C4 HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo- C5 HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo- C6 RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo ****** .*:* *.**:::******.*:********:**:**:* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 297 type PROTEIN Struct Unchecked Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 297 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9136] Library Relaxation: Multi_proc [72] Relaxation Summary: [9136]--->[9092] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.352 Mb, Max= 30.716 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH-- >C2 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- >C3 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- >C4 MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo- >C5 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo- >C6 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo FORMAT of file /tmp/tmp1659257975454698542aln Not Supported[FATAL:T-COFFEE] >C1 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH-- >C2 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- >C3 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- >C4 MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo- >C5 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo- >C6 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:299 S:99 BS:299 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 98.65 C1 C2 98.65 TOP 1 0 98.65 C2 C1 98.65 BOT 0 2 98.65 C1 C3 98.65 TOP 2 0 98.65 C3 C1 98.65 BOT 0 3 92.57 C1 C4 92.57 TOP 3 0 92.57 C4 C1 92.57 BOT 0 4 95.27 C1 C5 95.27 TOP 4 0 95.27 C5 C1 95.27 BOT 0 5 90.17 C1 C6 90.17 TOP 5 0 90.17 C6 C1 90.17 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 91.89 C2 C4 91.89 TOP 3 1 91.89 C4 C2 91.89 BOT 1 4 94.59 C2 C5 94.59 TOP 4 1 94.59 C5 C2 94.59 BOT 1 5 90.17 C2 C6 90.17 TOP 5 1 90.17 C6 C2 90.17 BOT 2 3 91.89 C3 C4 91.89 TOP 3 2 91.89 C4 C3 91.89 BOT 2 4 94.59 C3 C5 94.59 TOP 4 2 94.59 C5 C3 94.59 BOT 2 5 90.17 C3 C6 90.17 TOP 5 2 90.17 C6 C3 90.17 BOT 3 4 93.94 C4 C5 93.94 TOP 4 3 93.94 C5 C4 93.94 BOT 3 5 89.15 C4 C6 89.15 TOP 5 3 89.15 C6 C4 89.15 BOT 4 5 90.51 C5 C6 90.51 TOP 5 4 90.51 C6 C5 90.51 AVG 0 C1 * 95.06 AVG 1 C2 * 95.06 AVG 2 C3 * 95.06 AVG 3 C4 * 91.89 AVG 4 C5 * 93.78 AVG 5 C6 * 90.03 TOT TOT * 93.48 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT C2 ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT C3 ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT C4 ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT C5 ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT C6 ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT ***.****.**.** **:*** * .*:**.***** ************** C1 GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG C2 GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG C3 GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG C4 GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG C5 GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG C6 TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG ***** ** ******** ************ *.********.******* C1 AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT C2 AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT C3 AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT C4 AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT C5 AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT C6 AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT ****.**.*****************.**.** **:***********:*** C1 GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG C2 GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT C3 GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT C4 GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG C5 GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG C6 GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA ***** . *****:**:**.**.** *****.*********.* ** : C1 TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC C2 TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC C3 TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC C4 TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC C5 TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC C6 TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC ** * * .*.*.*:* .**: **.*****.*.*********.* C1 AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG C2 AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG C3 AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG C4 AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA C5 AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG C6 AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG *.***** ******** ******** **:** ** ** ********.**. C1 GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC C2 GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC C3 GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC C4 GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC C5 GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC C6 GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC ** ** * :*****.**.* **** **** *.* *****.******** C1 CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT C2 CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT C3 CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT C4 CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT C5 CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT C6 CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT ***. ******* ******** ** ** ** ***********:** ** * C1 TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT C2 TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT C3 TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT C4 TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT C5 TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT C6 TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT ****.*****:***** ** ********.** ****************** C1 TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT C2 TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT C3 TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT C4 TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT C5 TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT C6 TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT **.*****************.************** **. *.** **:** C1 CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT C2 CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT C3 CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT C4 TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT C5 CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT C6 CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT **** ** **.**.**:*****.**:********.********:* * C1 TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC C2 TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC C3 TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC C4 TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC C5 TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC C6 TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA *.*****.*****.**:** ***:******** **** ********.**. C1 GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC C2 GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC C3 GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC C4 GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC C5 GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC C6 GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC **.***********.** ** ***** ** ** ***** ***** **:** C1 TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT C2 TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT C3 TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT C4 TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC C5 TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC C6 AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT :*****.** ** ** *****************:**.***** ***** C1 TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT C2 TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT C3 TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT C4 TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT C5 TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT C6 TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC *******.***** **.******** :*..*.*********** .**** C1 TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG C2 TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG C3 TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG C4 CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG C5 CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG C6 CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA .* *.*********** ** *:** *** .**** ::.:.****.. C1 CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG C2 TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG C3 TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG C4 CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG C5 CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG C6 TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG ***** .*:**. *: ************** *. *:***.******* * C1 GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------ C2 GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------ C3 GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------ C4 GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------ C5 GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------ C6 GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------ * **.***** ** **..*******: ********** *** >C1 ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------ >C2 ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------ >C3 ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------ >C4 ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------ >C5 ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------ >C6 ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------ >C1 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH >C2 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH >C3 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH >C4 MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY HLLEESRoDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH >C5 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY HLLEESRoDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH >C6 MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALAVIIPEGIRSLYMGNGRPQDLTooPEHQDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKH MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 897 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1481299027 Setting output file names to "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 699250161 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1551362503 Seed = 1827598615 Swapseed = 1481299027 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 32 unique site patterns Division 2 has 26 unique site patterns Division 3 has 80 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2982.002368 -- -24.965149 Chain 2 -- -2927.054941 -- -24.965149 Chain 3 -- -2912.481568 -- -24.965149 Chain 4 -- -2842.626199 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2975.008011 -- -24.965149 Chain 2 -- -2926.345799 -- -24.965149 Chain 3 -- -2915.773703 -- -24.965149 Chain 4 -- -2894.906454 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2982.002] (-2927.055) (-2912.482) (-2842.626) * [-2975.008] (-2926.346) (-2915.774) (-2894.906) 500 -- [-2405.641] (-2407.384) (-2410.304) (-2410.378) * (-2413.735) (-2413.970) (-2427.044) [-2401.820] -- 0:33:19 1000 -- [-2372.996] (-2403.069) (-2392.987) (-2400.535) * (-2394.283) (-2418.012) (-2386.740) [-2338.591] -- 0:16:39 1500 -- [-2342.756] (-2378.722) (-2388.008) (-2388.227) * (-2376.970) (-2408.163) (-2380.071) [-2334.118] -- 0:11:05 2000 -- [-2338.271] (-2374.023) (-2363.200) (-2361.360) * (-2357.442) (-2384.111) (-2371.744) [-2331.531] -- 0:08:19 2500 -- (-2330.135) (-2355.281) [-2345.981] (-2344.249) * [-2340.483] (-2360.743) (-2342.631) (-2335.029) -- 0:06:39 3000 -- (-2340.029) [-2331.519] (-2340.889) (-2335.333) * [-2333.961] (-2353.460) (-2332.014) (-2339.788) -- 0:05:32 3500 -- [-2332.178] (-2334.481) (-2340.747) (-2341.270) * (-2328.699) (-2346.245) [-2336.308] (-2336.167) -- 0:04:44 4000 -- (-2330.371) (-2334.538) [-2336.904] (-2331.754) * [-2334.542] (-2343.243) (-2338.111) (-2332.018) -- 0:08:18 4500 -- (-2331.654) (-2336.723) (-2339.823) [-2328.451] * [-2330.570] (-2339.934) (-2337.064) (-2338.719) -- 0:07:22 5000 -- (-2335.104) (-2336.634) (-2331.583) [-2330.075] * (-2336.382) (-2335.655) (-2341.947) [-2333.714] -- 0:06:38 Average standard deviation of split frequencies: 0.039284 5500 -- (-2335.106) (-2330.791) [-2339.275] (-2332.227) * [-2331.320] (-2335.553) (-2344.357) (-2330.316) -- 0:06:01 6000 -- (-2334.318) (-2342.600) (-2336.249) [-2332.784] * (-2328.324) [-2337.694] (-2339.688) (-2331.939) -- 0:05:31 6500 -- (-2337.332) [-2331.407] (-2335.923) (-2334.826) * [-2332.778] (-2335.073) (-2343.143) (-2329.434) -- 0:05:05 7000 -- (-2340.283) [-2332.064] (-2332.124) (-2341.673) * (-2335.224) [-2336.935] (-2338.949) (-2332.803) -- 0:04:43 7500 -- (-2332.980) (-2334.928) (-2336.687) [-2329.855] * (-2330.192) [-2331.540] (-2332.373) (-2332.236) -- 0:06:37 8000 -- (-2336.438) [-2330.147] (-2336.831) (-2327.084) * (-2335.904) [-2334.197] (-2333.304) (-2333.979) -- 0:06:12 8500 -- (-2334.104) (-2338.867) (-2338.555) [-2329.889] * (-2331.510) (-2333.192) [-2329.000] (-2333.274) -- 0:05:49 9000 -- (-2332.432) (-2329.637) [-2333.700] (-2340.819) * [-2328.850] (-2333.269) (-2342.771) (-2330.502) -- 0:05:30 9500 -- (-2333.406) [-2340.420] (-2331.953) (-2339.021) * (-2338.476) (-2341.555) (-2329.596) [-2328.753] -- 0:05:12 10000 -- (-2328.446) (-2331.494) [-2332.326] (-2333.639) * (-2338.728) (-2341.158) [-2329.280] (-2337.482) -- 0:04:57 Average standard deviation of split frequencies: 0.014731 10500 -- [-2330.003] (-2330.154) (-2338.743) (-2327.957) * (-2339.926) (-2334.947) (-2335.709) [-2339.370] -- 0:04:42 11000 -- (-2331.569) (-2335.758) (-2348.736) [-2332.301] * (-2334.969) (-2331.992) [-2335.960] (-2333.611) -- 0:05:59 11500 -- (-2328.690) [-2334.744] (-2339.054) (-2336.122) * (-2332.925) (-2330.037) [-2327.003] (-2340.446) -- 0:05:43 12000 -- (-2336.474) (-2334.219) (-2333.842) [-2333.593] * (-2329.472) [-2333.881] (-2333.887) (-2335.110) -- 0:05:29 12500 -- (-2332.705) (-2339.645) (-2327.715) [-2332.901] * (-2334.023) (-2338.552) (-2334.226) [-2327.763] -- 0:05:16 13000 -- (-2328.748) (-2338.709) [-2331.890] (-2328.991) * (-2328.503) (-2330.646) [-2330.694] (-2331.039) -- 0:05:03 13500 -- (-2331.961) (-2341.056) [-2333.067] (-2333.933) * (-2331.944) (-2336.768) (-2337.641) [-2329.495] -- 0:04:52 14000 -- (-2337.271) (-2335.647) [-2332.636] (-2329.702) * [-2333.749] (-2335.276) (-2336.013) (-2341.232) -- 0:04:41 14500 -- [-2329.465] (-2341.427) (-2333.693) (-2340.019) * (-2337.867) (-2327.042) [-2331.565] (-2337.838) -- 0:05:39 15000 -- (-2332.464) [-2335.368] (-2334.722) (-2333.846) * (-2343.034) [-2331.562] (-2337.646) (-2335.590) -- 0:05:28 Average standard deviation of split frequencies: 0.009821 15500 -- [-2331.767] (-2330.549) (-2332.836) (-2342.875) * (-2345.469) (-2335.904) (-2331.833) [-2332.895] -- 0:05:17 16000 -- (-2336.736) [-2330.162] (-2334.163) (-2340.650) * (-2344.837) (-2339.397) [-2333.730] (-2339.856) -- 0:05:07 16500 -- (-2331.856) (-2330.965) [-2337.096] (-2335.508) * (-2334.337) (-2345.933) [-2332.373] (-2336.668) -- 0:04:58 17000 -- [-2333.036] (-2329.445) (-2334.001) (-2332.098) * [-2333.426] (-2351.141) (-2337.176) (-2337.060) -- 0:04:49 17500 -- (-2328.854) (-2332.076) [-2337.687] (-2336.050) * (-2333.623) (-2337.938) (-2337.466) [-2331.997] -- 0:04:40 18000 -- (-2331.258) [-2333.733] (-2337.735) (-2332.822) * [-2336.719] (-2333.336) (-2337.364) (-2333.576) -- 0:05:27 18500 -- (-2329.371) (-2333.806) [-2328.018] (-2335.560) * [-2337.815] (-2339.766) (-2336.529) (-2332.456) -- 0:05:18 19000 -- (-2331.422) (-2335.793) (-2337.382) [-2335.902] * (-2332.165) [-2334.431] (-2329.991) (-2336.104) -- 0:05:09 19500 -- [-2326.206] (-2332.499) (-2333.153) (-2329.566) * (-2331.606) [-2327.765] (-2336.221) (-2340.926) -- 0:05:01 20000 -- (-2326.355) (-2334.584) [-2332.633] (-2338.034) * [-2331.168] (-2336.022) (-2331.649) (-2333.444) -- 0:04:54 Average standard deviation of split frequencies: 0.007603 20500 -- [-2332.368] (-2333.801) (-2331.629) (-2333.533) * (-2334.337) (-2326.971) (-2339.513) [-2333.478] -- 0:04:46 21000 -- (-2333.400) [-2330.538] (-2334.528) (-2329.005) * (-2326.802) (-2345.773) (-2333.951) [-2332.228] -- 0:04:39 21500 -- (-2333.556) (-2331.103) (-2336.449) [-2340.524] * (-2332.071) [-2332.646] (-2331.604) (-2334.086) -- 0:05:18 22000 -- (-2329.280) (-2335.098) [-2330.821] (-2342.230) * (-2338.943) (-2331.391) [-2331.489] (-2350.318) -- 0:05:11 22500 -- (-2338.550) (-2337.988) [-2333.524] (-2332.181) * (-2332.948) [-2336.160] (-2331.318) (-2341.104) -- 0:05:04 23000 -- (-2339.968) (-2338.815) [-2327.579] (-2332.913) * (-2339.618) (-2327.459) (-2327.630) [-2327.881] -- 0:04:57 23500 -- (-2334.525) (-2337.527) [-2339.432] (-2331.463) * (-2338.358) (-2337.165) [-2330.855] (-2330.448) -- 0:04:50 24000 -- [-2332.615] (-2336.482) (-2338.142) (-2339.991) * (-2327.964) (-2337.674) [-2334.260] (-2330.487) -- 0:04:44 24500 -- (-2328.183) [-2333.303] (-2339.071) (-2339.475) * (-2333.550) [-2328.791] (-2332.493) (-2336.449) -- 0:04:38 25000 -- (-2329.446) (-2335.795) (-2340.693) [-2331.620] * [-2333.349] (-2330.685) (-2332.254) (-2334.212) -- 0:05:12 Average standard deviation of split frequencies: 0.000000 25500 -- [-2324.441] (-2337.344) (-2335.697) (-2333.930) * (-2332.272) (-2336.827) [-2330.288] (-2332.438) -- 0:05:05 26000 -- (-2332.995) (-2342.191) (-2335.280) [-2328.793] * (-2336.921) [-2330.651] (-2331.349) (-2328.308) -- 0:04:59 26500 -- (-2337.367) (-2331.554) [-2328.423] (-2328.275) * (-2333.650) [-2333.578] (-2330.000) (-2334.868) -- 0:04:53 27000 -- (-2338.377) [-2329.723] (-2328.757) (-2332.783) * [-2332.438] (-2332.566) (-2337.404) (-2331.922) -- 0:04:48 27500 -- (-2342.114) (-2336.802) [-2336.910] (-2341.064) * (-2331.456) (-2333.809) (-2333.438) [-2334.361] -- 0:04:42 28000 -- (-2329.385) [-2330.368] (-2334.698) (-2340.463) * (-2329.924) [-2330.053] (-2338.900) (-2338.361) -- 0:04:37 28500 -- (-2337.004) (-2333.346) [-2339.509] (-2332.612) * [-2329.041] (-2328.289) (-2332.093) (-2332.192) -- 0:05:06 29000 -- (-2330.316) (-2333.545) (-2336.790) [-2333.689] * (-2327.462) (-2328.877) [-2329.899] (-2328.900) -- 0:05:01 29500 -- (-2329.920) [-2328.919] (-2331.351) (-2329.155) * (-2336.035) [-2329.101] (-2329.331) (-2336.733) -- 0:04:56 30000 -- [-2334.568] (-2330.596) (-2333.692) (-2332.242) * (-2328.696) [-2330.785] (-2328.716) (-2334.182) -- 0:04:51 Average standard deviation of split frequencies: 0.005124 30500 -- (-2338.736) (-2326.011) [-2331.935] (-2335.753) * (-2331.322) [-2328.698] (-2329.519) (-2335.940) -- 0:04:46 31000 -- [-2335.425] (-2326.070) (-2334.386) (-2339.739) * (-2335.317) (-2332.915) [-2337.401] (-2333.913) -- 0:04:41 31500 -- (-2334.741) (-2330.044) (-2337.792) [-2331.695] * (-2330.242) (-2331.424) [-2329.768] (-2344.401) -- 0:04:36 32000 -- (-2327.793) (-2330.910) (-2339.109) [-2331.069] * (-2329.669) (-2333.604) [-2332.180] (-2332.587) -- 0:05:02 32500 -- [-2327.909] (-2335.726) (-2337.589) (-2335.954) * (-2334.065) [-2333.146] (-2327.665) (-2333.328) -- 0:04:57 33000 -- (-2343.424) (-2337.740) (-2330.768) [-2331.094] * (-2338.008) (-2341.049) [-2331.424] (-2336.729) -- 0:04:53 33500 -- (-2335.073) (-2339.484) (-2334.878) [-2335.903] * (-2330.308) (-2337.054) (-2335.790) [-2332.293] -- 0:04:48 34000 -- (-2329.677) (-2330.983) (-2332.640) [-2333.245] * (-2333.269) (-2333.772) (-2338.184) [-2335.994] -- 0:04:44 34500 -- (-2342.308) (-2328.831) [-2327.456] (-2330.449) * (-2331.137) (-2340.055) [-2338.390] (-2333.032) -- 0:04:39 35000 -- (-2333.449) [-2330.984] (-2329.302) (-2327.719) * (-2330.351) (-2340.523) [-2335.099] (-2329.362) -- 0:04:35 Average standard deviation of split frequencies: 0.000000 35500 -- (-2330.542) (-2333.796) [-2331.655] (-2345.603) * (-2339.594) (-2330.475) (-2330.906) [-2326.858] -- 0:04:58 36000 -- (-2328.433) [-2338.900] (-2331.642) (-2343.094) * (-2334.962) [-2330.522] (-2326.110) (-2329.958) -- 0:04:54 36500 -- (-2335.669) (-2332.437) (-2331.784) [-2334.804] * (-2329.211) (-2334.081) (-2336.290) [-2332.481] -- 0:04:50 37000 -- (-2334.231) (-2330.162) (-2333.400) [-2332.152] * [-2329.621] (-2332.857) (-2330.709) (-2332.661) -- 0:04:46 37500 -- (-2333.052) (-2335.136) (-2329.476) [-2327.312] * (-2332.203) [-2331.230] (-2329.311) (-2336.072) -- 0:04:42 38000 -- [-2331.217] (-2326.973) (-2331.710) (-2335.831) * (-2330.917) [-2330.328] (-2331.349) (-2342.179) -- 0:04:38 38500 -- (-2338.116) (-2332.403) [-2328.783] (-2330.024) * (-2330.516) [-2333.075] (-2331.529) (-2335.729) -- 0:04:34 39000 -- (-2329.980) (-2326.983) (-2333.380) [-2327.742] * [-2331.445] (-2329.860) (-2337.310) (-2337.115) -- 0:04:55 39500 -- (-2327.994) (-2343.225) [-2332.235] (-2331.816) * [-2332.785] (-2332.754) (-2330.685) (-2336.748) -- 0:04:51 40000 -- [-2334.585] (-2333.240) (-2329.316) (-2332.462) * (-2335.791) (-2333.830) [-2333.743] (-2332.871) -- 0:04:48 Average standard deviation of split frequencies: 0.000000 40500 -- (-2341.937) (-2330.818) [-2328.932] (-2336.761) * (-2337.629) (-2337.222) [-2331.626] (-2339.665) -- 0:04:44 41000 -- (-2336.836) (-2337.515) [-2332.069] (-2334.289) * (-2329.585) [-2333.475] (-2329.730) (-2333.288) -- 0:04:40 41500 -- (-2329.356) (-2331.102) [-2336.451] (-2343.803) * (-2331.603) (-2338.924) (-2326.190) [-2335.185] -- 0:04:37 42000 -- (-2334.924) (-2336.778) (-2333.635) [-2327.327] * (-2331.508) [-2333.595] (-2338.316) (-2341.425) -- 0:04:33 42500 -- (-2348.732) (-2331.655) [-2328.656] (-2332.839) * (-2336.162) (-2335.884) (-2336.582) [-2328.749] -- 0:04:52 43000 -- (-2332.745) [-2330.943] (-2332.962) (-2335.357) * (-2333.433) (-2339.547) (-2335.762) [-2333.127] -- 0:04:49 43500 -- (-2330.669) (-2329.011) (-2334.824) [-2337.149] * (-2338.645) (-2334.598) (-2342.584) [-2330.774] -- 0:04:45 44000 -- (-2339.005) [-2341.977] (-2332.206) (-2340.705) * [-2334.920] (-2344.469) (-2334.769) (-2331.810) -- 0:04:42 44500 -- (-2336.729) (-2330.672) (-2332.171) [-2335.401] * (-2330.453) (-2342.674) (-2332.533) [-2333.904] -- 0:04:39 45000 -- [-2331.644] (-2330.408) (-2330.668) (-2334.366) * (-2332.425) (-2335.579) (-2338.898) [-2333.212] -- 0:04:35 Average standard deviation of split frequencies: 0.000000 45500 -- (-2337.534) (-2332.806) [-2331.993] (-2334.367) * (-2334.478) [-2333.970] (-2331.527) (-2335.088) -- 0:04:32 46000 -- [-2334.447] (-2336.508) (-2332.344) (-2345.453) * [-2330.904] (-2329.608) (-2333.961) (-2330.710) -- 0:04:29 46500 -- [-2329.611] (-2333.867) (-2328.777) (-2341.176) * [-2338.755] (-2330.668) (-2339.444) (-2329.390) -- 0:04:47 47000 -- [-2333.342] (-2335.125) (-2330.603) (-2339.702) * (-2333.237) (-2337.784) (-2335.043) [-2332.639] -- 0:04:43 47500 -- [-2329.494] (-2330.262) (-2335.754) (-2331.105) * (-2331.263) (-2335.698) (-2333.713) [-2338.879] -- 0:04:40 48000 -- (-2330.780) (-2331.149) [-2333.666] (-2332.900) * [-2335.286] (-2333.380) (-2336.029) (-2334.102) -- 0:04:37 48500 -- (-2338.781) (-2328.889) (-2336.019) [-2327.300] * (-2326.587) (-2332.027) (-2337.707) [-2332.746] -- 0:04:34 49000 -- (-2328.900) (-2336.918) [-2331.473] (-2331.253) * (-2333.202) [-2334.005] (-2341.354) (-2325.648) -- 0:04:31 49500 -- (-2331.482) [-2327.010] (-2332.678) (-2332.034) * (-2337.076) (-2334.711) [-2331.069] (-2329.908) -- 0:04:28 50000 -- [-2338.705] (-2327.541) (-2333.605) (-2330.420) * (-2339.010) (-2338.775) (-2333.281) [-2335.036] -- 0:04:45 Average standard deviation of split frequencies: 0.000000 50500 -- (-2338.100) (-2331.547) [-2329.161] (-2333.503) * [-2339.409] (-2336.022) (-2333.687) (-2335.804) -- 0:04:42 51000 -- [-2331.536] (-2333.621) (-2333.221) (-2336.005) * (-2334.859) (-2335.636) (-2330.195) [-2336.256] -- 0:04:39 51500 -- [-2333.883] (-2332.298) (-2336.896) (-2325.667) * [-2336.532] (-2340.260) (-2334.902) (-2334.924) -- 0:04:36 52000 -- [-2331.252] (-2336.012) (-2340.009) (-2335.540) * (-2331.807) (-2337.203) [-2330.192] (-2343.835) -- 0:04:33 52500 -- (-2330.068) (-2337.156) [-2335.831] (-2342.444) * (-2333.437) (-2342.068) (-2334.149) [-2331.732] -- 0:04:30 53000 -- (-2339.697) (-2327.175) [-2335.474] (-2348.889) * (-2336.379) (-2331.509) (-2331.299) [-2333.910] -- 0:04:28 53500 -- (-2340.737) (-2326.839) (-2334.776) [-2332.728] * (-2342.017) (-2336.298) [-2333.427] (-2330.462) -- 0:04:43 54000 -- [-2332.556] (-2329.813) (-2333.225) (-2338.320) * (-2343.792) [-2329.695] (-2330.768) (-2329.637) -- 0:04:40 54500 -- (-2334.406) (-2328.634) (-2331.108) [-2329.529] * [-2340.238] (-2328.741) (-2331.486) (-2335.472) -- 0:04:37 55000 -- (-2338.993) [-2327.160] (-2333.774) (-2333.074) * (-2342.386) (-2339.022) (-2330.203) [-2333.535] -- 0:04:34 Average standard deviation of split frequencies: 0.000000 55500 -- (-2333.165) [-2335.163] (-2340.401) (-2331.576) * [-2335.101] (-2335.398) (-2331.037) (-2336.189) -- 0:04:32 56000 -- (-2327.570) (-2338.748) [-2335.970] (-2327.219) * (-2334.978) (-2329.944) [-2333.589] (-2330.507) -- 0:04:29 56500 -- (-2336.604) (-2335.095) (-2333.765) [-2330.739] * (-2337.121) [-2331.201] (-2340.737) (-2336.043) -- 0:04:27 57000 -- [-2338.475] (-2335.815) (-2328.974) (-2331.655) * (-2334.693) [-2333.311] (-2331.574) (-2335.070) -- 0:04:41 57500 -- (-2332.966) [-2330.627] (-2333.275) (-2330.099) * [-2335.676] (-2331.467) (-2334.551) (-2333.131) -- 0:04:38 58000 -- (-2334.249) (-2326.758) [-2341.660] (-2336.992) * (-2337.335) (-2331.936) [-2337.982] (-2327.952) -- 0:04:36 58500 -- (-2326.627) (-2333.854) (-2329.297) [-2328.637] * [-2329.729] (-2332.349) (-2337.149) (-2328.299) -- 0:04:33 59000 -- [-2328.333] (-2336.531) (-2333.665) (-2331.522) * (-2329.125) (-2338.208) (-2328.841) [-2328.618] -- 0:04:31 59500 -- (-2330.703) (-2328.198) (-2332.580) [-2332.355] * [-2330.224] (-2337.694) (-2337.285) (-2330.365) -- 0:04:28 60000 -- (-2333.544) (-2333.519) (-2335.053) [-2328.918] * [-2330.293] (-2343.793) (-2334.252) (-2333.379) -- 0:04:26 Average standard deviation of split frequencies: 0.002590 60500 -- [-2332.328] (-2334.516) (-2328.318) (-2328.665) * (-2333.957) (-2338.835) [-2330.534] (-2331.376) -- 0:04:39 61000 -- (-2329.386) (-2332.490) [-2328.953] (-2337.071) * (-2331.201) [-2328.645] (-2332.448) (-2333.158) -- 0:04:37 61500 -- (-2332.276) [-2331.543] (-2332.400) (-2331.966) * (-2334.169) (-2334.980) [-2328.925] (-2331.121) -- 0:04:34 62000 -- (-2335.266) (-2334.911) [-2330.550] (-2331.975) * [-2331.166] (-2333.097) (-2336.786) (-2333.583) -- 0:04:32 62500 -- (-2334.080) (-2335.445) [-2333.038] (-2332.191) * [-2326.122] (-2338.217) (-2337.053) (-2332.995) -- 0:04:30 63000 -- (-2331.973) [-2331.835] (-2332.317) (-2332.787) * [-2335.193] (-2341.938) (-2330.389) (-2330.853) -- 0:04:27 63500 -- (-2332.710) (-2334.873) (-2338.370) [-2334.335] * [-2330.051] (-2336.609) (-2331.180) (-2335.861) -- 0:04:25 64000 -- (-2338.301) [-2338.576] (-2330.189) (-2333.582) * (-2331.813) [-2331.421] (-2331.997) (-2333.904) -- 0:04:37 64500 -- (-2333.234) (-2332.694) (-2328.357) [-2335.056] * (-2330.920) [-2328.974] (-2334.025) (-2339.526) -- 0:04:35 65000 -- (-2334.605) [-2338.432] (-2335.513) (-2333.948) * [-2338.708] (-2334.104) (-2338.794) (-2330.496) -- 0:04:33 Average standard deviation of split frequencies: 0.002381 65500 -- (-2343.158) (-2334.088) (-2334.982) [-2333.731] * (-2338.891) [-2332.943] (-2334.163) (-2332.626) -- 0:04:31 66000 -- (-2333.662) (-2339.742) (-2338.970) [-2330.803] * (-2333.654) [-2327.835] (-2341.340) (-2338.183) -- 0:04:28 66500 -- (-2333.524) (-2333.260) (-2335.953) [-2338.910] * [-2333.942] (-2332.602) (-2331.193) (-2333.762) -- 0:04:26 67000 -- (-2329.734) (-2329.803) (-2327.367) [-2331.417] * (-2340.881) (-2337.090) (-2328.938) [-2333.478] -- 0:04:24 67500 -- (-2347.419) (-2339.130) [-2328.145] (-2334.396) * (-2338.608) (-2334.614) [-2330.185] (-2337.304) -- 0:04:36 68000 -- (-2338.315) (-2335.060) [-2332.076] (-2334.052) * [-2332.180] (-2335.309) (-2330.677) (-2336.540) -- 0:04:34 68500 -- [-2331.376] (-2333.902) (-2336.703) (-2333.662) * (-2330.183) (-2329.962) (-2331.690) [-2332.587] -- 0:04:31 69000 -- (-2341.704) (-2341.631) [-2332.292] (-2331.892) * (-2331.906) (-2332.775) [-2329.761] (-2330.423) -- 0:04:29 69500 -- (-2331.392) (-2331.722) (-2337.606) [-2329.867] * (-2330.331) (-2334.961) (-2334.307) [-2330.640] -- 0:04:27 70000 -- (-2328.089) (-2334.869) (-2327.722) [-2334.644] * (-2339.069) [-2328.107] (-2328.588) (-2333.285) -- 0:04:25 Average standard deviation of split frequencies: 0.002224 70500 -- [-2329.479] (-2331.605) (-2336.332) (-2332.111) * (-2329.650) [-2328.418] (-2332.795) (-2337.191) -- 0:04:23 71000 -- (-2333.703) (-2334.174) [-2335.613] (-2337.272) * (-2336.211) [-2326.077] (-2333.049) (-2335.204) -- 0:04:34 71500 -- [-2333.179] (-2339.079) (-2331.409) (-2329.940) * [-2331.531] (-2333.257) (-2333.966) (-2331.540) -- 0:04:32 72000 -- (-2342.213) (-2333.472) (-2335.684) [-2332.829] * (-2331.367) [-2329.643] (-2327.212) (-2334.879) -- 0:04:30 72500 -- (-2336.674) (-2333.432) (-2334.860) [-2329.577] * (-2337.405) (-2327.239) (-2330.165) [-2328.148] -- 0:04:28 73000 -- [-2337.892] (-2335.164) (-2334.526) (-2329.982) * (-2331.381) (-2341.810) [-2329.636] (-2330.823) -- 0:04:26 73500 -- (-2334.373) [-2333.336] (-2329.873) (-2332.599) * [-2329.351] (-2327.122) (-2334.365) (-2334.590) -- 0:04:24 74000 -- (-2343.049) (-2339.637) [-2329.475] (-2329.940) * [-2329.982] (-2328.391) (-2328.473) (-2336.292) -- 0:04:22 74500 -- (-2338.539) [-2334.410] (-2329.325) (-2332.976) * (-2332.759) (-2334.956) (-2336.881) [-2333.254] -- 0:04:33 75000 -- (-2335.309) [-2335.394] (-2330.536) (-2327.074) * [-2334.119] (-2339.036) (-2327.244) (-2333.268) -- 0:04:31 Average standard deviation of split frequencies: 0.004135 75500 -- (-2343.834) (-2339.002) (-2334.214) [-2331.977] * (-2342.234) (-2332.937) (-2340.280) [-2329.237] -- 0:04:29 76000 -- (-2341.981) (-2337.345) [-2330.734] (-2326.887) * (-2336.226) (-2332.642) (-2346.496) [-2331.769] -- 0:04:27 76500 -- (-2341.427) (-2330.437) [-2334.158] (-2332.750) * (-2340.019) (-2329.828) (-2339.498) [-2331.750] -- 0:04:25 77000 -- (-2343.974) (-2336.398) (-2334.329) [-2330.851] * (-2337.944) (-2335.054) (-2331.927) [-2329.181] -- 0:04:23 77500 -- (-2335.304) [-2332.904] (-2337.837) (-2331.475) * (-2329.072) (-2333.943) [-2332.878] (-2338.282) -- 0:04:21 78000 -- [-2332.980] (-2332.526) (-2333.834) (-2329.610) * (-2336.073) (-2334.081) (-2330.221) [-2333.077] -- 0:04:31 78500 -- (-2336.560) (-2329.891) (-2338.990) [-2335.598] * (-2338.812) (-2344.793) (-2332.685) [-2330.722] -- 0:04:29 79000 -- (-2348.357) (-2330.547) [-2334.027] (-2337.728) * (-2334.687) (-2339.734) [-2330.963] (-2338.220) -- 0:04:28 79500 -- (-2335.163) (-2336.639) [-2331.192] (-2337.560) * (-2332.143) (-2343.515) [-2330.132] (-2332.505) -- 0:04:26 80000 -- (-2335.572) (-2337.373) [-2336.717] (-2332.313) * (-2331.246) (-2338.142) [-2332.907] (-2329.644) -- 0:04:24 Average standard deviation of split frequencies: 0.005844 80500 -- [-2330.267] (-2335.399) (-2331.099) (-2336.013) * [-2337.240] (-2340.969) (-2343.717) (-2341.960) -- 0:04:22 81000 -- (-2332.623) (-2335.280) (-2331.645) [-2328.223] * (-2331.564) (-2337.160) (-2329.229) [-2331.088] -- 0:04:20 81500 -- [-2327.314] (-2338.290) (-2329.740) (-2340.400) * [-2337.340] (-2337.065) (-2337.494) (-2331.210) -- 0:04:30 82000 -- (-2330.473) (-2330.914) (-2332.310) [-2335.633] * (-2342.378) (-2336.572) (-2336.981) [-2332.347] -- 0:04:28 82500 -- (-2332.902) (-2335.833) [-2330.601] (-2331.271) * (-2328.155) [-2331.377] (-2336.612) (-2330.545) -- 0:04:26 83000 -- (-2332.750) [-2330.011] (-2329.991) (-2325.529) * [-2330.701] (-2331.972) (-2339.227) (-2332.941) -- 0:04:25 83500 -- (-2334.317) [-2335.401] (-2331.747) (-2330.157) * (-2331.524) (-2332.492) (-2330.824) [-2332.328] -- 0:04:23 84000 -- (-2337.847) (-2329.260) [-2333.008] (-2333.342) * (-2331.867) (-2327.938) [-2336.202] (-2335.527) -- 0:04:21 84500 -- (-2344.225) (-2330.423) [-2333.010] (-2335.014) * (-2332.534) [-2337.258] (-2333.874) (-2333.033) -- 0:04:20 85000 -- (-2337.494) (-2334.597) (-2338.075) [-2333.805] * (-2329.454) (-2333.574) [-2338.017] (-2332.085) -- 0:04:29 Average standard deviation of split frequencies: 0.001827 85500 -- [-2334.131] (-2331.746) (-2334.651) (-2331.246) * [-2337.493] (-2336.412) (-2337.916) (-2336.468) -- 0:04:27 86000 -- (-2329.413) (-2329.353) [-2336.564] (-2336.117) * (-2330.811) [-2329.417] (-2336.580) (-2331.209) -- 0:04:25 86500 -- (-2333.531) (-2333.196) (-2339.890) [-2334.784] * [-2337.881] (-2330.055) (-2334.271) (-2328.100) -- 0:04:24 87000 -- (-2333.824) [-2329.618] (-2335.677) (-2333.155) * (-2333.302) [-2334.412] (-2334.824) (-2334.070) -- 0:04:22 87500 -- (-2334.197) [-2331.446] (-2335.183) (-2334.808) * [-2333.698] (-2334.244) (-2332.069) (-2332.465) -- 0:04:20 88000 -- (-2338.640) (-2331.413) [-2338.344] (-2341.203) * (-2337.019) (-2332.731) (-2337.058) [-2337.580] -- 0:04:19 88500 -- (-2332.059) [-2339.550] (-2335.757) (-2337.946) * (-2336.568) [-2340.218] (-2333.474) (-2337.998) -- 0:04:27 89000 -- (-2329.923) (-2337.959) [-2330.376] (-2331.067) * (-2334.064) [-2331.514] (-2331.602) (-2345.073) -- 0:04:26 89500 -- [-2331.206] (-2330.798) (-2333.486) (-2326.811) * (-2334.134) (-2346.188) (-2338.278) [-2338.569] -- 0:04:24 90000 -- (-2336.011) (-2331.931) (-2335.541) [-2333.222] * (-2333.328) (-2338.535) (-2331.437) [-2335.588] -- 0:04:22 Average standard deviation of split frequencies: 0.001733 90500 -- (-2338.192) (-2330.465) (-2333.793) [-2325.697] * [-2331.820] (-2335.279) (-2343.485) (-2333.514) -- 0:04:21 91000 -- [-2330.933] (-2331.205) (-2329.825) (-2329.668) * [-2332.520] (-2329.375) (-2342.185) (-2336.886) -- 0:04:19 91500 -- [-2329.559] (-2337.585) (-2331.667) (-2332.619) * [-2331.706] (-2328.732) (-2331.270) (-2339.305) -- 0:04:28 92000 -- (-2335.408) (-2334.626) [-2333.194] (-2332.539) * [-2338.991] (-2333.575) (-2337.163) (-2338.201) -- 0:04:26 92500 -- [-2335.693] (-2341.266) (-2333.259) (-2340.138) * (-2335.459) [-2330.382] (-2339.140) (-2340.586) -- 0:04:24 93000 -- (-2330.200) [-2328.742] (-2351.294) (-2346.834) * (-2342.271) [-2328.450] (-2338.117) (-2335.725) -- 0:04:23 93500 -- (-2331.963) (-2331.480) [-2328.565] (-2336.645) * (-2340.805) [-2337.343] (-2333.255) (-2338.501) -- 0:04:21 94000 -- (-2339.675) (-2333.200) (-2331.927) [-2328.522] * (-2333.377) (-2328.573) (-2337.008) [-2344.278] -- 0:04:20 94500 -- (-2331.618) (-2340.226) (-2337.506) [-2334.415] * (-2331.523) (-2336.421) (-2336.216) [-2338.211] -- 0:04:18 95000 -- (-2338.863) (-2332.885) [-2332.935] (-2330.893) * (-2333.714) (-2330.048) [-2334.445] (-2341.149) -- 0:04:26 Average standard deviation of split frequencies: 0.001637 95500 -- [-2331.530] (-2331.516) (-2332.380) (-2337.522) * (-2337.053) (-2334.161) [-2332.582] (-2342.556) -- 0:04:25 96000 -- (-2332.234) (-2331.504) [-2331.680] (-2341.273) * [-2334.800] (-2332.897) (-2337.303) (-2329.877) -- 0:04:23 96500 -- (-2331.119) [-2334.162] (-2333.879) (-2339.666) * (-2338.993) (-2333.577) [-2330.332] (-2328.347) -- 0:04:22 97000 -- (-2341.198) (-2330.005) [-2328.078] (-2334.024) * (-2330.669) (-2335.385) (-2332.442) [-2330.659] -- 0:04:20 97500 -- (-2332.038) (-2332.895) [-2328.362] (-2333.008) * (-2335.981) (-2340.550) (-2330.744) [-2333.446] -- 0:04:19 98000 -- (-2342.604) (-2332.045) (-2334.401) [-2332.684] * (-2328.521) (-2336.050) (-2339.960) [-2329.348] -- 0:04:17 98500 -- (-2337.164) (-2341.988) (-2330.667) [-2333.418] * [-2335.521] (-2339.175) (-2330.329) (-2329.730) -- 0:04:25 99000 -- (-2334.966) (-2336.920) [-2326.963] (-2330.072) * (-2337.064) [-2335.477] (-2327.806) (-2332.856) -- 0:04:23 99500 -- (-2333.321) (-2340.041) [-2330.084] (-2327.557) * (-2337.174) (-2335.373) (-2338.897) [-2329.856] -- 0:04:22 100000 -- [-2331.543] (-2335.001) (-2329.092) (-2330.435) * (-2339.425) (-2334.506) [-2334.975] (-2343.772) -- 0:04:21 Average standard deviation of split frequencies: 0.001561 100500 -- (-2333.596) (-2340.889) [-2335.333] (-2332.240) * (-2332.518) (-2334.203) (-2338.642) [-2329.141] -- 0:04:19 101000 -- (-2335.341) [-2334.234] (-2335.270) (-2333.154) * [-2338.330] (-2337.796) (-2331.845) (-2329.926) -- 0:04:18 101500 -- [-2335.857] (-2329.159) (-2335.282) (-2338.011) * (-2335.517) [-2333.892] (-2334.764) (-2335.476) -- 0:04:16 102000 -- (-2333.741) (-2331.185) (-2334.773) [-2334.073] * (-2338.569) (-2336.292) [-2332.278] (-2339.588) -- 0:04:24 102500 -- [-2331.291] (-2333.958) (-2331.783) (-2331.068) * (-2341.986) (-2335.135) [-2330.872] (-2339.961) -- 0:04:22 103000 -- (-2332.678) [-2330.620] (-2335.083) (-2328.847) * (-2336.618) (-2328.999) [-2334.210] (-2332.260) -- 0:04:21 103500 -- (-2333.880) [-2331.591] (-2346.386) (-2327.963) * (-2340.865) (-2333.275) [-2328.204] (-2333.453) -- 0:04:19 104000 -- (-2340.130) (-2330.450) (-2342.038) [-2330.340] * (-2335.672) (-2337.788) [-2333.313] (-2330.693) -- 0:04:18 104500 -- (-2329.155) [-2330.077] (-2339.276) (-2341.177) * (-2328.370) [-2331.061] (-2337.829) (-2331.013) -- 0:04:17 105000 -- (-2329.869) [-2337.235] (-2339.305) (-2338.025) * (-2333.318) (-2331.490) (-2331.478) [-2337.789] -- 0:04:15 Average standard deviation of split frequencies: 0.001482 105500 -- (-2337.358) [-2333.830] (-2336.391) (-2335.453) * (-2332.108) [-2331.283] (-2330.717) (-2331.732) -- 0:04:22 106000 -- (-2331.826) (-2333.544) (-2332.199) [-2332.746] * (-2336.766) [-2333.903] (-2331.768) (-2340.637) -- 0:04:21 106500 -- (-2331.370) [-2330.749] (-2333.479) (-2335.516) * (-2332.797) (-2339.471) (-2333.484) [-2337.067] -- 0:04:20 107000 -- (-2335.288) (-2331.625) (-2333.199) [-2333.010] * (-2330.218) (-2334.868) [-2327.539] (-2338.637) -- 0:04:18 107500 -- (-2339.222) (-2332.939) (-2332.688) [-2333.644] * (-2329.464) (-2330.286) [-2331.319] (-2333.954) -- 0:04:17 108000 -- (-2333.824) [-2332.595] (-2336.562) (-2333.312) * (-2333.550) [-2330.576] (-2341.308) (-2331.876) -- 0:04:16 108500 -- [-2330.636] (-2326.035) (-2332.466) (-2341.888) * [-2330.036] (-2342.707) (-2332.403) (-2341.645) -- 0:04:14 109000 -- (-2331.838) [-2331.118] (-2326.280) (-2337.369) * (-2332.233) (-2328.874) [-2328.959] (-2338.656) -- 0:04:21 109500 -- (-2336.688) [-2330.153] (-2333.331) (-2331.606) * (-2333.653) (-2332.844) (-2339.626) [-2333.562] -- 0:04:20 110000 -- (-2336.226) (-2334.065) [-2334.482] (-2331.267) * (-2327.983) (-2336.809) (-2331.732) [-2333.649] -- 0:04:18 Average standard deviation of split frequencies: 0.001420 110500 -- (-2338.931) (-2331.010) [-2331.733] (-2336.417) * (-2331.699) (-2332.812) (-2335.515) [-2340.477] -- 0:04:17 111000 -- (-2335.695) (-2338.136) (-2331.795) [-2331.592] * (-2336.924) [-2333.246] (-2331.678) (-2330.687) -- 0:04:16 111500 -- (-2344.082) (-2328.377) (-2331.000) [-2332.466] * (-2335.788) [-2337.297] (-2328.779) (-2329.239) -- 0:04:14 112000 -- [-2331.069] (-2330.254) (-2338.195) (-2331.413) * (-2342.331) [-2334.501] (-2330.854) (-2333.423) -- 0:04:13 112500 -- (-2331.794) [-2337.493] (-2333.058) (-2329.429) * (-2342.482) (-2335.876) (-2335.241) [-2332.769] -- 0:04:20 113000 -- (-2334.734) [-2335.262] (-2337.720) (-2333.669) * (-2331.892) (-2333.129) (-2331.524) [-2332.914] -- 0:04:19 113500 -- [-2338.616] (-2329.589) (-2330.328) (-2336.218) * (-2332.558) (-2333.743) [-2329.872] (-2332.796) -- 0:04:17 114000 -- [-2339.670] (-2336.856) (-2332.313) (-2331.347) * [-2338.023] (-2328.581) (-2334.257) (-2332.640) -- 0:04:16 114500 -- (-2336.978) (-2331.930) (-2333.425) [-2330.448] * (-2332.185) (-2335.426) [-2338.585] (-2333.656) -- 0:04:15 115000 -- [-2334.515] (-2334.418) (-2338.663) (-2331.466) * (-2333.109) [-2332.287] (-2338.310) (-2333.377) -- 0:04:13 Average standard deviation of split frequencies: 0.000000 115500 -- (-2338.156) [-2330.052] (-2330.553) (-2338.206) * (-2331.922) (-2336.533) [-2334.432] (-2332.428) -- 0:04:12 116000 -- (-2332.240) (-2338.258) (-2337.998) [-2330.303] * [-2329.926] (-2331.416) (-2335.939) (-2333.167) -- 0:04:19 116500 -- (-2340.767) (-2334.871) (-2329.212) [-2331.136] * (-2338.186) (-2332.699) (-2334.787) [-2336.825] -- 0:04:17 117000 -- [-2332.367] (-2334.446) (-2335.412) (-2327.685) * [-2337.140] (-2334.804) (-2337.033) (-2330.779) -- 0:04:16 117500 -- (-2330.306) (-2330.490) [-2334.802] (-2329.006) * (-2338.748) (-2331.817) [-2337.439] (-2332.567) -- 0:04:15 118000 -- [-2330.481] (-2340.795) (-2343.407) (-2331.416) * (-2332.238) [-2335.008] (-2335.111) (-2331.546) -- 0:04:14 118500 -- (-2336.284) (-2335.760) (-2331.790) [-2333.574] * [-2331.968] (-2331.810) (-2337.442) (-2337.731) -- 0:04:12 119000 -- (-2338.434) (-2340.321) [-2332.606] (-2327.750) * (-2338.004) (-2327.545) (-2338.275) [-2338.877] -- 0:04:11 119500 -- (-2336.829) (-2334.842) [-2332.101] (-2333.040) * (-2337.677) (-2332.468) (-2345.686) [-2332.793] -- 0:04:17 120000 -- (-2334.866) [-2330.664] (-2330.162) (-2332.247) * (-2336.138) [-2339.204] (-2337.913) (-2335.638) -- 0:04:16 Average standard deviation of split frequencies: 0.000000 120500 -- [-2336.001] (-2328.940) (-2331.621) (-2338.292) * (-2328.673) [-2332.344] (-2331.217) (-2336.719) -- 0:04:15 121000 -- [-2335.731] (-2332.306) (-2335.110) (-2339.698) * (-2332.005) [-2331.538] (-2335.178) (-2333.533) -- 0:04:14 121500 -- (-2334.310) (-2336.471) [-2331.875] (-2337.853) * (-2327.285) [-2336.492] (-2327.466) (-2334.701) -- 0:04:13 122000 -- (-2333.269) (-2333.190) (-2335.212) [-2335.227] * (-2325.935) (-2341.288) [-2329.081] (-2341.319) -- 0:04:11 122500 -- [-2333.772] (-2330.171) (-2337.095) (-2327.007) * (-2327.379) (-2339.826) [-2329.303] (-2328.981) -- 0:04:10 123000 -- (-2330.342) [-2334.123] (-2343.757) (-2333.126) * (-2330.445) (-2338.244) (-2339.270) [-2335.793] -- 0:04:16 123500 -- [-2330.395] (-2333.009) (-2336.706) (-2336.979) * [-2330.384] (-2338.724) (-2337.861) (-2336.363) -- 0:04:15 124000 -- (-2336.795) [-2333.483] (-2341.611) (-2328.735) * (-2327.592) (-2342.415) (-2333.238) [-2336.725] -- 0:04:14 124500 -- (-2332.879) [-2333.289] (-2331.902) (-2331.182) * [-2335.651] (-2335.555) (-2338.988) (-2335.378) -- 0:04:13 125000 -- (-2333.300) [-2328.687] (-2331.872) (-2330.113) * [-2336.921] (-2338.918) (-2333.631) (-2333.831) -- 0:04:12 Average standard deviation of split frequencies: 0.001247 125500 -- (-2340.555) [-2331.296] (-2341.674) (-2328.541) * [-2329.579] (-2330.499) (-2333.203) (-2331.655) -- 0:04:10 126000 -- [-2332.806] (-2334.047) (-2330.972) (-2333.870) * [-2334.536] (-2342.519) (-2332.037) (-2331.674) -- 0:04:09 126500 -- [-2330.492] (-2335.465) (-2331.340) (-2331.180) * [-2325.676] (-2333.037) (-2334.062) (-2332.252) -- 0:04:15 127000 -- [-2330.176] (-2332.754) (-2339.329) (-2332.483) * (-2342.940) [-2331.042] (-2338.664) (-2335.692) -- 0:04:14 127500 -- (-2334.365) (-2338.984) (-2330.647) [-2331.340] * [-2333.819] (-2338.827) (-2336.763) (-2330.421) -- 0:04:13 128000 -- (-2329.507) (-2329.733) [-2329.633] (-2338.846) * [-2333.926] (-2332.596) (-2343.927) (-2335.642) -- 0:04:12 128500 -- (-2335.885) [-2332.459] (-2333.556) (-2331.381) * [-2331.340] (-2335.452) (-2345.730) (-2337.777) -- 0:04:10 129000 -- (-2335.103) (-2344.607) [-2335.330] (-2330.283) * (-2341.133) [-2333.168] (-2341.075) (-2336.219) -- 0:04:09 129500 -- [-2340.428] (-2335.196) (-2330.608) (-2331.211) * [-2333.164] (-2328.170) (-2337.516) (-2337.264) -- 0:04:08 130000 -- [-2330.982] (-2339.484) (-2328.891) (-2332.551) * (-2331.330) (-2333.704) [-2335.535] (-2327.835) -- 0:04:14 Average standard deviation of split frequencies: 0.002405 130500 -- (-2331.029) (-2335.456) (-2331.905) [-2336.955] * (-2329.603) (-2330.879) [-2332.453] (-2330.785) -- 0:04:13 131000 -- (-2328.775) (-2331.837) (-2333.950) [-2339.311] * [-2336.166] (-2332.353) (-2334.568) (-2335.526) -- 0:04:12 131500 -- [-2325.430] (-2333.719) (-2328.375) (-2328.495) * [-2333.096] (-2329.518) (-2336.409) (-2334.391) -- 0:04:10 132000 -- (-2328.624) (-2340.887) (-2337.314) [-2330.532] * (-2333.298) (-2331.847) [-2331.360] (-2336.336) -- 0:04:09 132500 -- (-2332.303) (-2332.709) [-2328.033] (-2339.838) * (-2331.428) (-2337.769) [-2328.480] (-2339.113) -- 0:04:08 133000 -- (-2336.989) (-2342.314) (-2332.582) [-2332.104] * (-2327.758) (-2334.713) (-2335.002) [-2334.878] -- 0:04:07 133500 -- [-2327.995] (-2328.165) (-2336.483) (-2337.314) * [-2330.103] (-2330.681) (-2329.275) (-2338.110) -- 0:04:13 134000 -- (-2334.289) (-2329.303) [-2334.331] (-2329.573) * [-2330.328] (-2331.300) (-2325.779) (-2330.106) -- 0:04:12 134500 -- [-2331.652] (-2339.438) (-2336.097) (-2330.501) * (-2327.487) [-2333.447] (-2330.459) (-2334.035) -- 0:04:10 135000 -- (-2338.206) (-2331.678) [-2329.594] (-2330.504) * [-2326.961] (-2333.095) (-2337.095) (-2328.652) -- 0:04:09 Average standard deviation of split frequencies: 0.002311 135500 -- (-2338.156) (-2333.025) [-2327.176] (-2331.881) * (-2332.837) [-2332.268] (-2329.828) (-2340.017) -- 0:04:08 136000 -- (-2339.176) [-2329.147] (-2331.319) (-2329.120) * (-2335.707) (-2336.559) [-2332.395] (-2331.781) -- 0:04:07 136500 -- (-2336.712) [-2332.231] (-2330.831) (-2328.600) * (-2330.462) (-2337.721) (-2332.401) [-2332.041] -- 0:04:06 137000 -- (-2332.582) (-2331.116) (-2332.512) [-2331.058] * (-2328.681) (-2333.829) (-2334.681) [-2331.341] -- 0:04:11 137500 -- (-2331.256) [-2326.488] (-2331.515) (-2333.835) * (-2327.983) (-2332.425) (-2336.119) [-2337.110] -- 0:04:10 138000 -- (-2333.673) [-2330.512] (-2335.180) (-2335.405) * [-2333.744] (-2347.061) (-2334.738) (-2334.683) -- 0:04:09 138500 -- (-2334.471) [-2334.510] (-2330.695) (-2335.555) * (-2344.222) (-2343.688) (-2338.517) [-2331.562] -- 0:04:08 139000 -- [-2337.242] (-2330.962) (-2333.868) (-2345.447) * (-2332.778) (-2334.933) (-2338.631) [-2327.008] -- 0:04:07 139500 -- [-2328.892] (-2336.371) (-2334.184) (-2337.852) * (-2337.020) (-2337.892) (-2332.020) [-2332.562] -- 0:04:06 140000 -- [-2331.231] (-2328.085) (-2338.835) (-2334.838) * (-2332.832) (-2335.681) [-2323.733] (-2326.728) -- 0:04:05 Average standard deviation of split frequencies: 0.002234 140500 -- (-2339.172) (-2327.798) [-2334.187] (-2330.119) * (-2331.554) [-2326.721] (-2332.866) (-2330.355) -- 0:04:10 141000 -- (-2339.016) [-2329.155] (-2331.289) (-2329.801) * [-2329.227] (-2337.513) (-2332.177) (-2335.118) -- 0:04:09 141500 -- (-2331.139) [-2328.439] (-2335.385) (-2330.684) * (-2334.549) (-2335.448) [-2328.861] (-2333.235) -- 0:04:08 142000 -- (-2332.780) [-2330.890] (-2332.496) (-2338.899) * (-2336.572) [-2337.506] (-2329.449) (-2332.913) -- 0:04:07 142500 -- [-2327.314] (-2335.531) (-2338.902) (-2332.500) * (-2337.335) (-2336.364) [-2333.970] (-2333.197) -- 0:04:06 143000 -- (-2332.644) (-2337.863) (-2331.249) [-2333.143] * (-2331.753) [-2333.016] (-2327.261) (-2331.455) -- 0:04:05 143500 -- (-2333.339) (-2342.391) [-2329.106] (-2332.726) * [-2330.718] (-2330.906) (-2332.297) (-2332.179) -- 0:04:04 144000 -- (-2330.499) [-2337.311] (-2331.234) (-2337.111) * (-2333.144) (-2333.715) [-2329.797] (-2328.650) -- 0:04:09 144500 -- (-2332.812) [-2335.120] (-2336.890) (-2329.045) * (-2333.501) (-2333.120) [-2333.442] (-2337.491) -- 0:04:08 145000 -- (-2327.265) (-2334.114) (-2332.328) [-2330.309] * (-2337.670) [-2332.054] (-2330.076) (-2340.070) -- 0:04:07 Average standard deviation of split frequencies: 0.002153 145500 -- (-2332.351) (-2333.716) [-2333.768] (-2342.910) * (-2335.394) (-2334.761) (-2333.451) [-2328.501] -- 0:04:06 146000 -- (-2331.367) (-2345.062) (-2328.386) [-2336.675] * (-2332.067) [-2331.748] (-2332.662) (-2335.942) -- 0:04:05 146500 -- (-2335.328) (-2332.843) [-2331.187] (-2336.723) * (-2338.232) [-2336.060] (-2331.847) (-2334.107) -- 0:04:04 147000 -- (-2333.761) (-2334.861) [-2337.525] (-2338.911) * (-2340.126) (-2331.277) [-2338.696] (-2334.239) -- 0:04:03 147500 -- (-2334.705) [-2327.501] (-2340.245) (-2336.635) * (-2340.415) [-2331.234] (-2332.997) (-2333.642) -- 0:04:08 148000 -- [-2326.669] (-2327.116) (-2333.507) (-2333.767) * (-2337.828) [-2329.870] (-2333.483) (-2327.518) -- 0:04:07 148500 -- (-2334.339) [-2329.657] (-2329.417) (-2328.287) * (-2333.148) (-2330.836) [-2333.663] (-2331.924) -- 0:04:06 149000 -- (-2327.955) (-2332.238) (-2335.369) [-2331.821] * (-2331.834) [-2327.374] (-2330.097) (-2337.260) -- 0:04:05 149500 -- (-2327.877) (-2331.686) [-2332.128] (-2331.239) * (-2340.009) (-2336.347) [-2332.295] (-2331.831) -- 0:04:04 150000 -- (-2341.398) (-2331.549) [-2333.832] (-2333.355) * (-2327.454) [-2331.577] (-2329.838) (-2332.577) -- 0:04:03 Average standard deviation of split frequencies: 0.002086 150500 -- (-2340.170) [-2332.706] (-2338.752) (-2330.692) * [-2329.200] (-2332.720) (-2330.257) (-2334.792) -- 0:04:02 151000 -- (-2326.905) (-2332.475) (-2331.738) [-2328.550] * [-2335.150] (-2334.701) (-2338.553) (-2326.573) -- 0:04:07 151500 -- (-2337.504) (-2335.649) [-2329.997] (-2337.871) * (-2331.760) (-2338.205) (-2341.178) [-2331.336] -- 0:04:06 152000 -- (-2337.589) (-2332.354) [-2328.255] (-2333.351) * (-2336.513) [-2330.220] (-2347.456) (-2330.366) -- 0:04:05 152500 -- (-2327.660) [-2331.577] (-2332.657) (-2331.720) * (-2335.212) (-2329.896) [-2342.946] (-2337.232) -- 0:04:04 153000 -- [-2332.332] (-2333.782) (-2333.470) (-2335.489) * (-2334.436) [-2330.012] (-2334.641) (-2341.902) -- 0:04:03 153500 -- (-2334.132) [-2334.935] (-2332.405) (-2332.416) * (-2336.406) (-2328.342) (-2340.694) [-2334.377] -- 0:04:02 154000 -- [-2333.299] (-2334.514) (-2331.951) (-2332.058) * [-2334.358] (-2335.007) (-2339.159) (-2329.186) -- 0:04:01 154500 -- [-2336.396] (-2329.608) (-2331.960) (-2331.038) * (-2332.185) (-2334.316) (-2341.321) [-2329.328] -- 0:04:06 155000 -- [-2330.813] (-2329.530) (-2334.510) (-2327.052) * (-2334.144) (-2325.403) [-2333.253] (-2338.186) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 155500 -- (-2329.614) (-2335.887) [-2330.958] (-2334.848) * (-2331.411) [-2328.738] (-2333.413) (-2339.162) -- 0:04:04 156000 -- (-2329.857) (-2332.944) (-2331.690) [-2330.501] * [-2334.346] (-2333.221) (-2338.295) (-2332.241) -- 0:04:03 156500 -- [-2334.850] (-2338.123) (-2333.297) (-2329.535) * (-2341.944) (-2336.988) [-2339.686] (-2339.944) -- 0:04:02 157000 -- (-2333.171) (-2331.588) [-2342.582] (-2335.269) * (-2328.805) (-2333.567) [-2338.038] (-2340.178) -- 0:04:01 157500 -- (-2337.850) (-2334.345) [-2335.008] (-2334.299) * (-2333.326) [-2328.368] (-2343.422) (-2331.754) -- 0:04:00 158000 -- (-2334.737) (-2350.022) [-2327.698] (-2336.449) * (-2336.059) [-2331.976] (-2334.972) (-2330.091) -- 0:04:05 158500 -- (-2328.927) (-2339.847) [-2332.413] (-2341.511) * (-2329.213) (-2331.195) (-2333.357) [-2329.252] -- 0:04:04 159000 -- (-2334.624) (-2331.149) [-2333.643] (-2335.312) * (-2335.962) (-2334.113) (-2331.947) [-2334.621] -- 0:04:03 159500 -- (-2331.707) (-2337.352) [-2332.160] (-2334.665) * [-2330.714] (-2336.553) (-2335.797) (-2338.668) -- 0:04:02 160000 -- (-2340.031) [-2335.367] (-2333.192) (-2330.815) * (-2333.377) (-2336.792) [-2331.123] (-2331.524) -- 0:04:01 Average standard deviation of split frequencies: 0.000978 160500 -- (-2334.507) (-2332.668) [-2343.100] (-2332.355) * [-2333.146] (-2336.479) (-2335.784) (-2332.694) -- 0:04:00 161000 -- (-2336.172) (-2343.299) [-2336.045] (-2335.857) * [-2336.945] (-2331.697) (-2331.108) (-2336.442) -- 0:03:59 161500 -- (-2334.165) [-2336.346] (-2336.477) (-2327.508) * (-2334.622) (-2332.696) [-2332.394] (-2332.361) -- 0:04:04 162000 -- [-2329.910] (-2331.046) (-2330.216) (-2328.512) * [-2328.092] (-2334.695) (-2333.036) (-2332.857) -- 0:04:03 162500 -- [-2333.421] (-2337.420) (-2334.650) (-2333.160) * (-2334.999) (-2333.086) (-2335.859) [-2333.371] -- 0:04:02 163000 -- [-2328.802] (-2344.530) (-2337.023) (-2330.417) * (-2335.310) (-2338.695) [-2334.764] (-2328.361) -- 0:04:01 163500 -- (-2334.945) (-2338.226) [-2333.769] (-2328.867) * (-2333.065) [-2337.126] (-2334.565) (-2343.137) -- 0:04:00 164000 -- (-2336.727) (-2336.270) (-2337.459) [-2329.666] * (-2333.192) (-2336.024) [-2335.939] (-2333.724) -- 0:03:59 164500 -- (-2336.398) [-2331.660] (-2333.357) (-2332.041) * [-2331.171] (-2335.868) (-2334.999) (-2331.465) -- 0:03:58 165000 -- (-2331.879) (-2331.601) (-2331.523) [-2331.266] * (-2330.488) (-2334.823) (-2343.434) [-2329.815] -- 0:04:02 Average standard deviation of split frequencies: 0.000947 165500 -- (-2330.127) (-2333.531) [-2332.228] (-2329.127) * [-2334.237] (-2333.309) (-2328.856) (-2343.556) -- 0:04:02 166000 -- (-2336.942) (-2328.771) [-2330.984] (-2340.518) * (-2342.123) (-2337.140) [-2344.490] (-2340.343) -- 0:04:01 166500 -- (-2332.512) (-2332.763) [-2330.489] (-2339.236) * (-2335.798) (-2336.133) [-2329.736] (-2333.291) -- 0:04:00 167000 -- (-2329.583) [-2327.422] (-2337.429) (-2339.728) * [-2332.219] (-2338.370) (-2332.501) (-2331.298) -- 0:03:59 167500 -- (-2328.906) (-2331.746) (-2339.689) [-2341.628] * (-2332.285) (-2339.009) (-2332.358) [-2333.497] -- 0:03:58 168000 -- (-2335.421) [-2334.687] (-2341.681) (-2337.380) * (-2330.068) (-2330.719) [-2329.977] (-2329.031) -- 0:03:57 168500 -- (-2328.095) (-2327.943) (-2330.804) [-2336.005] * (-2338.163) (-2334.542) (-2332.092) [-2334.395] -- 0:04:01 169000 -- (-2338.650) (-2331.037) [-2333.853] (-2336.050) * (-2334.400) (-2332.819) [-2332.666] (-2338.207) -- 0:04:00 169500 -- (-2334.766) (-2333.996) [-2326.165] (-2331.444) * (-2337.242) [-2333.856] (-2334.715) (-2332.389) -- 0:04:00 170000 -- (-2331.187) (-2345.704) [-2327.388] (-2335.016) * (-2335.790) (-2337.800) [-2329.486] (-2337.698) -- 0:03:59 Average standard deviation of split frequencies: 0.000000 170500 -- [-2335.396] (-2336.988) (-2328.328) (-2336.622) * [-2339.131] (-2335.597) (-2332.245) (-2335.762) -- 0:03:58 171000 -- [-2329.910] (-2333.845) (-2337.560) (-2336.132) * (-2333.589) [-2332.144] (-2337.009) (-2341.992) -- 0:03:57 171500 -- [-2334.508] (-2329.194) (-2336.383) (-2345.068) * (-2338.329) (-2334.243) [-2332.352] (-2339.684) -- 0:03:56 172000 -- (-2333.435) [-2331.319] (-2335.744) (-2335.817) * (-2332.716) [-2333.197] (-2334.429) (-2339.914) -- 0:04:00 172500 -- (-2331.214) (-2335.866) [-2328.541] (-2333.384) * (-2335.141) [-2330.179] (-2332.844) (-2331.709) -- 0:03:59 173000 -- (-2338.464) (-2333.391) (-2337.845) [-2336.303] * (-2334.407) (-2335.019) (-2335.642) [-2337.786] -- 0:03:59 173500 -- (-2330.630) (-2329.001) [-2333.100] (-2333.993) * (-2333.751) (-2332.594) [-2338.727] (-2340.842) -- 0:03:58 174000 -- (-2328.595) [-2332.092] (-2330.978) (-2341.622) * (-2331.742) (-2339.252) [-2328.138] (-2333.334) -- 0:03:57 174500 -- (-2332.638) [-2338.228] (-2335.530) (-2340.560) * (-2336.983) [-2335.120] (-2334.035) (-2338.031) -- 0:03:56 175000 -- (-2333.895) [-2328.896] (-2331.073) (-2337.080) * (-2332.617) (-2332.566) (-2334.129) [-2328.533] -- 0:03:55 Average standard deviation of split frequencies: 0.000000 175500 -- (-2330.492) (-2335.261) (-2333.127) [-2333.332] * (-2330.841) (-2334.820) [-2336.091] (-2333.713) -- 0:03:59 176000 -- (-2337.322) (-2332.588) (-2339.785) [-2327.591] * (-2335.017) (-2342.360) [-2332.407] (-2330.845) -- 0:03:58 176500 -- (-2335.665) [-2330.655] (-2341.120) (-2336.355) * [-2332.064] (-2334.286) (-2334.235) (-2326.738) -- 0:03:57 177000 -- (-2328.815) (-2334.442) (-2344.940) [-2328.974] * (-2327.820) [-2335.226] (-2335.550) (-2335.570) -- 0:03:57 177500 -- (-2339.603) [-2331.149] (-2332.354) (-2326.197) * (-2327.127) [-2327.228] (-2337.097) (-2331.334) -- 0:03:56 178000 -- (-2332.563) (-2332.277) (-2334.812) [-2334.242] * (-2333.042) [-2330.386] (-2341.536) (-2332.188) -- 0:03:55 178500 -- [-2337.466] (-2335.876) (-2337.185) (-2337.655) * (-2335.541) (-2338.563) (-2340.634) [-2331.155] -- 0:03:54 179000 -- (-2331.947) (-2332.965) [-2328.783] (-2336.006) * (-2336.051) [-2335.199] (-2331.465) (-2331.219) -- 0:03:58 179500 -- (-2330.050) (-2332.538) (-2330.704) [-2333.043] * (-2336.893) [-2330.785] (-2332.615) (-2330.034) -- 0:03:57 180000 -- (-2329.508) (-2332.356) [-2333.086] (-2329.759) * (-2334.382) (-2338.311) (-2333.984) [-2329.656] -- 0:03:56 Average standard deviation of split frequencies: 0.000000 180500 -- (-2329.648) (-2326.557) (-2335.847) [-2331.093] * (-2331.201) [-2333.558] (-2330.025) (-2332.937) -- 0:03:56 181000 -- (-2336.774) (-2328.694) [-2333.029] (-2336.179) * (-2330.470) (-2333.034) (-2334.118) [-2330.932] -- 0:03:55 181500 -- (-2337.779) [-2331.641] (-2333.264) (-2339.937) * (-2334.019) (-2331.849) (-2335.892) [-2334.454] -- 0:03:54 182000 -- [-2336.257] (-2328.097) (-2338.559) (-2330.645) * (-2340.854) (-2331.042) [-2331.529] (-2335.504) -- 0:03:53 182500 -- (-2330.088) [-2331.210] (-2332.118) (-2338.016) * (-2336.263) (-2340.904) [-2337.088] (-2332.079) -- 0:03:57 183000 -- (-2333.729) (-2338.525) [-2337.556] (-2338.880) * (-2334.654) (-2333.599) [-2329.313] (-2338.278) -- 0:03:56 183500 -- (-2329.933) [-2329.133] (-2336.008) (-2338.948) * (-2335.746) [-2336.032] (-2334.184) (-2330.722) -- 0:03:55 184000 -- [-2328.413] (-2330.324) (-2331.619) (-2336.236) * [-2331.071] (-2336.970) (-2332.897) (-2333.305) -- 0:03:55 184500 -- [-2328.164] (-2342.191) (-2334.107) (-2334.234) * (-2334.776) (-2333.307) [-2330.871] (-2331.547) -- 0:03:54 185000 -- [-2330.018] (-2333.603) (-2331.583) (-2331.611) * (-2335.214) [-2338.670] (-2334.848) (-2340.798) -- 0:03:53 Average standard deviation of split frequencies: 0.000000 185500 -- (-2334.034) (-2327.726) (-2329.825) [-2335.054] * (-2340.861) (-2329.950) (-2333.757) [-2331.418] -- 0:03:52 186000 -- (-2336.503) (-2333.525) (-2326.692) [-2330.611] * (-2333.470) (-2334.150) [-2328.061] (-2334.225) -- 0:03:56 186500 -- (-2337.851) (-2332.557) [-2339.283] (-2338.968) * (-2332.198) (-2337.358) [-2337.198] (-2338.777) -- 0:03:55 187000 -- [-2329.991] (-2337.856) (-2332.359) (-2329.556) * [-2334.001] (-2328.844) (-2331.592) (-2341.589) -- 0:03:54 187500 -- [-2333.273] (-2333.794) (-2330.535) (-2335.871) * (-2329.860) [-2333.060] (-2338.013) (-2335.588) -- 0:03:54 188000 -- [-2331.876] (-2345.551) (-2332.612) (-2330.391) * [-2335.069] (-2327.161) (-2331.526) (-2333.727) -- 0:03:53 188500 -- (-2332.540) [-2332.297] (-2331.919) (-2334.427) * (-2340.385) (-2328.491) [-2329.199] (-2333.030) -- 0:03:52 189000 -- [-2331.514] (-2329.446) (-2335.041) (-2335.252) * (-2330.623) (-2331.601) (-2339.742) [-2332.923] -- 0:03:51 189500 -- (-2332.003) (-2339.821) (-2329.097) [-2335.769] * (-2334.387) (-2334.086) (-2332.262) [-2330.971] -- 0:03:55 190000 -- (-2335.873) (-2333.183) [-2332.028] (-2330.623) * (-2330.240) (-2334.406) (-2336.038) [-2338.777] -- 0:03:54 Average standard deviation of split frequencies: 0.000000 190500 -- [-2334.157] (-2326.005) (-2342.289) (-2335.860) * (-2333.757) (-2334.659) [-2336.488] (-2329.181) -- 0:03:53 191000 -- (-2333.673) (-2338.972) (-2331.733) [-2330.247] * (-2334.864) [-2329.625] (-2331.641) (-2334.062) -- 0:03:52 191500 -- [-2329.385] (-2333.709) (-2331.642) (-2341.029) * (-2335.700) (-2327.840) (-2336.547) [-2333.178] -- 0:03:52 192000 -- [-2332.404] (-2338.021) (-2338.302) (-2335.529) * (-2339.655) (-2334.960) (-2338.545) [-2332.124] -- 0:03:51 192500 -- [-2328.306] (-2337.524) (-2330.431) (-2331.780) * (-2337.749) [-2332.218] (-2332.432) (-2332.638) -- 0:03:50 193000 -- (-2330.509) (-2333.153) [-2331.858] (-2331.515) * (-2336.119) [-2333.549] (-2330.223) (-2332.893) -- 0:03:54 193500 -- [-2332.619] (-2333.271) (-2326.564) (-2335.608) * (-2326.353) (-2337.601) (-2337.863) [-2333.971] -- 0:03:53 194000 -- (-2330.282) (-2334.635) (-2329.040) [-2333.449] * (-2334.068) (-2338.478) (-2333.359) [-2329.550] -- 0:03:52 194500 -- [-2333.859] (-2337.199) (-2330.056) (-2340.349) * [-2333.434] (-2338.516) (-2340.431) (-2332.753) -- 0:03:51 195000 -- [-2332.533] (-2338.025) (-2340.906) (-2329.549) * (-2332.258) [-2331.406] (-2337.370) (-2327.124) -- 0:03:51 Average standard deviation of split frequencies: 0.000000 195500 -- (-2341.715) (-2333.319) [-2333.322] (-2337.815) * (-2331.046) (-2334.629) (-2340.316) [-2329.439] -- 0:03:50 196000 -- (-2336.716) [-2334.593] (-2333.215) (-2332.010) * (-2336.265) (-2331.403) [-2331.065] (-2331.633) -- 0:03:49 196500 -- (-2332.647) (-2330.979) (-2337.152) [-2331.732] * [-2328.130] (-2334.093) (-2329.439) (-2336.900) -- 0:03:53 197000 -- (-2335.778) [-2333.884] (-2336.223) (-2334.998) * (-2336.944) (-2337.533) [-2329.511] (-2338.731) -- 0:03:52 197500 -- (-2329.923) (-2334.013) (-2334.503) [-2333.242] * [-2333.894] (-2346.139) (-2335.780) (-2330.721) -- 0:03:51 198000 -- (-2331.349) [-2336.862] (-2334.019) (-2329.280) * [-2330.805] (-2338.230) (-2336.305) (-2330.246) -- 0:03:50 198500 -- (-2338.192) (-2329.020) [-2331.437] (-2332.951) * (-2332.242) (-2334.618) [-2332.279] (-2334.775) -- 0:03:50 199000 -- (-2333.131) [-2333.467] (-2334.458) (-2327.558) * (-2339.146) [-2335.045] (-2337.906) (-2330.276) -- 0:03:49 199500 -- [-2332.823] (-2331.082) (-2334.356) (-2339.394) * (-2333.387) (-2336.825) [-2328.000] (-2332.955) -- 0:03:48 200000 -- (-2335.032) (-2334.141) (-2330.356) [-2329.256] * (-2341.299) (-2334.593) (-2333.832) [-2330.535] -- 0:03:52 Average standard deviation of split frequencies: 0.000000 200500 -- (-2330.536) (-2332.756) [-2328.680] (-2335.035) * (-2332.475) [-2333.528] (-2333.243) (-2328.618) -- 0:03:51 201000 -- (-2325.505) [-2333.233] (-2338.849) (-2330.325) * [-2328.408] (-2332.533) (-2327.690) (-2333.861) -- 0:03:50 201500 -- [-2329.734] (-2330.464) (-2332.524) (-2328.110) * (-2331.845) [-2335.477] (-2334.665) (-2338.002) -- 0:03:49 202000 -- (-2342.354) (-2340.624) [-2331.308] (-2325.492) * (-2331.101) (-2333.765) [-2333.388] (-2334.265) -- 0:03:49 202500 -- (-2339.014) [-2327.699] (-2330.146) (-2339.044) * (-2329.495) (-2332.618) [-2338.018] (-2338.605) -- 0:03:48 203000 -- (-2340.579) (-2330.149) (-2327.895) [-2329.445] * (-2331.671) [-2327.694] (-2335.125) (-2334.653) -- 0:03:47 203500 -- (-2336.558) [-2335.031] (-2333.544) (-2334.849) * (-2333.101) [-2331.103] (-2335.454) (-2339.555) -- 0:03:50 204000 -- (-2337.634) [-2330.988] (-2337.006) (-2330.269) * (-2336.591) (-2337.209) [-2333.118] (-2338.100) -- 0:03:50 204500 -- (-2332.785) [-2333.513] (-2338.304) (-2328.409) * (-2335.276) (-2339.876) (-2340.543) [-2337.547] -- 0:03:49 205000 -- (-2335.504) (-2333.289) (-2332.197) [-2329.068] * (-2335.471) (-2333.869) [-2331.985] (-2332.893) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 205500 -- (-2336.167) [-2331.904] (-2341.719) (-2325.983) * (-2337.475) (-2334.112) (-2339.942) [-2344.878] -- 0:03:48 206000 -- [-2336.399] (-2338.780) (-2329.718) (-2333.216) * (-2333.761) [-2334.091] (-2335.208) (-2338.230) -- 0:03:47 206500 -- (-2341.397) (-2333.020) (-2339.243) [-2332.747] * [-2331.251] (-2333.141) (-2341.710) (-2335.151) -- 0:03:46 207000 -- (-2336.446) [-2328.812] (-2333.787) (-2330.154) * (-2329.599) (-2337.251) (-2335.699) [-2333.539] -- 0:03:49 207500 -- (-2336.331) (-2334.054) (-2327.647) [-2331.995] * (-2330.826) (-2334.376) (-2331.425) [-2330.556] -- 0:03:49 208000 -- [-2334.480] (-2339.778) (-2334.586) (-2333.161) * (-2331.961) (-2340.089) [-2332.366] (-2332.452) -- 0:03:48 208500 -- [-2329.324] (-2336.793) (-2333.227) (-2338.031) * (-2333.668) (-2347.328) [-2330.144] (-2338.250) -- 0:03:47 209000 -- [-2331.758] (-2329.505) (-2328.419) (-2334.758) * (-2328.488) (-2337.422) [-2331.525] (-2334.978) -- 0:03:47 209500 -- [-2333.017] (-2335.962) (-2328.004) (-2333.040) * (-2330.501) [-2333.365] (-2331.134) (-2335.712) -- 0:03:46 210000 -- (-2331.167) (-2338.392) (-2329.959) [-2326.784] * (-2333.311) (-2335.165) [-2335.789] (-2330.679) -- 0:03:45 Average standard deviation of split frequencies: 0.000000 210500 -- (-2329.228) [-2332.334] (-2333.888) (-2333.239) * (-2335.111) (-2332.867) [-2326.720] (-2333.455) -- 0:03:48 211000 -- (-2332.506) (-2335.550) [-2325.533] (-2329.901) * (-2331.795) (-2335.325) [-2336.639] (-2330.591) -- 0:03:48 211500 -- (-2335.927) [-2331.501] (-2333.592) (-2339.482) * (-2333.747) (-2335.359) [-2333.744] (-2330.599) -- 0:03:47 212000 -- (-2336.660) (-2327.737) [-2334.689] (-2329.849) * (-2341.038) [-2328.763] (-2339.282) (-2334.757) -- 0:03:46 212500 -- [-2333.748] (-2331.583) (-2332.693) (-2328.791) * (-2331.817) (-2331.626) [-2331.476] (-2331.649) -- 0:03:46 213000 -- [-2333.053] (-2332.217) (-2329.349) (-2331.650) * [-2333.573] (-2333.122) (-2334.038) (-2330.315) -- 0:03:45 213500 -- [-2335.108] (-2334.061) (-2337.424) (-2337.964) * [-2335.601] (-2335.884) (-2327.152) (-2333.898) -- 0:03:44 214000 -- (-2334.648) [-2333.975] (-2334.496) (-2329.847) * (-2331.799) (-2333.600) (-2332.106) [-2334.221] -- 0:03:47 214500 -- [-2331.673] (-2332.626) (-2337.463) (-2331.148) * (-2329.873) [-2330.945] (-2336.898) (-2335.926) -- 0:03:47 215000 -- (-2332.892) (-2338.063) [-2334.697] (-2327.015) * [-2329.152] (-2333.476) (-2335.137) (-2331.052) -- 0:03:46 Average standard deviation of split frequencies: 0.000727 215500 -- (-2336.718) (-2329.092) (-2331.017) [-2333.100] * (-2329.931) (-2328.055) (-2331.971) [-2336.940] -- 0:03:45 216000 -- (-2331.461) [-2329.540] (-2339.300) (-2329.807) * (-2329.951) [-2326.385] (-2330.365) (-2334.142) -- 0:03:45 216500 -- (-2332.434) (-2335.916) [-2332.412] (-2341.443) * (-2327.338) [-2333.796] (-2331.993) (-2331.128) -- 0:03:44 217000 -- (-2331.197) (-2332.543) (-2334.682) [-2334.579] * [-2334.040] (-2331.705) (-2336.291) (-2334.316) -- 0:03:43 217500 -- [-2336.002] (-2328.608) (-2336.105) (-2347.163) * [-2338.605] (-2332.948) (-2335.259) (-2332.599) -- 0:03:46 218000 -- [-2337.827] (-2326.938) (-2332.897) (-2334.590) * [-2335.638] (-2333.714) (-2333.397) (-2333.946) -- 0:03:45 218500 -- (-2338.656) (-2335.281) [-2329.438] (-2326.758) * (-2328.540) (-2338.243) [-2333.519] (-2330.848) -- 0:03:45 219000 -- (-2342.331) (-2338.118) [-2329.381] (-2333.947) * [-2329.514] (-2338.734) (-2332.466) (-2329.016) -- 0:03:44 219500 -- (-2338.248) (-2331.403) (-2335.427) [-2336.644] * [-2329.733] (-2333.847) (-2350.856) (-2331.959) -- 0:03:44 220000 -- (-2328.465) [-2336.922] (-2331.387) (-2335.715) * (-2335.552) (-2336.549) (-2340.399) [-2330.049] -- 0:03:43 Average standard deviation of split frequencies: 0.000712 220500 -- (-2328.000) [-2331.849] (-2329.716) (-2332.086) * (-2338.556) (-2334.366) [-2339.632] (-2330.070) -- 0:03:42 221000 -- (-2332.561) [-2328.232] (-2334.941) (-2333.844) * (-2327.308) (-2337.415) (-2342.670) [-2328.402] -- 0:03:45 221500 -- (-2336.039) [-2332.403] (-2339.764) (-2328.848) * [-2328.552] (-2342.796) (-2335.584) (-2329.449) -- 0:03:44 222000 -- (-2333.763) (-2327.612) [-2338.958] (-2336.328) * [-2326.265] (-2344.331) (-2344.766) (-2330.538) -- 0:03:44 222500 -- [-2332.483] (-2330.965) (-2332.325) (-2329.625) * [-2328.969] (-2342.764) (-2333.421) (-2333.876) -- 0:03:43 223000 -- (-2330.347) [-2335.446] (-2336.207) (-2335.356) * (-2335.170) (-2337.960) (-2340.102) [-2332.872] -- 0:03:42 223500 -- (-2341.098) [-2329.366] (-2330.064) (-2330.084) * (-2332.976) [-2333.645] (-2335.309) (-2327.747) -- 0:03:42 224000 -- (-2343.593) [-2330.401] (-2335.958) (-2330.435) * (-2332.906) [-2331.840] (-2330.942) (-2339.362) -- 0:03:41 224500 -- (-2339.099) [-2334.382] (-2336.021) (-2330.593) * [-2332.402] (-2334.650) (-2337.654) (-2334.745) -- 0:03:44 225000 -- (-2337.137) [-2331.666] (-2342.662) (-2329.541) * (-2332.016) [-2331.272] (-2333.581) (-2331.277) -- 0:03:43 Average standard deviation of split frequencies: 0.000695 225500 -- (-2335.505) [-2329.876] (-2338.483) (-2332.532) * (-2335.837) [-2337.189] (-2331.501) (-2338.828) -- 0:03:43 226000 -- (-2335.341) [-2330.951] (-2334.525) (-2332.638) * (-2325.411) [-2325.221] (-2332.488) (-2340.686) -- 0:03:42 226500 -- (-2337.227) (-2329.952) (-2339.298) [-2331.894] * (-2342.673) (-2330.906) (-2341.036) [-2330.081] -- 0:03:41 227000 -- (-2341.851) (-2332.405) [-2333.805] (-2334.747) * (-2332.090) (-2333.787) (-2336.304) [-2332.091] -- 0:03:41 227500 -- (-2336.014) [-2333.163] (-2332.367) (-2333.117) * (-2329.039) [-2331.432] (-2329.872) (-2329.253) -- 0:03:40 228000 -- (-2336.704) [-2338.290] (-2336.489) (-2349.196) * (-2332.075) (-2342.146) (-2334.612) [-2330.876] -- 0:03:43 228500 -- (-2334.319) [-2343.137] (-2330.491) (-2338.622) * [-2333.452] (-2324.995) (-2329.374) (-2340.795) -- 0:03:42 229000 -- (-2335.918) (-2331.701) [-2330.550] (-2332.904) * (-2333.354) (-2329.886) [-2336.368] (-2334.582) -- 0:03:42 229500 -- (-2335.703) (-2335.263) [-2331.534] (-2343.902) * [-2333.266] (-2325.468) (-2337.343) (-2329.420) -- 0:03:41 230000 -- (-2331.345) [-2336.695] (-2331.636) (-2341.292) * (-2330.054) [-2335.928] (-2328.912) (-2336.929) -- 0:03:40 Average standard deviation of split frequencies: 0.000681 230500 -- (-2339.616) [-2331.011] (-2331.006) (-2338.950) * (-2327.656) (-2341.537) [-2328.570] (-2331.513) -- 0:03:40 231000 -- (-2336.833) [-2336.167] (-2333.367) (-2329.850) * [-2327.904] (-2335.152) (-2333.416) (-2330.107) -- 0:03:39 231500 -- (-2333.502) [-2330.320] (-2328.352) (-2329.604) * (-2332.871) (-2333.040) (-2335.955) [-2327.926] -- 0:03:42 232000 -- (-2337.553) [-2335.522] (-2335.721) (-2333.799) * [-2328.427] (-2340.010) (-2332.663) (-2329.110) -- 0:03:41 232500 -- (-2325.906) (-2333.084) [-2326.964] (-2333.474) * [-2334.152] (-2334.717) (-2337.897) (-2331.669) -- 0:03:41 233000 -- (-2332.745) [-2341.255] (-2333.535) (-2343.276) * (-2332.438) (-2332.233) [-2332.262] (-2330.598) -- 0:03:40 233500 -- (-2331.021) (-2348.711) (-2330.889) [-2335.097] * (-2328.738) (-2333.066) [-2329.997] (-2331.227) -- 0:03:39 234000 -- (-2334.576) (-2334.390) [-2329.721] (-2332.538) * [-2326.675] (-2331.569) (-2341.900) (-2331.370) -- 0:03:39 234500 -- (-2330.843) (-2347.543) (-2331.191) [-2330.074] * [-2331.023] (-2333.413) (-2332.328) (-2332.483) -- 0:03:38 235000 -- (-2337.076) [-2333.675] (-2327.940) (-2340.777) * (-2328.073) (-2332.065) [-2330.598] (-2331.925) -- 0:03:41 Average standard deviation of split frequencies: 0.001332 235500 -- [-2336.951] (-2338.072) (-2335.012) (-2335.031) * [-2330.814] (-2327.132) (-2333.870) (-2332.118) -- 0:03:40 236000 -- [-2332.046] (-2333.940) (-2331.550) (-2328.977) * (-2335.390) [-2327.456] (-2333.774) (-2343.575) -- 0:03:40 236500 -- (-2337.847) [-2336.451] (-2327.549) (-2336.947) * (-2335.504) (-2331.992) [-2335.811] (-2337.207) -- 0:03:39 237000 -- (-2329.213) [-2332.723] (-2331.106) (-2329.264) * (-2339.418) (-2334.665) (-2334.202) [-2336.174] -- 0:03:38 237500 -- (-2329.849) (-2329.121) [-2331.072] (-2337.017) * [-2330.463] (-2330.408) (-2340.185) (-2331.933) -- 0:03:38 238000 -- [-2336.391] (-2334.193) (-2337.930) (-2332.883) * (-2335.180) [-2336.502] (-2331.010) (-2331.517) -- 0:03:37 238500 -- (-2336.834) (-2329.591) (-2339.593) [-2328.742] * (-2336.491) [-2331.820] (-2336.273) (-2332.518) -- 0:03:40 239000 -- (-2334.474) [-2329.778] (-2337.857) (-2333.284) * [-2327.313] (-2332.691) (-2332.225) (-2338.203) -- 0:03:39 239500 -- (-2352.431) [-2335.882] (-2340.347) (-2328.249) * [-2334.772] (-2335.241) (-2330.121) (-2332.775) -- 0:03:39 240000 -- (-2333.618) (-2333.831) (-2337.426) [-2327.892] * (-2338.077) [-2333.707] (-2334.925) (-2333.060) -- 0:03:38 Average standard deviation of split frequencies: 0.001306 240500 -- (-2332.983) (-2328.831) (-2334.881) [-2326.389] * (-2333.141) [-2331.165] (-2342.362) (-2333.068) -- 0:03:37 241000 -- [-2334.394] (-2328.867) (-2342.074) (-2341.099) * (-2334.267) (-2331.742) [-2332.871] (-2336.877) -- 0:03:37 241500 -- [-2328.334] (-2335.448) (-2331.605) (-2329.874) * (-2330.640) (-2331.247) [-2329.096] (-2328.403) -- 0:03:36 242000 -- (-2332.949) [-2333.446] (-2335.847) (-2330.941) * [-2332.195] (-2334.839) (-2330.737) (-2336.483) -- 0:03:39 242500 -- [-2333.110] (-2330.621) (-2330.829) (-2329.645) * (-2329.762) (-2330.474) (-2333.078) [-2329.807] -- 0:03:38 243000 -- [-2330.921] (-2332.781) (-2331.233) (-2331.906) * (-2331.930) (-2330.829) (-2337.186) [-2334.973] -- 0:03:38 243500 -- (-2331.216) (-2329.393) (-2328.087) [-2326.577] * (-2333.381) (-2335.832) (-2333.242) [-2328.919] -- 0:03:37 244000 -- (-2338.095) [-2333.188] (-2329.144) (-2336.512) * (-2330.169) (-2331.413) (-2330.045) [-2328.799] -- 0:03:36 244500 -- (-2344.444) [-2334.265] (-2329.409) (-2327.861) * (-2334.463) [-2331.110] (-2332.524) (-2326.716) -- 0:03:36 245000 -- (-2338.944) [-2336.030] (-2335.083) (-2338.053) * (-2344.772) (-2332.476) (-2331.909) [-2333.052] -- 0:03:35 Average standard deviation of split frequencies: 0.001278 245500 -- (-2336.651) (-2333.343) [-2333.205] (-2333.472) * (-2333.046) (-2335.144) (-2331.679) [-2327.758] -- 0:03:38 246000 -- (-2338.166) (-2331.263) (-2335.108) [-2344.055] * (-2335.840) [-2333.315] (-2333.575) (-2336.208) -- 0:03:37 246500 -- (-2335.460) [-2332.686] (-2334.241) (-2335.668) * (-2331.114) (-2332.314) [-2333.856] (-2333.710) -- 0:03:37 247000 -- (-2329.053) (-2336.869) [-2338.815] (-2327.287) * (-2329.210) (-2330.440) [-2327.635] (-2330.662) -- 0:03:36 247500 -- (-2334.153) [-2334.896] (-2331.695) (-2330.560) * (-2335.193) (-2344.155) [-2337.625] (-2335.560) -- 0:03:35 248000 -- (-2329.937) (-2333.938) [-2330.661] (-2334.358) * (-2338.289) (-2340.781) [-2327.967] (-2336.803) -- 0:03:35 248500 -- (-2331.896) (-2335.857) [-2332.120] (-2328.274) * [-2329.391] (-2329.379) (-2328.510) (-2339.433) -- 0:03:34 249000 -- (-2335.242) (-2329.447) (-2334.562) [-2333.959] * [-2334.731] (-2326.393) (-2337.388) (-2330.585) -- 0:03:37 249500 -- (-2336.231) (-2332.754) (-2333.728) [-2332.886] * (-2329.754) (-2338.207) [-2331.493] (-2331.458) -- 0:03:36 250000 -- (-2332.012) (-2336.069) [-2334.393] (-2338.005) * (-2335.141) (-2332.767) (-2336.903) [-2332.322] -- 0:03:36 Average standard deviation of split frequencies: 0.001881 250500 -- [-2330.040] (-2338.206) (-2337.702) (-2334.684) * [-2329.248] (-2342.372) (-2334.926) (-2331.705) -- 0:03:35 251000 -- (-2335.798) [-2334.227] (-2337.343) (-2333.767) * [-2334.660] (-2344.722) (-2330.062) (-2337.010) -- 0:03:34 251500 -- [-2332.368] (-2327.209) (-2339.678) (-2332.949) * (-2336.390) (-2346.756) [-2332.006] (-2330.354) -- 0:03:34 252000 -- (-2334.432) (-2335.802) (-2331.253) [-2332.234] * (-2339.397) (-2342.175) (-2330.926) [-2327.501] -- 0:03:33 252500 -- [-2334.797] (-2329.160) (-2334.361) (-2336.829) * (-2335.732) (-2334.638) [-2334.503] (-2341.540) -- 0:03:36 253000 -- (-2334.856) (-2330.636) (-2334.095) [-2334.273] * [-2335.413] (-2335.871) (-2339.534) (-2331.526) -- 0:03:35 253500 -- (-2333.997) [-2329.837] (-2344.804) (-2339.389) * (-2330.879) (-2334.754) (-2328.339) [-2337.177] -- 0:03:34 254000 -- [-2336.831] (-2334.570) (-2342.072) (-2344.282) * (-2329.619) (-2336.184) [-2329.433] (-2334.638) -- 0:03:34 254500 -- (-2335.795) [-2332.168] (-2336.183) (-2326.912) * [-2337.512] (-2327.460) (-2333.695) (-2336.743) -- 0:03:33 255000 -- [-2326.540] (-2330.852) (-2340.542) (-2330.416) * (-2335.024) (-2336.214) [-2333.629] (-2336.893) -- 0:03:33 Average standard deviation of split frequencies: 0.001841 255500 -- (-2342.757) (-2332.659) (-2342.586) [-2333.703] * [-2336.998] (-2334.054) (-2329.556) (-2336.919) -- 0:03:32 256000 -- (-2337.061) [-2333.530] (-2333.681) (-2333.698) * (-2334.324) (-2335.719) (-2337.621) [-2336.190] -- 0:03:35 256500 -- (-2332.154) [-2332.532] (-2325.750) (-2325.311) * (-2334.084) (-2338.233) (-2328.832) [-2337.430] -- 0:03:34 257000 -- (-2339.428) (-2337.078) (-2328.906) [-2332.885] * (-2335.147) (-2330.142) [-2332.027] (-2332.023) -- 0:03:33 257500 -- (-2330.785) (-2334.009) (-2331.017) [-2332.129] * (-2328.071) (-2330.869) (-2339.677) [-2332.144] -- 0:03:33 258000 -- (-2329.471) [-2331.642] (-2332.035) (-2341.627) * [-2335.348] (-2334.647) (-2340.790) (-2336.050) -- 0:03:32 258500 -- [-2331.821] (-2330.370) (-2335.896) (-2332.197) * (-2337.699) (-2335.616) [-2331.451] (-2333.890) -- 0:03:32 259000 -- (-2333.274) (-2331.998) (-2344.110) [-2333.247] * (-2332.608) (-2339.796) [-2333.722] (-2334.084) -- 0:03:31 259500 -- [-2329.281] (-2336.088) (-2331.667) (-2335.678) * [-2333.308] (-2328.544) (-2332.264) (-2349.176) -- 0:03:34 260000 -- (-2331.480) (-2333.065) [-2324.225] (-2326.273) * [-2335.874] (-2336.416) (-2331.234) (-2334.439) -- 0:03:33 Average standard deviation of split frequencies: 0.001808 260500 -- [-2329.096] (-2330.881) (-2331.440) (-2329.928) * (-2333.509) (-2348.216) (-2328.940) [-2329.768] -- 0:03:32 261000 -- (-2334.028) (-2337.197) [-2332.757] (-2332.000) * (-2330.273) (-2338.916) [-2335.247] (-2333.687) -- 0:03:32 261500 -- [-2332.053] (-2332.800) (-2330.175) (-2338.004) * (-2334.062) (-2334.502) [-2328.910] (-2338.114) -- 0:03:31 262000 -- (-2337.388) (-2333.248) [-2332.189] (-2334.314) * (-2336.289) [-2331.447] (-2334.971) (-2334.012) -- 0:03:31 262500 -- (-2338.937) (-2332.936) [-2335.013] (-2342.676) * [-2333.583] (-2329.924) (-2341.686) (-2340.731) -- 0:03:33 263000 -- (-2340.272) (-2333.096) (-2330.980) [-2331.487] * [-2335.466] (-2346.844) (-2334.669) (-2335.222) -- 0:03:32 263500 -- (-2339.425) (-2343.635) (-2333.953) [-2329.249] * (-2330.268) (-2338.368) (-2331.949) [-2330.213] -- 0:03:32 264000 -- (-2335.532) [-2333.712] (-2335.901) (-2332.718) * (-2334.376) (-2337.215) (-2338.407) [-2325.797] -- 0:03:31 264500 -- [-2334.715] (-2327.889) (-2332.512) (-2331.020) * [-2331.235] (-2329.341) (-2333.687) (-2329.405) -- 0:03:31 265000 -- (-2343.593) [-2335.206] (-2332.822) (-2340.158) * (-2334.502) (-2333.815) [-2332.393] (-2332.685) -- 0:03:30 Average standard deviation of split frequencies: 0.001181 265500 -- (-2342.410) (-2335.685) (-2335.219) [-2335.867] * (-2334.517) (-2331.390) (-2334.333) [-2330.885] -- 0:03:30 266000 -- (-2341.104) [-2332.117] (-2335.158) (-2330.366) * [-2337.135] (-2330.909) (-2334.067) (-2333.601) -- 0:03:32 266500 -- (-2335.468) (-2333.855) [-2339.990] (-2326.627) * (-2333.072) (-2346.759) (-2333.851) [-2329.496] -- 0:03:31 267000 -- (-2331.588) (-2330.845) [-2332.528] (-2334.354) * (-2340.005) [-2329.875] (-2329.065) (-2330.754) -- 0:03:31 267500 -- (-2333.416) (-2332.655) (-2329.807) [-2330.270] * (-2328.445) (-2336.657) [-2328.509] (-2335.307) -- 0:03:30 268000 -- (-2333.261) (-2335.294) (-2334.835) [-2330.203] * [-2337.215] (-2333.294) (-2333.184) (-2333.953) -- 0:03:30 268500 -- (-2335.666) (-2334.705) [-2332.542] (-2332.516) * (-2342.713) (-2332.590) [-2328.945] (-2333.488) -- 0:03:29 269000 -- (-2333.800) (-2334.101) [-2328.399] (-2334.432) * [-2332.606] (-2326.554) (-2331.195) (-2333.135) -- 0:03:29 269500 -- (-2327.046) [-2336.088] (-2327.989) (-2327.061) * [-2331.024] (-2334.116) (-2327.577) (-2339.444) -- 0:03:31 270000 -- (-2328.989) (-2336.276) (-2328.834) [-2328.283] * [-2328.980] (-2334.305) (-2337.448) (-2339.588) -- 0:03:30 Average standard deviation of split frequencies: 0.000581 270500 -- [-2328.184] (-2334.480) (-2328.134) (-2334.262) * (-2335.418) (-2331.403) [-2335.052] (-2339.210) -- 0:03:30 271000 -- [-2338.251] (-2328.757) (-2332.189) (-2334.303) * (-2338.787) [-2333.125] (-2330.883) (-2331.994) -- 0:03:29 271500 -- (-2331.999) [-2328.673] (-2333.284) (-2332.766) * (-2334.191) (-2328.867) [-2326.981] (-2329.433) -- 0:03:29 272000 -- (-2333.201) [-2329.819] (-2330.591) (-2337.164) * (-2329.582) (-2331.039) [-2333.351] (-2331.283) -- 0:03:28 272500 -- (-2337.675) (-2346.991) (-2335.418) [-2337.532] * (-2328.760) (-2335.302) [-2329.702] (-2338.506) -- 0:03:28 273000 -- (-2334.014) (-2340.494) (-2333.784) [-2338.850] * (-2330.202) (-2335.505) [-2331.195] (-2334.352) -- 0:03:30 273500 -- (-2336.207) (-2339.945) [-2330.736] (-2331.311) * [-2330.403] (-2330.609) (-2329.518) (-2329.788) -- 0:03:29 274000 -- [-2335.045] (-2333.863) (-2333.739) (-2333.672) * (-2333.468) [-2333.128] (-2335.705) (-2330.366) -- 0:03:29 274500 -- (-2340.499) (-2337.155) (-2331.264) [-2331.664] * (-2327.756) [-2333.142] (-2326.928) (-2332.361) -- 0:03:28 275000 -- (-2339.162) (-2334.936) (-2332.724) [-2338.990] * (-2340.468) (-2333.705) (-2331.243) [-2339.705] -- 0:03:28 Average standard deviation of split frequencies: 0.001139 275500 -- (-2347.298) (-2334.783) [-2329.076] (-2335.209) * (-2331.395) (-2331.587) [-2329.847] (-2333.345) -- 0:03:27 276000 -- (-2338.697) (-2331.448) [-2329.774] (-2335.319) * (-2336.075) (-2335.676) (-2332.965) [-2332.855] -- 0:03:27 276500 -- (-2330.540) [-2334.283] (-2335.649) (-2337.042) * (-2338.334) [-2334.106] (-2341.203) (-2327.902) -- 0:03:29 277000 -- (-2336.894) [-2337.156] (-2343.486) (-2329.458) * (-2345.774) (-2329.007) (-2339.043) [-2335.981] -- 0:03:28 277500 -- (-2333.949) [-2341.390] (-2338.604) (-2332.083) * (-2334.523) (-2330.117) (-2330.837) [-2337.788] -- 0:03:28 278000 -- [-2330.295] (-2327.428) (-2333.416) (-2331.851) * (-2337.036) (-2336.313) (-2334.522) [-2333.335] -- 0:03:27 278500 -- (-2336.826) (-2330.687) (-2335.189) [-2331.333] * (-2332.720) [-2339.448] (-2331.486) (-2330.646) -- 0:03:27 279000 -- (-2331.435) (-2335.973) [-2333.081] (-2332.895) * (-2336.486) (-2332.878) (-2335.018) [-2331.151] -- 0:03:26 279500 -- (-2335.475) (-2333.037) [-2329.676] (-2335.384) * [-2329.640] (-2337.539) (-2333.457) (-2330.288) -- 0:03:26 280000 -- (-2334.445) (-2336.720) [-2328.071] (-2335.378) * (-2346.658) (-2335.104) (-2340.365) [-2331.515] -- 0:03:28 Average standard deviation of split frequencies: 0.001680 280500 -- (-2329.259) (-2330.980) (-2332.381) [-2332.995] * (-2329.590) (-2334.432) (-2340.704) [-2331.450] -- 0:03:27 281000 -- (-2334.023) (-2331.125) (-2328.113) [-2330.865] * (-2327.906) (-2334.713) (-2334.370) [-2333.189] -- 0:03:27 281500 -- (-2327.237) (-2333.768) [-2330.120] (-2332.477) * [-2335.087] (-2334.623) (-2337.400) (-2330.704) -- 0:03:26 282000 -- (-2332.949) (-2336.055) [-2335.042] (-2333.802) * [-2331.827] (-2334.692) (-2333.128) (-2336.470) -- 0:03:26 282500 -- (-2332.339) [-2340.832] (-2333.912) (-2337.922) * (-2333.305) [-2331.129] (-2334.374) (-2337.889) -- 0:03:25 283000 -- [-2334.141] (-2334.442) (-2336.899) (-2331.653) * (-2331.933) (-2330.073) (-2331.772) [-2337.243] -- 0:03:25 283500 -- (-2330.370) [-2333.676] (-2337.492) (-2337.188) * (-2338.739) [-2330.735] (-2343.780) (-2334.701) -- 0:03:27 284000 -- (-2339.177) [-2332.011] (-2333.253) (-2330.191) * (-2336.744) [-2337.080] (-2338.283) (-2333.242) -- 0:03:26 284500 -- (-2337.990) (-2329.834) (-2342.383) [-2329.582] * (-2333.678) (-2332.405) (-2334.009) [-2332.041] -- 0:03:26 285000 -- (-2334.112) (-2332.866) [-2329.012] (-2330.516) * (-2339.424) (-2348.925) (-2337.256) [-2335.662] -- 0:03:25 Average standard deviation of split frequencies: 0.001648 285500 -- [-2333.171] (-2335.996) (-2337.179) (-2331.034) * (-2341.637) [-2329.340] (-2331.986) (-2332.166) -- 0:03:25 286000 -- (-2341.628) [-2337.802] (-2333.018) (-2329.310) * [-2329.340] (-2337.206) (-2330.747) (-2333.792) -- 0:03:24 286500 -- (-2344.727) (-2332.655) [-2330.792] (-2329.545) * (-2335.839) [-2337.273] (-2334.293) (-2338.053) -- 0:03:24 287000 -- (-2329.519) (-2333.947) [-2331.241] (-2329.459) * (-2334.204) (-2333.696) [-2333.444] (-2332.169) -- 0:03:26 287500 -- (-2328.265) [-2332.331] (-2339.101) (-2340.849) * (-2341.870) (-2330.890) [-2333.930] (-2331.671) -- 0:03:25 288000 -- (-2330.016) (-2338.146) (-2332.270) [-2331.189] * [-2331.325] (-2328.126) (-2340.670) (-2337.795) -- 0:03:25 288500 -- (-2331.652) [-2333.091] (-2334.530) (-2333.525) * (-2331.243) (-2334.458) (-2341.449) [-2334.743] -- 0:03:24 289000 -- [-2330.679] (-2337.382) (-2330.673) (-2343.388) * (-2329.089) [-2331.364] (-2335.216) (-2333.942) -- 0:03:24 289500 -- [-2329.129] (-2334.157) (-2328.410) (-2329.416) * [-2334.333] (-2331.049) (-2335.310) (-2331.001) -- 0:03:23 290000 -- (-2330.367) [-2333.338] (-2332.934) (-2334.118) * (-2336.248) [-2331.147] (-2333.796) (-2336.229) -- 0:03:23 Average standard deviation of split frequencies: 0.002703 290500 -- (-2336.088) (-2334.204) [-2339.319] (-2330.030) * (-2334.185) [-2330.803] (-2329.187) (-2327.267) -- 0:03:25 291000 -- (-2330.144) [-2330.406] (-2337.004) (-2332.906) * [-2332.747] (-2326.208) (-2343.581) (-2336.065) -- 0:03:24 291500 -- (-2334.826) (-2335.918) (-2333.802) [-2329.814] * (-2333.142) [-2327.117] (-2331.047) (-2333.008) -- 0:03:24 292000 -- [-2335.548] (-2338.846) (-2331.487) (-2329.503) * [-2329.597] (-2337.243) (-2333.057) (-2341.680) -- 0:03:23 292500 -- [-2333.796] (-2333.576) (-2336.411) (-2334.659) * (-2333.613) (-2332.657) [-2332.929] (-2336.166) -- 0:03:23 293000 -- (-2328.621) (-2329.407) (-2331.701) [-2336.968] * (-2330.178) [-2328.162] (-2333.456) (-2335.880) -- 0:03:22 293500 -- (-2334.044) (-2338.892) [-2330.356] (-2334.806) * [-2330.072] (-2332.324) (-2332.109) (-2332.252) -- 0:03:22 294000 -- (-2335.529) (-2335.043) (-2341.826) [-2334.918] * (-2331.912) (-2333.076) [-2332.276] (-2331.499) -- 0:03:24 294500 -- (-2328.142) [-2340.066] (-2332.613) (-2333.292) * [-2337.130] (-2340.569) (-2326.802) (-2340.943) -- 0:03:23 295000 -- (-2337.227) [-2332.258] (-2332.062) (-2332.792) * (-2336.925) (-2331.832) (-2337.799) [-2337.457] -- 0:03:23 Average standard deviation of split frequencies: 0.002654 295500 -- (-2330.700) [-2334.704] (-2337.969) (-2334.039) * (-2330.179) [-2327.968] (-2339.471) (-2330.803) -- 0:03:22 296000 -- [-2331.104] (-2334.897) (-2329.626) (-2336.147) * (-2339.018) [-2327.616] (-2329.608) (-2334.683) -- 0:03:22 296500 -- (-2338.211) (-2327.432) (-2333.729) [-2331.880] * [-2330.044] (-2337.563) (-2327.143) (-2333.115) -- 0:03:21 297000 -- (-2339.409) (-2344.271) (-2330.976) [-2330.204] * (-2338.996) (-2331.592) [-2328.193] (-2333.077) -- 0:03:21 297500 -- (-2333.422) (-2331.808) [-2332.139] (-2334.919) * [-2332.659] (-2331.503) (-2331.387) (-2334.329) -- 0:03:23 298000 -- (-2336.114) (-2335.947) (-2332.115) [-2330.111] * (-2336.862) (-2338.096) [-2332.301] (-2332.674) -- 0:03:22 298500 -- (-2331.861) [-2329.440] (-2335.905) (-2333.003) * (-2334.751) [-2341.439] (-2334.420) (-2332.313) -- 0:03:22 299000 -- (-2330.917) (-2337.930) [-2328.998] (-2337.834) * [-2334.489] (-2331.933) (-2339.425) (-2331.461) -- 0:03:21 299500 -- (-2330.726) [-2339.621] (-2334.964) (-2333.884) * [-2331.880] (-2338.310) (-2337.448) (-2331.871) -- 0:03:21 300000 -- (-2333.603) (-2335.426) [-2338.069] (-2337.465) * (-2342.070) [-2333.265] (-2330.185) (-2332.186) -- 0:03:20 Average standard deviation of split frequencies: 0.001568 300500 -- (-2329.973) [-2332.768] (-2331.004) (-2343.491) * (-2340.571) (-2330.695) (-2332.909) [-2328.525] -- 0:03:20 301000 -- (-2334.027) (-2334.668) [-2330.263] (-2333.382) * (-2328.853) [-2331.731] (-2334.758) (-2329.193) -- 0:03:22 301500 -- (-2338.696) [-2328.979] (-2332.087) (-2334.272) * (-2339.339) (-2333.064) [-2330.550] (-2332.192) -- 0:03:21 302000 -- [-2330.234] (-2330.132) (-2336.271) (-2333.768) * (-2335.321) [-2332.085] (-2335.731) (-2329.663) -- 0:03:21 302500 -- (-2328.485) (-2335.067) [-2333.965] (-2336.640) * [-2330.639] (-2333.346) (-2338.409) (-2334.662) -- 0:03:20 303000 -- [-2340.893] (-2334.637) (-2338.601) (-2339.805) * (-2332.657) (-2336.913) [-2327.955] (-2335.921) -- 0:03:20 303500 -- (-2338.282) [-2332.138] (-2335.378) (-2339.079) * (-2332.059) [-2332.138] (-2330.932) (-2339.407) -- 0:03:19 304000 -- (-2333.747) [-2333.935] (-2331.811) (-2338.895) * (-2334.641) (-2334.142) [-2329.672] (-2332.960) -- 0:03:19 304500 -- (-2328.944) [-2334.663] (-2331.609) (-2336.320) * (-2334.952) (-2336.543) [-2330.731] (-2333.578) -- 0:03:20 305000 -- [-2335.911] (-2331.464) (-2331.457) (-2333.656) * (-2333.589) [-2337.861] (-2337.155) (-2338.896) -- 0:03:20 Average standard deviation of split frequencies: 0.001541 305500 -- (-2337.258) [-2328.223] (-2341.123) (-2336.867) * [-2334.239] (-2333.496) (-2331.785) (-2333.624) -- 0:03:20 306000 -- (-2338.189) [-2334.009] (-2332.555) (-2337.235) * (-2334.519) [-2337.565] (-2332.929) (-2335.071) -- 0:03:19 306500 -- (-2339.586) (-2332.284) (-2332.581) [-2334.035] * (-2336.921) (-2332.781) [-2330.385] (-2332.775) -- 0:03:19 307000 -- (-2336.287) [-2326.661] (-2327.109) (-2333.483) * (-2335.234) (-2335.903) [-2331.156] (-2337.079) -- 0:03:18 307500 -- (-2327.173) (-2330.430) [-2330.076] (-2345.559) * (-2340.445) [-2330.400] (-2330.494) (-2332.725) -- 0:03:18 308000 -- (-2333.788) [-2343.106] (-2328.286) (-2332.261) * (-2340.750) [-2328.912] (-2336.637) (-2337.485) -- 0:03:19 308500 -- [-2334.019] (-2339.995) (-2327.305) (-2342.812) * (-2332.329) (-2336.349) [-2334.072] (-2343.140) -- 0:03:19 309000 -- (-2327.658) (-2336.543) [-2329.851] (-2330.878) * [-2327.543] (-2335.737) (-2334.906) (-2333.380) -- 0:03:19 309500 -- [-2332.098] (-2328.373) (-2338.029) (-2327.035) * [-2329.885] (-2337.437) (-2338.567) (-2331.243) -- 0:03:18 310000 -- (-2334.842) (-2336.242) [-2333.036] (-2334.216) * (-2334.903) (-2332.301) (-2342.354) [-2329.232] -- 0:03:18 Average standard deviation of split frequencies: 0.001517 310500 -- [-2331.116] (-2334.710) (-2337.926) (-2339.140) * (-2336.489) [-2331.347] (-2336.092) (-2335.772) -- 0:03:17 311000 -- (-2332.059) (-2334.422) [-2334.045] (-2338.462) * (-2330.858) (-2332.796) [-2332.162] (-2335.476) -- 0:03:17 311500 -- (-2343.120) (-2328.206) (-2337.965) [-2328.064] * [-2331.163] (-2345.950) (-2328.897) (-2333.800) -- 0:03:18 312000 -- (-2335.217) (-2333.736) (-2339.258) [-2330.544] * (-2338.206) (-2326.665) (-2337.038) [-2331.977] -- 0:03:18 312500 -- (-2337.773) (-2332.143) [-2337.485] (-2342.079) * (-2335.131) (-2332.286) [-2332.857] (-2338.420) -- 0:03:18 313000 -- [-2335.770] (-2333.123) (-2331.401) (-2336.336) * (-2336.035) (-2330.288) (-2329.855) [-2340.895] -- 0:03:17 313500 -- [-2335.961] (-2332.390) (-2333.178) (-2333.441) * (-2330.004) [-2333.331] (-2335.554) (-2326.616) -- 0:03:17 314000 -- (-2330.242) (-2331.492) [-2333.146] (-2341.154) * (-2333.428) [-2326.579] (-2333.426) (-2331.299) -- 0:03:16 314500 -- (-2331.376) (-2336.480) [-2332.590] (-2335.636) * (-2338.936) [-2326.019] (-2334.672) (-2334.379) -- 0:03:16 315000 -- [-2328.912] (-2333.715) (-2333.727) (-2326.596) * (-2341.263) (-2335.747) (-2332.440) [-2337.597] -- 0:03:17 Average standard deviation of split frequencies: 0.000995 315500 -- (-2338.805) (-2336.411) [-2329.704] (-2334.296) * (-2332.016) [-2333.101] (-2330.472) (-2331.386) -- 0:03:17 316000 -- (-2331.333) [-2330.974] (-2331.636) (-2326.818) * (-2332.754) (-2332.797) [-2330.536] (-2335.269) -- 0:03:16 316500 -- (-2334.486) (-2327.963) [-2332.935] (-2332.706) * (-2331.579) [-2336.632] (-2333.479) (-2343.495) -- 0:03:16 317000 -- (-2333.553) [-2330.512] (-2333.439) (-2335.618) * (-2330.048) (-2337.820) (-2338.024) [-2340.479] -- 0:03:16 317500 -- (-2330.623) (-2342.978) [-2329.499] (-2333.193) * (-2325.959) [-2329.172] (-2332.006) (-2342.839) -- 0:03:15 318000 -- [-2334.325] (-2331.556) (-2328.952) (-2334.557) * (-2333.890) (-2327.585) [-2330.915] (-2332.205) -- 0:03:15 318500 -- (-2328.629) (-2334.569) (-2334.617) [-2330.365] * (-2336.905) (-2332.923) (-2334.488) [-2333.333] -- 0:03:16 319000 -- (-2334.168) [-2336.749] (-2332.524) (-2334.375) * (-2330.693) (-2331.524) [-2329.099] (-2340.083) -- 0:03:16 319500 -- (-2332.193) (-2328.578) (-2341.249) [-2327.199] * (-2329.060) [-2329.737] (-2335.031) (-2329.317) -- 0:03:15 320000 -- (-2331.964) (-2338.189) (-2335.268) [-2333.465] * (-2328.956) (-2340.779) [-2331.275] (-2337.986) -- 0:03:15 Average standard deviation of split frequencies: 0.001470 320500 -- [-2330.224] (-2329.994) (-2339.311) (-2331.845) * (-2338.868) (-2326.361) [-2331.377] (-2330.430) -- 0:03:15 321000 -- (-2338.849) (-2329.317) (-2339.033) [-2329.711] * (-2338.154) (-2329.882) (-2334.932) [-2329.537] -- 0:03:14 321500 -- [-2334.341] (-2331.450) (-2333.349) (-2336.002) * [-2335.332] (-2337.641) (-2333.808) (-2333.886) -- 0:03:14 322000 -- (-2331.211) (-2334.542) [-2335.276] (-2328.477) * (-2337.030) [-2340.396] (-2328.636) (-2332.024) -- 0:03:15 322500 -- (-2335.089) (-2330.301) [-2333.520] (-2337.355) * (-2335.909) (-2336.085) (-2339.009) [-2333.159] -- 0:03:15 323000 -- [-2327.700] (-2338.519) (-2334.884) (-2333.129) * (-2335.522) [-2333.202] (-2334.823) (-2332.824) -- 0:03:14 323500 -- (-2336.155) [-2329.920] (-2342.200) (-2328.469) * (-2334.497) [-2329.329] (-2326.992) (-2331.911) -- 0:03:14 324000 -- (-2330.652) (-2336.094) (-2329.744) [-2329.346] * (-2339.094) (-2333.900) [-2328.677] (-2342.296) -- 0:03:14 324500 -- (-2331.999) (-2332.226) [-2328.540] (-2336.117) * [-2337.099] (-2335.677) (-2334.680) (-2331.597) -- 0:03:13 325000 -- (-2332.055) [-2326.852] (-2331.256) (-2330.107) * (-2328.646) [-2333.391] (-2342.145) (-2328.830) -- 0:03:13 Average standard deviation of split frequencies: 0.001446 325500 -- (-2329.708) (-2328.561) (-2332.599) [-2334.269] * (-2334.128) (-2334.036) [-2336.450] (-2331.413) -- 0:03:14 326000 -- (-2327.558) (-2334.042) [-2332.562] (-2335.908) * (-2334.323) (-2333.323) (-2330.585) [-2331.019] -- 0:03:14 326500 -- (-2341.148) (-2334.778) (-2336.460) [-2331.691] * (-2330.589) (-2331.613) (-2325.472) [-2328.664] -- 0:03:13 327000 -- [-2331.999] (-2333.899) (-2329.912) (-2340.263) * [-2331.495] (-2337.834) (-2334.994) (-2338.489) -- 0:03:13 327500 -- (-2334.201) (-2335.712) [-2335.244] (-2337.466) * [-2336.284] (-2331.868) (-2332.124) (-2331.906) -- 0:03:13 328000 -- [-2331.749] (-2341.142) (-2328.689) (-2332.939) * [-2334.592] (-2338.343) (-2331.504) (-2331.955) -- 0:03:12 328500 -- (-2333.288) [-2339.143] (-2333.340) (-2334.266) * (-2335.783) (-2337.763) [-2339.548] (-2329.177) -- 0:03:12 329000 -- (-2344.351) (-2334.404) (-2334.027) [-2330.786] * (-2338.937) (-2335.050) (-2331.755) [-2335.973] -- 0:03:13 329500 -- [-2328.787] (-2332.362) (-2332.977) (-2332.948) * [-2340.398] (-2337.358) (-2330.058) (-2333.159) -- 0:03:13 330000 -- (-2332.800) [-2331.371] (-2328.052) (-2331.113) * (-2334.109) [-2335.851] (-2331.194) (-2331.575) -- 0:03:12 Average standard deviation of split frequencies: 0.000950 330500 -- (-2332.524) [-2332.692] (-2335.585) (-2338.998) * [-2328.577] (-2336.087) (-2332.803) (-2335.893) -- 0:03:12 331000 -- (-2330.826) (-2339.868) [-2331.167] (-2332.077) * [-2328.003] (-2336.629) (-2336.216) (-2336.159) -- 0:03:12 331500 -- [-2328.178] (-2341.955) (-2334.636) (-2329.275) * (-2339.757) [-2327.925] (-2333.123) (-2334.591) -- 0:03:11 332000 -- [-2331.690] (-2340.892) (-2332.119) (-2328.340) * [-2334.672] (-2336.628) (-2350.295) (-2336.079) -- 0:03:11 332500 -- [-2335.759] (-2329.937) (-2330.164) (-2332.497) * (-2329.444) (-2330.543) (-2331.012) [-2335.248] -- 0:03:12 333000 -- [-2330.031] (-2338.440) (-2329.209) (-2336.615) * (-2339.453) (-2326.023) [-2327.280] (-2339.034) -- 0:03:12 333500 -- (-2341.203) [-2333.640] (-2329.045) (-2332.592) * (-2338.119) [-2332.910] (-2334.327) (-2332.528) -- 0:03:11 334000 -- [-2329.704] (-2327.490) (-2335.099) (-2329.399) * (-2336.406) (-2333.792) [-2331.081] (-2334.663) -- 0:03:11 334500 -- [-2340.770] (-2330.192) (-2330.805) (-2333.089) * (-2328.065) (-2335.483) (-2325.861) [-2331.723] -- 0:03:10 335000 -- [-2338.176] (-2339.891) (-2339.147) (-2331.770) * (-2331.312) (-2333.867) [-2328.798] (-2334.092) -- 0:03:10 Average standard deviation of split frequencies: 0.000468 335500 -- (-2329.344) [-2334.077] (-2340.348) (-2341.028) * (-2324.798) (-2335.959) [-2329.887] (-2335.876) -- 0:03:10 336000 -- (-2328.711) (-2332.769) [-2329.124] (-2335.646) * [-2330.535] (-2335.537) (-2341.562) (-2338.910) -- 0:03:11 336500 -- (-2334.380) [-2332.762] (-2330.972) (-2332.289) * [-2333.097] (-2330.166) (-2334.902) (-2337.986) -- 0:03:11 337000 -- (-2338.121) (-2339.582) [-2331.871] (-2332.379) * [-2336.360] (-2337.715) (-2336.226) (-2331.151) -- 0:03:10 337500 -- (-2333.982) (-2343.641) (-2332.939) [-2328.661] * (-2338.807) (-2334.687) [-2326.465] (-2329.855) -- 0:03:10 338000 -- (-2331.461) (-2334.289) [-2336.139] (-2335.486) * (-2333.049) (-2331.629) (-2331.514) [-2330.513] -- 0:03:09 338500 -- (-2336.243) [-2332.071] (-2342.365) (-2336.015) * (-2340.079) (-2340.062) (-2329.540) [-2328.363] -- 0:03:09 339000 -- (-2331.044) (-2339.015) [-2332.371] (-2338.369) * (-2338.914) (-2331.231) (-2330.595) [-2330.421] -- 0:03:09 339500 -- (-2331.160) (-2336.142) [-2337.171] (-2338.531) * [-2335.463] (-2332.651) (-2339.604) (-2330.576) -- 0:03:10 340000 -- (-2330.987) [-2335.897] (-2335.813) (-2342.353) * (-2328.942) (-2337.437) (-2332.602) [-2333.072] -- 0:03:10 Average standard deviation of split frequencies: 0.000923 340500 -- (-2338.008) (-2333.486) [-2331.628] (-2332.739) * (-2339.219) [-2333.736] (-2329.471) (-2329.930) -- 0:03:09 341000 -- (-2334.021) (-2331.454) (-2332.983) [-2331.192] * [-2330.670] (-2332.987) (-2331.888) (-2337.535) -- 0:03:09 341500 -- (-2329.372) (-2337.106) [-2333.385] (-2335.110) * (-2335.307) [-2332.000] (-2334.676) (-2329.512) -- 0:03:08 342000 -- (-2340.386) (-2334.819) (-2331.369) [-2333.312] * (-2331.728) [-2331.942] (-2335.485) (-2339.742) -- 0:03:08 342500 -- (-2336.988) (-2337.471) [-2332.377] (-2331.038) * [-2333.858] (-2335.631) (-2336.730) (-2330.574) -- 0:03:08 343000 -- (-2328.982) (-2344.659) (-2328.288) [-2333.729] * (-2332.152) [-2331.201] (-2332.968) (-2334.418) -- 0:03:09 343500 -- (-2336.107) (-2331.569) (-2330.500) [-2334.566] * [-2327.266] (-2331.777) (-2340.522) (-2328.783) -- 0:03:09 344000 -- [-2331.617] (-2336.428) (-2335.830) (-2335.321) * (-2324.457) (-2330.812) (-2335.941) [-2327.989] -- 0:03:08 344500 -- (-2337.299) [-2328.415] (-2329.870) (-2336.498) * [-2338.352] (-2332.529) (-2335.779) (-2342.680) -- 0:03:08 345000 -- (-2332.999) [-2332.737] (-2334.995) (-2338.326) * (-2330.744) (-2334.181) [-2339.545] (-2334.625) -- 0:03:07 Average standard deviation of split frequencies: 0.000454 345500 -- (-2326.632) (-2336.256) [-2329.654] (-2332.429) * (-2336.259) [-2328.177] (-2337.482) (-2331.199) -- 0:03:07 346000 -- (-2327.772) (-2334.074) (-2333.621) [-2331.082] * (-2328.314) (-2335.576) [-2331.645] (-2335.549) -- 0:03:07 346500 -- [-2333.837] (-2333.898) (-2336.434) (-2339.973) * [-2330.803] (-2329.574) (-2328.436) (-2333.430) -- 0:03:08 347000 -- [-2332.635] (-2337.592) (-2333.204) (-2340.696) * [-2330.155] (-2333.244) (-2336.531) (-2332.226) -- 0:03:08 347500 -- (-2335.449) [-2335.740] (-2339.821) (-2332.446) * (-2332.944) (-2335.957) (-2338.152) [-2334.358] -- 0:03:07 348000 -- (-2340.823) (-2336.612) (-2331.669) [-2337.129] * (-2334.142) [-2332.795] (-2336.330) (-2335.593) -- 0:03:07 348500 -- (-2330.102) (-2337.084) (-2343.001) [-2329.560] * (-2331.711) [-2330.909] (-2333.051) (-2330.790) -- 0:03:06 349000 -- (-2339.824) (-2333.889) [-2337.326] (-2328.499) * [-2334.491] (-2335.128) (-2338.217) (-2335.158) -- 0:03:06 349500 -- (-2338.402) (-2340.259) (-2332.846) [-2332.664] * [-2329.331] (-2334.501) (-2333.868) (-2333.113) -- 0:03:06 350000 -- [-2337.927] (-2338.510) (-2335.466) (-2330.891) * [-2330.912] (-2334.352) (-2330.784) (-2333.229) -- 0:03:07 Average standard deviation of split frequencies: 0.000000 350500 -- (-2336.124) (-2335.224) [-2330.924] (-2331.808) * (-2334.467) (-2338.340) (-2329.235) [-2330.102] -- 0:03:07 351000 -- (-2334.716) (-2343.122) [-2329.577] (-2344.321) * (-2337.864) (-2336.167) (-2329.520) [-2335.014] -- 0:03:06 351500 -- (-2330.344) (-2334.359) [-2331.010] (-2341.390) * [-2332.979] (-2332.166) (-2334.818) (-2338.716) -- 0:03:06 352000 -- (-2330.306) (-2334.210) (-2332.848) [-2332.555] * (-2337.371) [-2331.391] (-2329.475) (-2348.026) -- 0:03:05 352500 -- (-2333.814) (-2341.966) (-2334.226) [-2330.063] * [-2327.832] (-2329.495) (-2332.652) (-2331.044) -- 0:03:05 353000 -- [-2335.701] (-2334.439) (-2327.455) (-2335.207) * (-2334.545) (-2329.629) (-2334.671) [-2330.105] -- 0:03:05 353500 -- [-2331.638] (-2340.284) (-2337.275) (-2334.188) * (-2333.775) (-2331.761) [-2337.910] (-2335.369) -- 0:03:06 354000 -- (-2333.331) (-2336.827) [-2336.391] (-2330.120) * (-2334.490) (-2337.314) (-2331.673) [-2329.779] -- 0:03:06 354500 -- (-2333.427) (-2332.931) (-2340.889) [-2332.585] * [-2333.518] (-2329.874) (-2330.082) (-2343.230) -- 0:03:05 355000 -- (-2331.395) (-2331.797) [-2333.390] (-2331.512) * (-2328.910) (-2328.414) (-2328.841) [-2335.839] -- 0:03:05 Average standard deviation of split frequencies: 0.000000 355500 -- (-2338.630) [-2330.936] (-2330.512) (-2334.096) * [-2339.849] (-2337.784) (-2338.722) (-2343.723) -- 0:03:04 356000 -- (-2335.873) [-2331.957] (-2332.705) (-2338.219) * (-2332.036) [-2333.564] (-2337.196) (-2341.657) -- 0:03:04 356500 -- (-2335.670) (-2327.106) (-2329.093) [-2335.529] * [-2330.411] (-2333.660) (-2336.051) (-2342.273) -- 0:03:04 357000 -- (-2332.768) (-2334.810) (-2332.959) [-2331.606] * (-2333.411) (-2331.799) [-2333.118] (-2331.678) -- 0:03:03 357500 -- [-2335.410] (-2330.020) (-2330.155) (-2330.921) * (-2336.295) (-2327.555) (-2335.503) [-2333.053] -- 0:03:05 358000 -- (-2335.988) (-2333.199) (-2332.137) [-2330.138] * (-2329.520) [-2333.608] (-2336.029) (-2329.638) -- 0:03:04 358500 -- (-2335.340) (-2335.990) [-2333.309] (-2332.723) * (-2339.456) [-2331.164] (-2331.525) (-2332.728) -- 0:03:04 359000 -- (-2332.950) (-2335.514) (-2330.207) [-2337.249] * (-2331.235) (-2330.287) [-2338.951] (-2333.078) -- 0:03:03 359500 -- (-2332.620) [-2329.379] (-2332.977) (-2334.216) * [-2334.377] (-2333.967) (-2332.101) (-2339.313) -- 0:03:03 360000 -- (-2333.453) [-2329.857] (-2335.024) (-2335.720) * (-2330.802) (-2338.413) [-2330.487] (-2330.166) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 360500 -- (-2333.705) (-2336.318) [-2330.971] (-2334.166) * (-2327.903) [-2336.490] (-2338.678) (-2332.851) -- 0:03:02 361000 -- (-2338.660) (-2338.549) [-2335.982] (-2329.104) * (-2337.336) (-2339.274) (-2335.501) [-2327.394] -- 0:03:04 361500 -- [-2334.990] (-2344.928) (-2336.201) (-2328.937) * (-2335.025) (-2342.154) (-2338.792) [-2330.894] -- 0:03:03 362000 -- (-2335.592) (-2333.103) (-2336.585) [-2329.880] * (-2328.474) (-2337.594) (-2341.927) [-2332.586] -- 0:03:03 362500 -- (-2331.732) (-2339.362) (-2342.074) [-2332.921] * (-2330.313) (-2334.996) (-2335.937) [-2331.002] -- 0:03:02 363000 -- [-2332.659] (-2330.840) (-2334.873) (-2338.198) * (-2327.090) (-2332.060) (-2339.276) [-2331.312] -- 0:03:02 363500 -- (-2324.013) (-2330.807) [-2334.647] (-2332.398) * [-2331.334] (-2336.640) (-2337.240) (-2330.321) -- 0:03:02 364000 -- (-2330.087) (-2338.933) (-2333.534) [-2334.564] * [-2326.361] (-2340.309) (-2333.982) (-2330.144) -- 0:03:03 364500 -- [-2333.825] (-2333.601) (-2333.625) (-2327.596) * [-2332.910] (-2336.137) (-2333.882) (-2329.992) -- 0:03:03 365000 -- [-2334.186] (-2327.469) (-2327.836) (-2334.477) * (-2338.414) [-2327.351] (-2338.881) (-2332.310) -- 0:03:02 Average standard deviation of split frequencies: 0.000429 365500 -- (-2328.863) (-2329.623) (-2337.397) [-2329.264] * (-2338.843) [-2330.029] (-2333.377) (-2328.511) -- 0:03:02 366000 -- [-2332.507] (-2332.282) (-2337.040) (-2329.750) * (-2334.105) (-2328.754) (-2338.890) [-2331.129] -- 0:03:01 366500 -- (-2340.424) [-2329.743] (-2339.346) (-2337.525) * (-2329.366) [-2328.305] (-2342.412) (-2332.818) -- 0:03:01 367000 -- (-2343.653) (-2326.886) (-2340.148) [-2341.932] * (-2335.877) (-2334.571) [-2332.825] (-2327.972) -- 0:03:01 367500 -- (-2338.240) (-2332.307) (-2331.478) [-2339.149] * (-2329.806) [-2330.423] (-2338.619) (-2334.034) -- 0:03:00 368000 -- (-2337.479) (-2331.522) (-2338.571) [-2334.558] * (-2332.305) (-2332.247) (-2342.236) [-2332.492] -- 0:03:02 368500 -- (-2340.991) (-2329.348) (-2331.091) [-2331.865] * (-2331.771) (-2334.017) [-2338.068] (-2339.583) -- 0:03:01 369000 -- (-2340.175) (-2331.471) (-2333.209) [-2334.925] * (-2331.554) (-2337.591) [-2336.393] (-2330.853) -- 0:03:01 369500 -- (-2340.449) [-2330.983] (-2339.423) (-2341.816) * (-2346.813) (-2333.809) [-2337.720] (-2341.449) -- 0:03:00 370000 -- (-2334.589) (-2337.479) [-2332.678] (-2340.014) * (-2337.322) [-2334.350] (-2332.151) (-2339.942) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 370500 -- (-2341.699) [-2325.392] (-2332.857) (-2334.891) * (-2336.062) (-2336.647) (-2332.078) [-2336.756] -- 0:03:00 371000 -- (-2342.419) [-2331.004] (-2336.341) (-2334.203) * (-2336.524) (-2338.184) [-2332.451] (-2330.255) -- 0:02:59 371500 -- (-2339.708) (-2332.345) [-2335.749] (-2331.010) * (-2333.660) (-2333.452) (-2336.974) [-2332.815] -- 0:03:01 372000 -- [-2332.504] (-2337.977) (-2340.299) (-2339.268) * (-2334.400) (-2332.628) (-2334.242) [-2329.479] -- 0:03:00 372500 -- [-2328.305] (-2335.284) (-2337.840) (-2331.780) * [-2332.477] (-2328.667) (-2327.653) (-2332.928) -- 0:03:00 373000 -- [-2331.763] (-2336.850) (-2341.874) (-2333.968) * (-2340.127) (-2332.394) [-2332.618] (-2327.673) -- 0:02:59 373500 -- (-2342.844) [-2332.813] (-2335.731) (-2341.658) * (-2332.682) (-2328.558) [-2330.579] (-2338.902) -- 0:02:59 374000 -- (-2332.811) [-2327.931] (-2332.711) (-2336.987) * (-2329.192) [-2332.431] (-2327.697) (-2337.873) -- 0:02:59 374500 -- (-2337.760) (-2334.370) (-2334.996) [-2329.805] * (-2339.918) (-2329.466) [-2327.605] (-2333.587) -- 0:03:00 375000 -- (-2336.599) (-2338.789) (-2330.565) [-2328.925] * [-2333.244] (-2332.219) (-2332.304) (-2331.088) -- 0:03:00 Average standard deviation of split frequencies: 0.000418 375500 -- (-2326.727) [-2340.836] (-2333.601) (-2334.722) * [-2335.558] (-2330.908) (-2326.622) (-2338.890) -- 0:02:59 376000 -- (-2327.745) [-2329.597] (-2339.472) (-2336.413) * (-2328.818) [-2330.830] (-2330.664) (-2331.120) -- 0:02:59 376500 -- [-2334.035] (-2328.362) (-2330.385) (-2331.994) * (-2334.360) (-2332.686) (-2332.013) [-2329.483] -- 0:02:58 377000 -- (-2329.130) [-2333.614] (-2330.997) (-2343.406) * (-2333.608) (-2333.801) [-2333.001] (-2338.420) -- 0:02:58 377500 -- (-2331.046) (-2334.953) (-2329.553) [-2327.365] * [-2332.558] (-2345.191) (-2329.331) (-2336.567) -- 0:02:58 378000 -- (-2335.957) [-2337.673] (-2328.620) (-2327.468) * (-2329.772) (-2343.121) (-2342.159) [-2331.670] -- 0:02:57 378500 -- [-2328.008] (-2333.588) (-2337.352) (-2333.381) * (-2336.187) (-2333.345) [-2333.718] (-2330.773) -- 0:02:58 379000 -- [-2332.027] (-2336.104) (-2336.321) (-2328.193) * (-2345.853) (-2336.285) (-2331.017) [-2328.724] -- 0:02:58 379500 -- (-2338.236) (-2336.070) (-2332.192) [-2329.594] * (-2333.345) [-2333.218] (-2336.567) (-2331.096) -- 0:02:58 380000 -- (-2333.734) (-2338.569) (-2339.838) [-2334.260] * (-2329.305) (-2331.067) (-2327.571) [-2333.649] -- 0:02:57 Average standard deviation of split frequencies: 0.000413 380500 -- (-2334.965) (-2342.509) (-2336.112) [-2330.982] * (-2334.745) (-2336.418) (-2328.967) [-2328.839] -- 0:02:57 381000 -- [-2331.347] (-2330.386) (-2331.684) (-2343.133) * [-2335.321] (-2336.664) (-2333.163) (-2334.385) -- 0:02:57 381500 -- (-2331.691) (-2334.888) [-2331.770] (-2331.325) * (-2332.607) (-2341.760) (-2331.105) [-2338.394] -- 0:02:56 382000 -- (-2336.943) (-2331.182) [-2329.775] (-2329.376) * (-2333.946) (-2337.759) (-2330.501) [-2335.196] -- 0:02:57 382500 -- (-2339.065) [-2335.884] (-2334.542) (-2326.693) * (-2329.767) [-2329.214] (-2330.112) (-2334.454) -- 0:02:57 383000 -- (-2331.320) (-2333.315) (-2337.317) [-2332.594] * (-2329.891) [-2335.070] (-2332.026) (-2338.819) -- 0:02:57 383500 -- (-2336.902) [-2335.671] (-2331.281) (-2336.159) * (-2327.611) (-2336.217) [-2331.100] (-2330.421) -- 0:02:56 384000 -- [-2335.210] (-2337.685) (-2332.360) (-2333.829) * (-2329.306) (-2329.969) (-2334.078) [-2330.368] -- 0:02:56 384500 -- [-2333.931] (-2330.314) (-2329.522) (-2328.167) * (-2332.415) (-2329.332) (-2336.377) [-2331.811] -- 0:02:56 385000 -- (-2335.254) (-2341.032) (-2328.776) [-2330.805] * (-2333.791) [-2328.022] (-2332.355) (-2327.797) -- 0:02:55 Average standard deviation of split frequencies: 0.000407 385500 -- (-2338.054) (-2330.024) (-2335.009) [-2328.994] * (-2328.788) (-2338.923) [-2333.994] (-2334.515) -- 0:02:56 386000 -- (-2339.777) [-2337.375] (-2336.151) (-2325.961) * (-2329.167) (-2338.006) (-2334.447) [-2332.412] -- 0:02:56 386500 -- (-2335.790) [-2333.358] (-2332.696) (-2329.575) * (-2330.900) [-2332.789] (-2333.956) (-2332.462) -- 0:02:56 387000 -- [-2331.797] (-2330.215) (-2331.339) (-2329.032) * [-2328.901] (-2334.204) (-2336.414) (-2332.670) -- 0:02:55 387500 -- [-2334.869] (-2332.937) (-2332.394) (-2335.866) * (-2332.949) [-2333.634] (-2334.484) (-2330.409) -- 0:02:55 388000 -- (-2331.870) (-2333.569) (-2332.022) [-2334.531] * (-2334.064) (-2331.005) [-2335.961] (-2331.975) -- 0:02:55 388500 -- (-2326.536) (-2332.375) (-2337.760) [-2338.289] * (-2332.269) (-2331.421) (-2327.348) [-2327.854] -- 0:02:54 389000 -- (-2335.225) (-2334.812) (-2332.391) [-2330.469] * (-2333.258) (-2327.430) (-2331.927) [-2334.804] -- 0:02:55 389500 -- (-2329.556) (-2332.598) [-2335.302] (-2331.667) * [-2332.098] (-2334.639) (-2334.626) (-2340.379) -- 0:02:55 390000 -- (-2333.900) (-2329.333) [-2329.454] (-2336.531) * [-2328.693] (-2332.531) (-2331.805) (-2333.858) -- 0:02:55 Average standard deviation of split frequencies: 0.000402 390500 -- (-2330.444) (-2330.605) [-2329.802] (-2338.697) * (-2331.287) (-2335.397) [-2341.336] (-2340.975) -- 0:02:54 391000 -- [-2328.959] (-2332.740) (-2328.884) (-2331.569) * [-2331.606] (-2330.113) (-2335.497) (-2333.593) -- 0:02:54 391500 -- (-2334.327) [-2328.862] (-2331.153) (-2337.253) * [-2331.059] (-2339.326) (-2335.995) (-2329.798) -- 0:02:54 392000 -- [-2330.267] (-2333.833) (-2336.728) (-2336.079) * (-2333.738) (-2335.779) [-2334.303] (-2330.433) -- 0:02:53 392500 -- (-2334.007) (-2336.194) [-2331.194] (-2331.813) * [-2332.954] (-2341.479) (-2336.387) (-2334.222) -- 0:02:54 393000 -- (-2330.121) [-2329.028] (-2330.625) (-2328.321) * [-2329.781] (-2336.263) (-2333.861) (-2329.916) -- 0:02:54 393500 -- (-2336.265) (-2333.966) (-2330.860) [-2328.753] * (-2335.845) (-2335.747) [-2332.339] (-2332.646) -- 0:02:54 394000 -- (-2333.804) (-2339.115) (-2327.911) [-2330.915] * [-2334.313] (-2338.703) (-2336.341) (-2329.176) -- 0:02:53 394500 -- [-2341.420] (-2335.318) (-2331.224) (-2331.983) * [-2327.776] (-2333.765) (-2334.542) (-2340.708) -- 0:02:53 395000 -- (-2336.291) (-2331.502) (-2333.946) [-2331.406] * (-2335.803) (-2334.060) (-2329.518) [-2331.161] -- 0:02:53 Average standard deviation of split frequencies: 0.000794 395500 -- (-2337.791) (-2333.165) [-2329.183] (-2327.725) * (-2340.671) [-2330.857] (-2328.848) (-2333.612) -- 0:02:52 396000 -- (-2333.433) [-2334.288] (-2337.423) (-2328.165) * (-2332.934) [-2332.175] (-2332.640) (-2333.764) -- 0:02:53 396500 -- (-2342.095) (-2336.456) [-2333.012] (-2326.300) * (-2333.065) (-2335.600) [-2329.842] (-2344.597) -- 0:02:53 397000 -- (-2342.152) (-2338.003) (-2334.134) [-2334.163] * (-2333.822) (-2329.946) [-2333.180] (-2333.086) -- 0:02:53 397500 -- [-2337.259] (-2335.779) (-2340.962) (-2332.515) * (-2335.738) (-2332.080) (-2333.744) [-2337.892] -- 0:02:52 398000 -- [-2339.064] (-2337.228) (-2340.910) (-2347.660) * (-2336.608) (-2333.594) [-2333.452] (-2336.619) -- 0:02:52 398500 -- (-2347.280) (-2337.478) [-2332.701] (-2334.131) * [-2332.180] (-2331.505) (-2334.481) (-2338.063) -- 0:02:52 399000 -- (-2338.270) (-2335.734) (-2329.694) [-2336.647] * (-2333.830) (-2334.025) (-2334.969) [-2331.988] -- 0:02:51 399500 -- [-2339.773] (-2336.320) (-2338.332) (-2329.897) * (-2335.254) (-2335.665) (-2335.300) [-2335.481] -- 0:02:52 400000 -- (-2332.602) (-2328.757) (-2327.900) [-2326.750] * [-2332.441] (-2329.060) (-2334.260) (-2329.686) -- 0:02:52 Average standard deviation of split frequencies: 0.000784 400500 -- [-2336.604] (-2331.698) (-2335.798) (-2328.829) * (-2332.273) [-2334.708] (-2328.665) (-2335.582) -- 0:02:52 401000 -- (-2335.818) (-2330.266) [-2333.826] (-2328.763) * (-2329.242) (-2331.659) [-2327.375] (-2326.363) -- 0:02:51 401500 -- (-2335.977) [-2330.405] (-2328.283) (-2331.722) * (-2328.923) [-2336.893] (-2329.609) (-2330.877) -- 0:02:51 402000 -- (-2337.684) (-2332.742) [-2330.861] (-2336.428) * (-2330.999) [-2332.826] (-2334.549) (-2330.686) -- 0:02:51 402500 -- (-2333.531) [-2331.167] (-2338.800) (-2336.624) * (-2339.057) [-2338.791] (-2333.235) (-2330.186) -- 0:02:52 403000 -- (-2333.306) (-2325.416) (-2332.185) [-2330.668] * (-2325.874) (-2340.844) (-2335.407) [-2324.529] -- 0:02:51 403500 -- (-2327.293) [-2331.202] (-2339.011) (-2331.743) * (-2327.066) (-2341.250) [-2331.154] (-2328.069) -- 0:02:51 404000 -- (-2333.334) (-2329.034) (-2333.157) [-2331.207] * (-2326.951) (-2335.991) (-2332.537) [-2332.334] -- 0:02:51 404500 -- (-2327.867) (-2332.234) [-2330.183] (-2329.326) * [-2335.250] (-2332.724) (-2332.037) (-2329.770) -- 0:02:50 405000 -- (-2333.199) (-2327.100) (-2333.287) [-2328.673] * (-2331.861) (-2332.566) [-2331.937] (-2333.530) -- 0:02:50 Average standard deviation of split frequencies: 0.000774 405500 -- [-2329.397] (-2329.954) (-2328.829) (-2331.889) * [-2334.460] (-2332.734) (-2326.558) (-2335.226) -- 0:02:50 406000 -- [-2327.206] (-2332.800) (-2330.364) (-2332.773) * (-2329.547) (-2337.122) (-2330.040) [-2333.284] -- 0:02:51 406500 -- (-2336.636) [-2328.074] (-2329.993) (-2332.099) * (-2341.198) (-2333.200) [-2331.477] (-2341.027) -- 0:02:50 407000 -- (-2340.069) [-2330.252] (-2340.666) (-2326.465) * (-2334.332) (-2331.436) (-2335.307) [-2334.247] -- 0:02:50 407500 -- (-2339.780) [-2334.187] (-2341.016) (-2326.984) * (-2334.503) (-2333.065) [-2342.062] (-2332.260) -- 0:02:50 408000 -- (-2344.462) [-2336.077] (-2335.894) (-2335.495) * [-2331.914] (-2328.920) (-2337.234) (-2335.372) -- 0:02:49 408500 -- (-2333.098) (-2331.984) (-2330.539) [-2330.388] * (-2333.754) (-2334.361) (-2337.096) [-2332.709] -- 0:02:49 409000 -- (-2333.307) (-2338.912) [-2326.816] (-2329.580) * (-2335.339) [-2336.462] (-2336.871) (-2328.188) -- 0:02:49 409500 -- [-2326.813] (-2333.382) (-2332.329) (-2329.164) * (-2330.547) (-2325.602) (-2329.982) [-2329.309] -- 0:02:50 410000 -- (-2340.061) (-2335.375) [-2331.859] (-2335.293) * (-2327.891) (-2339.821) (-2335.656) [-2332.719] -- 0:02:49 Average standard deviation of split frequencies: 0.000383 410500 -- (-2333.785) [-2337.088] (-2329.820) (-2333.583) * (-2332.974) (-2332.371) (-2331.633) [-2330.982] -- 0:02:49 411000 -- [-2331.934] (-2330.773) (-2328.260) (-2336.187) * (-2326.440) (-2329.657) [-2336.985] (-2334.125) -- 0:02:49 411500 -- (-2331.981) (-2336.816) [-2335.443] (-2332.088) * (-2343.151) [-2336.007] (-2333.480) (-2328.620) -- 0:02:48 412000 -- (-2333.575) (-2333.551) (-2329.716) [-2329.706] * (-2337.690) (-2331.365) (-2336.015) [-2328.184] -- 0:02:48 412500 -- [-2328.595] (-2329.687) (-2338.449) (-2334.355) * (-2335.140) (-2332.847) [-2329.355] (-2337.550) -- 0:02:48 413000 -- (-2338.464) (-2336.081) [-2330.236] (-2333.985) * [-2330.281] (-2330.861) (-2331.724) (-2327.763) -- 0:02:49 413500 -- (-2333.201) [-2328.470] (-2334.520) (-2337.962) * [-2336.522] (-2337.437) (-2333.671) (-2333.861) -- 0:02:48 414000 -- (-2336.942) [-2332.676] (-2328.880) (-2341.095) * (-2334.736) [-2332.418] (-2332.134) (-2337.930) -- 0:02:48 414500 -- [-2332.994] (-2328.821) (-2325.995) (-2329.463) * (-2329.596) [-2328.113] (-2338.643) (-2342.846) -- 0:02:48 415000 -- (-2331.733) (-2332.751) [-2329.300] (-2337.801) * (-2327.251) (-2334.390) [-2325.845] (-2332.910) -- 0:02:47 Average standard deviation of split frequencies: 0.000378 415500 -- (-2335.423) (-2334.039) [-2334.172] (-2329.408) * [-2327.696] (-2338.516) (-2331.918) (-2335.818) -- 0:02:47 416000 -- (-2329.654) (-2338.477) (-2335.506) [-2331.499] * (-2337.029) (-2331.567) [-2331.760] (-2334.345) -- 0:02:47 416500 -- (-2329.014) (-2334.113) [-2334.454] (-2326.025) * (-2333.793) (-2331.039) (-2330.448) [-2331.059] -- 0:02:48 417000 -- (-2334.105) (-2338.657) [-2336.115] (-2330.988) * (-2340.166) (-2332.843) (-2330.824) [-2332.522] -- 0:02:47 417500 -- (-2347.483) [-2334.937] (-2336.176) (-2330.640) * (-2339.499) (-2330.793) (-2331.080) [-2333.632] -- 0:02:47 418000 -- (-2340.515) (-2337.846) [-2333.239] (-2334.549) * (-2335.685) (-2336.646) (-2335.377) [-2329.191] -- 0:02:47 418500 -- (-2332.786) (-2334.123) [-2330.437] (-2333.905) * (-2335.899) (-2333.485) [-2333.510] (-2334.378) -- 0:02:46 419000 -- (-2339.344) (-2333.249) [-2327.065] (-2333.801) * (-2332.001) (-2336.774) [-2330.523] (-2335.817) -- 0:02:46 419500 -- [-2331.676] (-2328.126) (-2331.162) (-2334.243) * (-2334.818) (-2342.651) [-2331.920] (-2345.947) -- 0:02:46 420000 -- (-2331.558) [-2334.457] (-2339.723) (-2332.464) * (-2327.908) (-2341.905) (-2332.217) [-2331.008] -- 0:02:47 Average standard deviation of split frequencies: 0.000000 420500 -- (-2332.683) [-2330.888] (-2328.699) (-2332.323) * (-2332.397) (-2336.667) [-2329.289] (-2331.327) -- 0:02:46 421000 -- (-2333.449) (-2333.539) (-2337.786) [-2337.848] * (-2328.778) (-2347.355) [-2325.509] (-2330.004) -- 0:02:46 421500 -- [-2339.449] (-2334.817) (-2338.109) (-2338.085) * (-2331.924) [-2331.826] (-2338.753) (-2329.899) -- 0:02:46 422000 -- (-2334.407) [-2336.986] (-2330.856) (-2334.893) * (-2331.636) (-2335.821) [-2328.660] (-2337.312) -- 0:02:45 422500 -- (-2332.474) (-2341.113) [-2332.074] (-2339.706) * (-2333.213) [-2328.551] (-2329.520) (-2334.340) -- 0:02:45 423000 -- (-2332.700) (-2331.207) (-2333.222) [-2330.587] * (-2344.177) (-2333.901) [-2334.588] (-2344.675) -- 0:02:45 423500 -- (-2335.041) (-2340.763) (-2335.635) [-2333.854] * (-2333.800) (-2330.004) [-2335.490] (-2341.983) -- 0:02:46 424000 -- (-2331.823) (-2333.224) [-2331.363] (-2330.660) * (-2335.320) (-2335.205) (-2331.316) [-2334.516] -- 0:02:45 424500 -- (-2333.479) [-2333.058] (-2331.599) (-2330.522) * (-2334.621) (-2331.652) [-2330.807] (-2334.022) -- 0:02:45 425000 -- (-2333.055) (-2330.101) [-2331.018] (-2333.569) * (-2330.308) (-2336.848) (-2329.869) [-2340.324] -- 0:02:45 Average standard deviation of split frequencies: 0.000369 425500 -- [-2325.648] (-2333.116) (-2331.900) (-2344.799) * (-2332.807) (-2336.176) [-2338.297] (-2337.387) -- 0:02:44 426000 -- [-2330.468] (-2332.812) (-2334.012) (-2336.679) * (-2331.420) [-2334.181] (-2331.612) (-2345.026) -- 0:02:44 426500 -- [-2333.189] (-2335.542) (-2333.904) (-2331.677) * (-2334.299) (-2333.298) (-2331.739) [-2335.865] -- 0:02:44 427000 -- [-2328.802] (-2337.269) (-2346.478) (-2335.149) * (-2330.376) [-2326.603] (-2334.576) (-2337.992) -- 0:02:45 427500 -- (-2334.542) (-2336.119) [-2331.345] (-2331.140) * (-2335.979) (-2339.212) [-2335.096] (-2333.829) -- 0:02:44 428000 -- (-2337.006) [-2329.911] (-2335.006) (-2332.222) * (-2329.226) (-2339.133) [-2343.319] (-2339.532) -- 0:02:44 428500 -- (-2329.619) (-2338.243) [-2331.572] (-2334.811) * [-2330.812] (-2342.957) (-2341.295) (-2332.698) -- 0:02:44 429000 -- (-2330.144) [-2327.352] (-2334.674) (-2330.902) * (-2331.938) [-2326.943] (-2341.961) (-2334.777) -- 0:02:43 429500 -- (-2348.797) (-2329.612) (-2328.305) [-2332.701] * [-2338.200] (-2333.827) (-2334.871) (-2343.163) -- 0:02:43 430000 -- (-2336.422) (-2330.753) [-2331.802] (-2329.398) * (-2336.485) [-2329.392] (-2328.260) (-2345.560) -- 0:02:43 Average standard deviation of split frequencies: 0.000365 430500 -- (-2347.436) (-2335.164) [-2332.384] (-2330.592) * (-2328.878) [-2329.282] (-2332.221) (-2335.562) -- 0:02:44 431000 -- [-2329.576] (-2339.417) (-2333.052) (-2336.418) * [-2330.976] (-2335.692) (-2332.224) (-2336.708) -- 0:02:43 431500 -- (-2334.916) [-2334.787] (-2342.606) (-2328.599) * (-2333.555) [-2330.447] (-2333.494) (-2339.743) -- 0:02:43 432000 -- [-2333.913] (-2329.435) (-2331.738) (-2333.326) * (-2336.158) [-2333.437] (-2339.594) (-2331.952) -- 0:02:43 432500 -- (-2333.149) (-2331.068) [-2327.651] (-2341.642) * (-2335.924) (-2334.142) (-2340.317) [-2330.561] -- 0:02:42 433000 -- (-2338.634) (-2331.350) (-2332.505) [-2333.734] * (-2331.705) [-2327.268] (-2345.890) (-2332.865) -- 0:02:42 433500 -- (-2335.526) (-2332.680) (-2335.579) [-2330.773] * (-2338.637) [-2331.414] (-2340.833) (-2333.447) -- 0:02:42 434000 -- (-2335.229) [-2329.530] (-2342.746) (-2332.503) * (-2335.674) (-2334.407) [-2332.265] (-2333.353) -- 0:02:43 434500 -- (-2336.341) (-2340.386) (-2329.493) [-2332.782] * (-2339.541) [-2341.033] (-2329.997) (-2333.933) -- 0:02:42 435000 -- (-2342.823) [-2330.438] (-2333.728) (-2334.818) * [-2336.296] (-2331.843) (-2332.690) (-2336.296) -- 0:02:42 Average standard deviation of split frequencies: 0.000360 435500 -- (-2338.046) (-2329.025) [-2327.277] (-2333.732) * (-2339.274) (-2333.758) [-2335.827] (-2331.173) -- 0:02:42 436000 -- (-2329.826) (-2333.416) (-2331.952) [-2335.757] * (-2333.257) [-2332.532] (-2327.317) (-2334.912) -- 0:02:41 436500 -- [-2332.436] (-2331.431) (-2341.820) (-2334.277) * (-2330.085) (-2329.979) [-2332.606] (-2334.764) -- 0:02:41 437000 -- (-2334.211) (-2332.417) (-2328.047) [-2332.600] * (-2338.211) (-2331.970) (-2330.331) [-2333.855] -- 0:02:41 437500 -- (-2333.174) [-2328.467] (-2336.509) (-2328.466) * [-2337.507] (-2329.522) (-2335.212) (-2334.080) -- 0:02:40 438000 -- (-2331.361) (-2341.157) [-2333.114] (-2334.917) * (-2341.084) (-2334.362) (-2330.143) [-2333.697] -- 0:02:41 438500 -- (-2333.604) (-2337.923) (-2329.793) [-2330.675] * (-2335.633) (-2336.594) [-2334.277] (-2339.033) -- 0:02:41 439000 -- [-2333.669] (-2338.001) (-2334.507) (-2342.828) * (-2331.209) [-2335.770] (-2333.992) (-2338.885) -- 0:02:41 439500 -- (-2336.811) (-2339.729) (-2333.586) [-2328.232] * [-2330.397] (-2330.221) (-2343.169) (-2330.853) -- 0:02:40 440000 -- (-2329.992) (-2342.811) (-2342.579) [-2328.697] * (-2336.904) [-2329.924] (-2330.148) (-2334.900) -- 0:02:40 Average standard deviation of split frequencies: 0.000357 440500 -- [-2331.315] (-2340.187) (-2335.201) (-2330.761) * (-2342.372) (-2332.646) [-2338.818] (-2328.790) -- 0:02:40 441000 -- (-2334.436) [-2328.585] (-2331.616) (-2339.397) * (-2339.487) (-2332.114) (-2335.877) [-2338.003] -- 0:02:39 441500 -- [-2334.029] (-2336.406) (-2328.731) (-2330.420) * (-2349.831) (-2333.803) [-2333.694] (-2334.647) -- 0:02:40 442000 -- (-2329.403) [-2339.238] (-2333.094) (-2330.586) * (-2333.898) [-2331.420] (-2334.843) (-2340.549) -- 0:02:40 442500 -- (-2329.631) [-2336.667] (-2328.955) (-2329.068) * (-2342.021) (-2331.355) (-2338.053) [-2329.164] -- 0:02:40 443000 -- (-2328.858) (-2338.567) (-2341.543) [-2332.806] * (-2334.624) (-2327.849) (-2328.528) [-2341.264] -- 0:02:39 443500 -- (-2327.902) (-2333.074) [-2334.821] (-2331.957) * [-2337.250] (-2332.315) (-2336.143) (-2333.755) -- 0:02:39 444000 -- (-2334.254) (-2330.286) [-2333.661] (-2332.003) * (-2340.033) (-2328.629) [-2336.017] (-2333.950) -- 0:02:39 444500 -- [-2329.408] (-2336.020) (-2336.564) (-2336.171) * (-2331.367) (-2328.086) (-2333.963) [-2330.185] -- 0:02:38 445000 -- (-2333.545) [-2329.013] (-2339.018) (-2330.777) * (-2328.142) (-2332.893) [-2333.044] (-2326.382) -- 0:02:39 Average standard deviation of split frequencies: 0.000000 445500 -- [-2330.914] (-2339.089) (-2328.299) (-2325.257) * (-2333.364) (-2338.138) (-2330.790) [-2331.597] -- 0:02:39 446000 -- [-2335.756] (-2333.818) (-2328.173) (-2329.922) * (-2328.775) [-2331.914] (-2340.480) (-2331.585) -- 0:02:38 446500 -- (-2338.245) [-2329.327] (-2332.143) (-2345.082) * [-2330.070] (-2334.242) (-2330.096) (-2335.882) -- 0:02:38 447000 -- (-2335.904) [-2330.182] (-2334.569) (-2328.669) * (-2338.585) [-2331.651] (-2337.356) (-2336.138) -- 0:02:38 447500 -- (-2335.749) [-2338.668] (-2338.597) (-2331.287) * (-2331.454) [-2332.994] (-2340.366) (-2330.071) -- 0:02:38 448000 -- (-2333.416) (-2330.946) [-2332.785] (-2330.766) * (-2335.761) (-2331.836) (-2341.462) [-2334.756] -- 0:02:37 448500 -- (-2333.642) (-2330.825) (-2332.673) [-2333.710] * [-2327.783] (-2330.149) (-2336.301) (-2334.336) -- 0:02:38 449000 -- [-2327.976] (-2331.937) (-2330.483) (-2337.292) * (-2336.556) (-2330.667) (-2336.068) [-2338.802] -- 0:02:38 449500 -- (-2331.832) [-2333.640] (-2333.362) (-2331.371) * (-2334.652) (-2336.574) [-2334.444] (-2333.284) -- 0:02:37 450000 -- (-2332.353) (-2336.044) [-2332.886] (-2326.893) * (-2330.424) [-2333.810] (-2333.484) (-2336.849) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 450500 -- [-2329.348] (-2328.193) (-2333.151) (-2330.876) * [-2331.608] (-2338.376) (-2340.569) (-2340.207) -- 0:02:37 451000 -- (-2353.999) (-2328.028) (-2342.266) [-2336.908] * (-2335.363) (-2330.098) (-2331.474) [-2332.911] -- 0:02:37 451500 -- (-2333.069) (-2332.104) (-2335.852) [-2327.678] * (-2337.305) (-2324.854) (-2333.947) [-2331.497] -- 0:02:36 452000 -- (-2336.568) [-2330.961] (-2333.808) (-2333.457) * (-2340.325) (-2327.408) [-2329.841] (-2335.799) -- 0:02:37 452500 -- (-2335.022) [-2338.805] (-2332.847) (-2329.951) * (-2333.420) [-2333.012] (-2330.756) (-2332.478) -- 0:02:37 453000 -- (-2332.176) (-2339.154) (-2332.011) [-2327.510] * (-2334.953) (-2335.342) (-2329.925) [-2331.683] -- 0:02:36 453500 -- [-2328.399] (-2335.480) (-2334.376) (-2329.490) * [-2328.088] (-2342.137) (-2333.057) (-2328.549) -- 0:02:36 454000 -- [-2329.311] (-2329.797) (-2327.630) (-2338.025) * (-2331.928) (-2336.711) [-2334.130] (-2341.002) -- 0:02:36 454500 -- [-2329.887] (-2333.055) (-2330.383) (-2331.926) * (-2333.767) [-2334.808] (-2329.938) (-2335.073) -- 0:02:36 455000 -- (-2333.670) (-2331.596) [-2332.361] (-2329.634) * (-2331.141) (-2331.186) [-2330.454] (-2334.736) -- 0:02:35 Average standard deviation of split frequencies: 0.000000 455500 -- (-2331.710) (-2326.947) (-2333.976) [-2329.578] * [-2330.457] (-2336.801) (-2332.313) (-2336.071) -- 0:02:36 456000 -- [-2335.021] (-2342.133) (-2338.408) (-2329.557) * [-2325.800] (-2328.724) (-2333.565) (-2340.282) -- 0:02:36 456500 -- (-2342.088) (-2337.555) (-2332.068) [-2328.739] * (-2335.200) (-2338.177) [-2336.468] (-2331.096) -- 0:02:35 457000 -- (-2331.726) (-2340.448) [-2334.677] (-2325.886) * (-2331.912) [-2332.386] (-2338.639) (-2330.333) -- 0:02:35 457500 -- (-2331.621) (-2335.353) [-2330.642] (-2328.049) * (-2335.504) (-2332.072) [-2334.553] (-2330.630) -- 0:02:35 458000 -- [-2337.617] (-2332.762) (-2331.856) (-2333.035) * (-2332.896) (-2337.879) [-2330.810] (-2329.912) -- 0:02:35 458500 -- (-2332.855) (-2329.638) (-2333.604) [-2330.040] * (-2331.675) (-2329.070) [-2345.247] (-2330.348) -- 0:02:34 459000 -- [-2341.509] (-2334.648) (-2334.601) (-2329.712) * (-2330.341) (-2333.136) (-2345.259) [-2331.198] -- 0:02:35 459500 -- (-2338.567) [-2333.353] (-2332.237) (-2329.143) * [-2336.447] (-2333.501) (-2336.871) (-2329.778) -- 0:02:35 460000 -- (-2334.683) (-2330.290) (-2336.921) [-2332.314] * (-2338.308) (-2333.971) (-2343.005) [-2327.977] -- 0:02:34 Average standard deviation of split frequencies: 0.000341 460500 -- (-2335.352) [-2333.699] (-2334.106) (-2329.520) * [-2329.438] (-2336.913) (-2334.988) (-2333.818) -- 0:02:34 461000 -- (-2340.218) [-2328.250] (-2331.683) (-2331.450) * [-2331.620] (-2328.566) (-2329.901) (-2334.537) -- 0:02:34 461500 -- (-2329.217) [-2331.008] (-2331.372) (-2328.287) * (-2330.235) (-2326.337) (-2344.173) [-2327.204] -- 0:02:34 462000 -- (-2328.888) (-2329.486) [-2333.490] (-2333.032) * (-2331.710) (-2332.889) [-2334.594] (-2330.705) -- 0:02:33 462500 -- (-2327.834) [-2331.150] (-2336.270) (-2341.058) * (-2331.235) (-2329.185) [-2336.730] (-2335.780) -- 0:02:34 463000 -- (-2328.590) [-2335.817] (-2329.579) (-2333.407) * (-2335.100) (-2333.866) (-2334.324) [-2336.381] -- 0:02:34 463500 -- (-2331.542) (-2329.746) (-2338.844) [-2328.514] * (-2336.032) [-2327.759] (-2330.749) (-2331.060) -- 0:02:33 464000 -- (-2337.619) (-2331.703) [-2329.831] (-2332.379) * (-2335.765) (-2343.340) (-2335.933) [-2327.649] -- 0:02:33 464500 -- (-2333.203) [-2329.453] (-2333.620) (-2336.856) * (-2331.428) (-2331.999) [-2335.840] (-2337.155) -- 0:02:33 465000 -- (-2348.059) (-2340.095) (-2334.256) [-2333.608] * (-2337.090) [-2328.518] (-2331.036) (-2334.453) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 465500 -- (-2343.131) [-2330.859] (-2327.746) (-2328.908) * (-2329.162) [-2329.521] (-2327.066) (-2335.550) -- 0:02:32 466000 -- (-2341.761) (-2329.702) (-2338.548) [-2328.039] * (-2341.208) (-2334.813) [-2337.099] (-2332.527) -- 0:02:33 466500 -- (-2339.685) (-2334.908) (-2328.685) [-2328.750] * [-2344.558] (-2331.386) (-2331.233) (-2331.216) -- 0:02:33 467000 -- (-2328.608) (-2341.345) [-2327.831] (-2330.765) * (-2337.078) (-2334.214) (-2334.467) [-2327.238] -- 0:02:32 467500 -- (-2330.044) (-2337.068) (-2332.773) [-2332.660] * (-2335.374) [-2332.446] (-2334.912) (-2335.079) -- 0:02:32 468000 -- (-2336.317) (-2330.718) [-2344.011] (-2337.111) * (-2325.796) [-2330.946] (-2336.095) (-2334.757) -- 0:02:32 468500 -- [-2334.313] (-2333.695) (-2332.958) (-2338.860) * (-2335.666) (-2334.853) (-2334.759) [-2337.663] -- 0:02:32 469000 -- (-2333.631) (-2333.636) (-2335.461) [-2332.956] * [-2331.731] (-2336.815) (-2346.062) (-2335.125) -- 0:02:31 469500 -- [-2332.135] (-2340.975) (-2329.495) (-2340.928) * (-2335.102) (-2330.854) [-2333.078] (-2333.130) -- 0:02:32 470000 -- (-2330.184) (-2338.525) (-2334.990) [-2332.643] * [-2334.530] (-2330.929) (-2332.157) (-2332.977) -- 0:02:32 Average standard deviation of split frequencies: 0.000000 470500 -- (-2327.352) (-2339.030) [-2330.378] (-2339.492) * (-2333.471) [-2330.119] (-2340.123) (-2330.049) -- 0:02:31 471000 -- (-2330.946) [-2332.883] (-2332.232) (-2336.853) * [-2334.810] (-2334.934) (-2335.014) (-2335.758) -- 0:02:31 471500 -- [-2334.415] (-2335.079) (-2332.499) (-2342.048) * (-2334.310) (-2331.896) (-2334.288) [-2328.331] -- 0:02:31 472000 -- (-2334.602) [-2334.242] (-2334.385) (-2335.172) * (-2328.259) [-2329.856] (-2333.844) (-2341.490) -- 0:02:31 472500 -- (-2336.405) (-2337.974) (-2327.948) [-2330.977] * (-2331.957) [-2328.015] (-2334.349) (-2327.876) -- 0:02:30 473000 -- [-2332.401] (-2339.253) (-2328.445) (-2330.624) * (-2335.962) (-2334.894) (-2334.306) [-2329.016] -- 0:02:31 473500 -- [-2329.645] (-2336.327) (-2331.936) (-2327.928) * [-2329.585] (-2330.364) (-2334.670) (-2331.598) -- 0:02:31 474000 -- (-2348.490) (-2333.108) (-2333.962) [-2340.537] * (-2336.849) (-2336.736) (-2339.932) [-2331.547] -- 0:02:30 474500 -- (-2335.646) (-2327.884) [-2336.601] (-2334.292) * (-2348.670) (-2335.678) [-2329.859] (-2329.527) -- 0:02:30 475000 -- (-2337.204) (-2333.563) [-2328.755] (-2330.378) * (-2340.259) [-2327.758] (-2340.155) (-2333.661) -- 0:02:30 Average standard deviation of split frequencies: 0.000000 475500 -- [-2332.279] (-2335.894) (-2330.397) (-2334.075) * (-2331.579) (-2330.058) [-2331.284] (-2336.173) -- 0:02:30 476000 -- (-2337.901) [-2334.965] (-2332.454) (-2333.332) * (-2338.649) (-2327.392) (-2331.720) [-2330.661] -- 0:02:29 476500 -- [-2333.005] (-2333.889) (-2339.842) (-2334.381) * (-2329.016) (-2327.662) (-2333.537) [-2330.030] -- 0:02:30 477000 -- (-2332.980) [-2332.930] (-2340.482) (-2333.167) * (-2332.227) [-2337.188] (-2329.326) (-2336.155) -- 0:02:30 477500 -- [-2333.477] (-2338.390) (-2332.977) (-2334.466) * (-2336.678) (-2335.662) (-2325.428) [-2333.239] -- 0:02:29 478000 -- (-2331.844) (-2331.383) (-2338.635) [-2338.317] * (-2346.610) [-2335.113] (-2328.020) (-2328.583) -- 0:02:29 478500 -- [-2334.202] (-2347.428) (-2332.946) (-2331.462) * (-2336.996) [-2332.167] (-2330.486) (-2334.378) -- 0:02:29 479000 -- [-2334.515] (-2340.529) (-2332.421) (-2332.128) * (-2332.007) (-2331.593) (-2336.395) [-2335.323] -- 0:02:29 479500 -- [-2335.436] (-2338.605) (-2336.351) (-2331.888) * (-2341.046) (-2330.484) [-2330.339] (-2345.618) -- 0:02:28 480000 -- (-2335.046) (-2331.294) [-2335.542] (-2333.312) * [-2328.037] (-2338.587) (-2331.825) (-2339.835) -- 0:02:29 Average standard deviation of split frequencies: 0.000327 480500 -- [-2329.129] (-2328.180) (-2329.927) (-2336.577) * (-2329.167) (-2335.878) (-2331.398) [-2339.531] -- 0:02:29 481000 -- (-2335.341) [-2329.528] (-2336.287) (-2334.825) * (-2330.917) (-2335.612) [-2332.573] (-2342.286) -- 0:02:28 481500 -- (-2328.413) (-2335.524) [-2326.312] (-2340.534) * [-2331.247] (-2330.770) (-2327.018) (-2341.920) -- 0:02:28 482000 -- (-2325.079) (-2334.587) (-2331.138) [-2336.183] * (-2332.777) [-2330.262] (-2343.650) (-2344.836) -- 0:02:28 482500 -- [-2333.019] (-2340.438) (-2337.042) (-2339.389) * (-2329.108) [-2326.334] (-2341.679) (-2342.080) -- 0:02:28 483000 -- (-2341.321) (-2337.594) [-2350.456] (-2336.783) * (-2340.984) (-2331.947) (-2331.936) [-2333.420] -- 0:02:27 483500 -- [-2336.204] (-2337.049) (-2329.500) (-2335.162) * (-2332.984) (-2327.324) (-2339.872) [-2330.702] -- 0:02:28 484000 -- (-2349.893) (-2329.636) (-2331.227) [-2332.150] * (-2330.499) (-2332.922) [-2332.021] (-2339.820) -- 0:02:28 484500 -- (-2336.585) [-2334.126] (-2331.635) (-2333.700) * (-2338.904) [-2337.877] (-2334.772) (-2339.130) -- 0:02:27 485000 -- (-2338.201) [-2331.950] (-2337.463) (-2328.619) * (-2329.707) (-2334.419) (-2333.837) [-2330.092] -- 0:02:27 Average standard deviation of split frequencies: 0.000323 485500 -- (-2338.109) (-2335.870) [-2331.048] (-2335.403) * (-2333.257) (-2331.546) [-2328.497] (-2333.529) -- 0:02:27 486000 -- (-2335.618) [-2334.568] (-2344.100) (-2328.666) * (-2326.433) (-2341.584) (-2328.642) [-2332.160] -- 0:02:27 486500 -- (-2338.117) (-2331.593) [-2333.237] (-2334.230) * (-2340.566) (-2329.733) [-2327.476] (-2332.081) -- 0:02:26 487000 -- [-2335.012] (-2328.858) (-2329.685) (-2333.874) * (-2335.270) (-2327.854) (-2329.826) [-2329.688] -- 0:02:27 487500 -- [-2337.996] (-2334.781) (-2336.389) (-2328.352) * (-2334.711) (-2328.129) (-2329.865) [-2329.683] -- 0:02:27 488000 -- (-2332.081) (-2333.148) (-2339.699) [-2332.117] * (-2335.273) (-2336.032) [-2332.396] (-2337.828) -- 0:02:26 488500 -- (-2338.249) [-2332.265] (-2338.241) (-2333.749) * (-2334.731) (-2341.853) [-2326.919] (-2335.728) -- 0:02:26 489000 -- (-2340.273) [-2327.732] (-2331.409) (-2327.628) * [-2334.251] (-2332.340) (-2330.050) (-2335.021) -- 0:02:26 489500 -- (-2335.320) (-2336.088) [-2328.637] (-2328.171) * (-2336.677) (-2336.188) [-2328.094] (-2333.941) -- 0:02:26 490000 -- (-2331.046) (-2334.055) (-2339.067) [-2332.090] * (-2337.068) (-2331.155) (-2329.868) [-2326.106] -- 0:02:25 Average standard deviation of split frequencies: 0.000000 490500 -- [-2335.877] (-2328.454) (-2347.567) (-2334.023) * (-2336.222) (-2340.827) [-2332.445] (-2332.801) -- 0:02:26 491000 -- (-2334.134) (-2332.081) [-2334.751] (-2334.210) * [-2337.458] (-2330.419) (-2335.775) (-2330.347) -- 0:02:26 491500 -- [-2329.807] (-2332.680) (-2330.109) (-2335.781) * (-2335.877) [-2329.011] (-2331.327) (-2339.540) -- 0:02:25 492000 -- (-2334.856) [-2331.996] (-2338.078) (-2330.486) * (-2337.678) (-2327.140) [-2332.236] (-2334.414) -- 0:02:25 492500 -- [-2335.694] (-2334.128) (-2333.854) (-2345.153) * (-2335.656) (-2328.109) [-2334.910] (-2337.026) -- 0:02:25 493000 -- (-2332.920) [-2339.297] (-2338.502) (-2337.428) * (-2328.924) (-2338.424) (-2325.736) [-2331.890] -- 0:02:25 493500 -- [-2339.718] (-2329.673) (-2332.733) (-2343.379) * (-2336.496) (-2347.855) (-2329.762) [-2331.886] -- 0:02:24 494000 -- [-2339.218] (-2334.480) (-2330.799) (-2338.172) * (-2344.074) (-2334.063) [-2329.569] (-2332.054) -- 0:02:25 494500 -- (-2333.700) (-2336.596) [-2334.946] (-2346.377) * (-2335.664) (-2335.737) (-2326.524) [-2330.312] -- 0:02:25 495000 -- (-2330.651) (-2336.780) (-2333.240) [-2332.258] * (-2340.565) (-2337.375) [-2328.503] (-2330.890) -- 0:02:24 Average standard deviation of split frequencies: 0.000317 495500 -- (-2334.671) [-2329.926] (-2332.879) (-2327.918) * (-2342.898) (-2330.920) [-2328.952] (-2332.856) -- 0:02:24 496000 -- [-2329.540] (-2335.142) (-2330.272) (-2329.055) * (-2333.023) (-2335.370) [-2333.933] (-2330.664) -- 0:02:24 496500 -- (-2335.195) (-2333.205) (-2330.786) [-2328.858] * [-2334.795] (-2328.246) (-2340.992) (-2332.152) -- 0:02:24 497000 -- (-2331.798) [-2329.253] (-2330.975) (-2340.158) * [-2331.404] (-2331.777) (-2334.154) (-2330.584) -- 0:02:23 497500 -- (-2332.615) [-2330.764] (-2333.976) (-2333.722) * (-2331.739) (-2331.229) (-2337.266) [-2330.903] -- 0:02:24 498000 -- (-2336.358) (-2332.453) (-2330.176) [-2338.421] * [-2331.333] (-2339.402) (-2338.578) (-2329.983) -- 0:02:24 498500 -- [-2333.491] (-2342.471) (-2335.301) (-2335.340) * (-2330.367) [-2338.583] (-2340.275) (-2331.205) -- 0:02:23 499000 -- (-2334.213) (-2333.801) [-2339.383] (-2334.010) * (-2327.406) (-2335.884) (-2335.959) [-2334.066] -- 0:02:23 499500 -- [-2326.978] (-2327.216) (-2336.007) (-2338.879) * (-2332.946) (-2335.343) (-2347.165) [-2335.871] -- 0:02:23 500000 -- (-2333.807) (-2330.245) (-2336.439) [-2330.736] * (-2336.797) (-2336.994) [-2331.146] (-2338.849) -- 0:02:23 Average standard deviation of split frequencies: 0.000314 500500 -- (-2328.989) (-2338.756) (-2355.782) [-2336.141] * (-2334.364) (-2335.330) (-2334.310) [-2329.336] -- 0:02:22 501000 -- (-2329.070) (-2332.496) (-2338.063) [-2335.600] * (-2337.517) (-2335.341) (-2336.566) [-2339.958] -- 0:02:23 501500 -- (-2330.925) [-2329.416] (-2338.072) (-2331.587) * [-2335.402] (-2343.019) (-2326.566) (-2333.460) -- 0:02:23 502000 -- (-2330.859) [-2329.126] (-2342.062) (-2332.371) * (-2328.487) (-2334.705) (-2335.981) [-2331.679] -- 0:02:22 502500 -- (-2340.273) (-2334.749) (-2335.606) [-2337.155] * (-2331.962) (-2335.134) (-2335.285) [-2332.744] -- 0:02:22 503000 -- (-2330.787) (-2339.507) (-2338.861) [-2328.847] * [-2331.010] (-2330.888) (-2332.248) (-2332.428) -- 0:02:22 503500 -- (-2329.774) (-2334.352) (-2335.592) [-2330.834] * (-2325.514) (-2337.720) (-2335.215) [-2332.756] -- 0:02:21 504000 -- (-2339.360) (-2336.961) [-2331.511] (-2330.350) * [-2331.125] (-2338.686) (-2335.590) (-2327.428) -- 0:02:21 504500 -- (-2333.248) (-2334.580) (-2339.683) [-2327.590] * (-2332.710) (-2342.838) [-2333.782] (-2332.634) -- 0:02:22 505000 -- (-2333.076) [-2329.487] (-2332.629) (-2329.123) * (-2335.660) (-2336.165) (-2336.483) [-2332.009] -- 0:02:22 Average standard deviation of split frequencies: 0.000311 505500 -- [-2330.002] (-2335.886) (-2330.708) (-2340.318) * (-2336.576) (-2338.253) (-2330.288) [-2333.446] -- 0:02:21 506000 -- (-2334.818) (-2331.832) [-2335.263] (-2337.279) * (-2335.480) (-2333.907) [-2332.673] (-2333.980) -- 0:02:21 506500 -- (-2334.176) [-2330.262] (-2330.030) (-2332.204) * (-2334.280) (-2327.947) [-2332.219] (-2332.009) -- 0:02:21 507000 -- [-2331.211] (-2331.454) (-2334.771) (-2333.724) * (-2334.362) [-2336.187] (-2333.083) (-2334.563) -- 0:02:20 507500 -- (-2330.091) (-2334.308) (-2332.484) [-2329.991] * (-2336.917) (-2333.377) (-2332.626) [-2330.519] -- 0:02:21 508000 -- (-2335.975) (-2337.518) (-2337.415) [-2332.565] * [-2333.417] (-2336.504) (-2330.424) (-2332.295) -- 0:02:21 508500 -- (-2338.998) (-2332.882) (-2331.907) [-2333.774] * [-2338.197] (-2331.788) (-2329.875) (-2338.786) -- 0:02:21 509000 -- (-2338.865) (-2333.343) [-2333.486] (-2334.329) * [-2330.156] (-2335.095) (-2333.317) (-2331.389) -- 0:02:20 509500 -- [-2331.316] (-2336.518) (-2332.444) (-2333.741) * (-2332.044) [-2336.683] (-2336.823) (-2331.546) -- 0:02:20 510000 -- (-2334.597) (-2343.357) (-2331.083) [-2328.990] * (-2330.245) [-2332.791] (-2335.475) (-2339.275) -- 0:02:20 Average standard deviation of split frequencies: 0.000615 510500 -- (-2329.825) (-2332.819) (-2342.711) [-2330.844] * (-2331.632) (-2329.186) [-2337.594] (-2332.796) -- 0:02:19 511000 -- (-2331.887) (-2330.615) [-2334.972] (-2339.280) * [-2328.679] (-2338.332) (-2334.973) (-2339.072) -- 0:02:20 511500 -- (-2332.005) [-2337.372] (-2333.027) (-2331.959) * (-2336.279) (-2331.763) (-2328.724) [-2333.316] -- 0:02:20 512000 -- (-2332.869) [-2330.116] (-2328.163) (-2329.182) * [-2332.316] (-2334.994) (-2331.368) (-2346.988) -- 0:02:20 512500 -- [-2334.601] (-2326.481) (-2329.724) (-2336.445) * (-2346.779) (-2336.650) [-2329.832] (-2343.545) -- 0:02:19 513000 -- (-2333.513) (-2330.427) (-2335.823) [-2330.579] * (-2329.034) [-2329.929] (-2331.484) (-2335.398) -- 0:02:19 513500 -- (-2340.638) (-2334.823) (-2328.819) [-2334.397] * (-2336.404) (-2332.878) (-2339.006) [-2330.693] -- 0:02:19 514000 -- (-2337.352) (-2337.988) (-2334.143) [-2341.874] * (-2335.095) (-2338.022) (-2340.174) [-2340.588] -- 0:02:18 514500 -- (-2338.228) (-2329.123) [-2333.060] (-2338.309) * (-2333.772) [-2327.861] (-2331.589) (-2334.713) -- 0:02:19 515000 -- (-2332.742) (-2332.260) (-2335.021) [-2336.791] * (-2336.318) (-2340.802) (-2330.293) [-2340.150] -- 0:02:19 Average standard deviation of split frequencies: 0.000609 515500 -- [-2328.934] (-2334.272) (-2335.722) (-2330.562) * (-2330.997) [-2330.028] (-2335.508) (-2333.183) -- 0:02:19 516000 -- [-2331.487] (-2335.131) (-2330.704) (-2340.822) * (-2334.070) (-2325.792) [-2333.321] (-2335.074) -- 0:02:18 516500 -- (-2329.222) [-2326.291] (-2329.613) (-2329.432) * [-2330.925] (-2336.404) (-2331.485) (-2334.544) -- 0:02:18 517000 -- (-2329.595) [-2332.055] (-2337.319) (-2334.600) * (-2334.410) (-2339.813) [-2337.000] (-2336.207) -- 0:02:18 517500 -- (-2332.672) [-2333.122] (-2333.697) (-2333.113) * (-2332.235) [-2336.093] (-2336.127) (-2331.883) -- 0:02:17 518000 -- (-2332.686) (-2336.487) [-2335.521] (-2337.736) * (-2341.897) (-2341.764) (-2333.749) [-2332.533] -- 0:02:18 518500 -- [-2327.907] (-2338.976) (-2338.628) (-2340.845) * [-2330.516] (-2333.348) (-2336.015) (-2329.211) -- 0:02:18 519000 -- [-2333.800] (-2335.219) (-2336.372) (-2351.685) * [-2332.492] (-2346.020) (-2333.405) (-2339.214) -- 0:02:18 519500 -- (-2338.532) (-2345.945) [-2332.388] (-2337.151) * (-2333.376) (-2332.916) (-2336.606) [-2333.500] -- 0:02:17 520000 -- (-2341.777) (-2332.989) (-2336.421) [-2340.818] * (-2341.931) (-2339.688) (-2332.825) [-2329.056] -- 0:02:17 Average standard deviation of split frequencies: 0.000604 520500 -- (-2334.013) (-2333.342) [-2331.762] (-2338.993) * [-2332.785] (-2335.032) (-2334.585) (-2331.873) -- 0:02:17 521000 -- (-2333.982) [-2333.031] (-2332.028) (-2340.242) * [-2327.622] (-2339.328) (-2332.805) (-2335.223) -- 0:02:16 521500 -- (-2330.346) (-2331.804) (-2333.642) [-2329.500] * (-2336.137) [-2333.921] (-2337.320) (-2333.205) -- 0:02:17 522000 -- (-2329.889) (-2334.199) [-2330.556] (-2331.911) * [-2329.972] (-2328.980) (-2337.144) (-2328.289) -- 0:02:17 522500 -- [-2335.529] (-2338.725) (-2329.987) (-2341.787) * [-2329.316] (-2327.153) (-2331.272) (-2328.080) -- 0:02:17 523000 -- [-2329.799] (-2331.528) (-2329.374) (-2338.684) * [-2335.266] (-2334.508) (-2333.395) (-2331.323) -- 0:02:16 523500 -- (-2334.835) (-2343.169) [-2328.854] (-2331.013) * (-2331.901) (-2330.747) (-2334.902) [-2332.142] -- 0:02:16 524000 -- [-2332.681] (-2336.010) (-2332.264) (-2335.109) * [-2330.251] (-2329.911) (-2334.185) (-2335.201) -- 0:02:16 524500 -- (-2332.864) (-2332.313) [-2331.376] (-2333.070) * (-2336.990) [-2333.197] (-2329.809) (-2339.233) -- 0:02:15 525000 -- (-2338.476) [-2335.170] (-2333.111) (-2331.575) * (-2341.841) [-2335.463] (-2334.330) (-2327.612) -- 0:02:16 Average standard deviation of split frequencies: 0.000896 525500 -- [-2336.149] (-2333.516) (-2335.700) (-2339.749) * (-2330.750) [-2333.511] (-2334.813) (-2341.101) -- 0:02:16 526000 -- (-2329.744) (-2331.459) [-2326.704] (-2331.855) * [-2333.573] (-2331.018) (-2343.416) (-2334.736) -- 0:02:16 526500 -- (-2333.814) (-2339.879) (-2331.910) [-2339.128] * (-2334.316) [-2329.475] (-2335.693) (-2339.738) -- 0:02:15 527000 -- [-2332.942] (-2336.050) (-2329.534) (-2332.086) * (-2329.946) (-2334.934) (-2334.667) [-2333.978] -- 0:02:15 527500 -- [-2331.307] (-2329.532) (-2334.158) (-2332.654) * [-2331.982] (-2342.480) (-2338.932) (-2333.193) -- 0:02:15 528000 -- [-2329.565] (-2331.613) (-2342.148) (-2336.014) * (-2337.541) (-2343.092) [-2332.374] (-2334.562) -- 0:02:14 528500 -- [-2331.287] (-2330.127) (-2327.516) (-2340.615) * (-2334.521) (-2335.193) [-2335.421] (-2337.466) -- 0:02:15 529000 -- (-2331.720) [-2337.013] (-2335.006) (-2335.489) * (-2335.569) (-2330.491) (-2333.827) [-2331.820] -- 0:02:15 529500 -- [-2329.642] (-2351.265) (-2337.211) (-2342.566) * (-2338.174) (-2339.318) (-2331.618) [-2334.062] -- 0:02:15 530000 -- [-2330.391] (-2339.474) (-2335.083) (-2340.927) * (-2333.984) [-2331.363] (-2339.479) (-2333.501) -- 0:02:14 Average standard deviation of split frequencies: 0.000592 530500 -- (-2336.204) (-2338.201) (-2331.678) [-2342.084] * (-2332.146) [-2327.065] (-2333.134) (-2335.035) -- 0:02:14 531000 -- [-2330.609] (-2332.000) (-2333.556) (-2333.197) * (-2335.093) (-2330.611) (-2338.713) [-2331.847] -- 0:02:14 531500 -- [-2332.820] (-2337.917) (-2336.527) (-2335.236) * [-2330.252] (-2338.892) (-2331.496) (-2328.399) -- 0:02:13 532000 -- (-2336.077) [-2330.400] (-2339.047) (-2330.947) * [-2336.481] (-2333.961) (-2335.461) (-2335.767) -- 0:02:14 532500 -- (-2343.699) (-2336.019) [-2328.844] (-2330.824) * [-2332.562] (-2331.474) (-2329.512) (-2330.799) -- 0:02:14 533000 -- [-2336.135] (-2335.281) (-2330.541) (-2334.368) * (-2328.512) (-2337.234) (-2333.113) [-2329.998] -- 0:02:14 533500 -- (-2333.025) [-2331.253] (-2337.920) (-2331.800) * (-2331.081) [-2333.401] (-2329.713) (-2331.137) -- 0:02:13 534000 -- (-2331.433) (-2332.029) (-2331.424) [-2334.357] * (-2334.084) [-2329.532] (-2331.942) (-2329.348) -- 0:02:13 534500 -- (-2328.079) (-2334.062) (-2338.733) [-2336.979] * [-2329.877] (-2346.219) (-2333.178) (-2331.395) -- 0:02:13 535000 -- [-2330.335] (-2333.183) (-2335.149) (-2330.304) * (-2331.077) (-2341.269) [-2332.086] (-2333.519) -- 0:02:12 Average standard deviation of split frequencies: 0.000586 535500 -- (-2328.262) [-2331.963] (-2329.501) (-2328.253) * (-2330.425) (-2345.206) (-2327.434) [-2331.538] -- 0:02:13 536000 -- [-2329.573] (-2336.006) (-2334.575) (-2326.351) * (-2336.868) (-2334.221) (-2332.100) [-2335.544] -- 0:02:13 536500 -- (-2343.153) (-2338.452) [-2337.885] (-2337.125) * (-2332.595) [-2336.090] (-2336.197) (-2328.707) -- 0:02:13 537000 -- (-2345.260) (-2338.591) (-2333.271) [-2328.850] * [-2330.117] (-2339.842) (-2333.104) (-2331.412) -- 0:02:12 537500 -- (-2337.950) [-2334.453] (-2337.948) (-2331.247) * (-2334.749) (-2329.695) [-2326.935] (-2328.411) -- 0:02:12 538000 -- (-2346.998) (-2329.520) (-2335.994) [-2332.612] * (-2333.950) (-2332.840) [-2333.150] (-2336.581) -- 0:02:12 538500 -- (-2344.410) [-2340.568] (-2339.303) (-2333.787) * (-2332.426) (-2335.177) [-2334.008] (-2333.968) -- 0:02:11 539000 -- (-2334.370) [-2329.386] (-2339.700) (-2329.138) * [-2334.369] (-2330.139) (-2333.630) (-2330.861) -- 0:02:12 539500 -- (-2339.299) (-2331.646) [-2333.927] (-2332.838) * [-2329.759] (-2336.975) (-2329.122) (-2335.348) -- 0:02:12 540000 -- [-2329.322] (-2335.801) (-2338.048) (-2333.701) * (-2333.961) [-2330.988] (-2329.383) (-2333.508) -- 0:02:12 Average standard deviation of split frequencies: 0.000581 540500 -- (-2343.302) (-2331.861) [-2335.948] (-2335.886) * (-2328.210) (-2338.667) [-2331.200] (-2335.869) -- 0:02:11 541000 -- [-2331.005] (-2332.211) (-2330.796) (-2337.093) * (-2330.177) (-2340.949) (-2334.880) [-2333.022] -- 0:02:11 541500 -- (-2331.579) [-2330.297] (-2330.514) (-2337.322) * (-2334.442) [-2335.522] (-2337.390) (-2334.230) -- 0:02:11 542000 -- (-2332.273) [-2332.302] (-2329.815) (-2330.379) * (-2334.194) (-2333.558) [-2330.578] (-2335.397) -- 0:02:11 542500 -- [-2328.679] (-2334.433) (-2331.817) (-2331.497) * (-2340.193) (-2335.284) [-2328.237] (-2338.901) -- 0:02:11 543000 -- (-2326.716) (-2336.065) (-2332.963) [-2328.675] * (-2328.736) (-2332.866) [-2327.836] (-2345.970) -- 0:02:11 543500 -- (-2331.994) (-2340.448) [-2329.178] (-2329.735) * (-2332.655) (-2332.417) [-2330.879] (-2332.506) -- 0:02:11 544000 -- (-2342.758) (-2335.037) [-2335.211] (-2329.309) * (-2331.985) (-2331.796) (-2327.490) [-2332.943] -- 0:02:10 544500 -- [-2329.220] (-2339.655) (-2337.192) (-2341.372) * [-2339.038] (-2331.273) (-2333.199) (-2330.375) -- 0:02:10 545000 -- (-2335.375) (-2333.146) (-2332.179) [-2332.536] * [-2332.017] (-2335.657) (-2333.812) (-2334.445) -- 0:02:10 Average standard deviation of split frequencies: 0.000576 545500 -- (-2329.878) (-2338.663) [-2332.862] (-2328.005) * (-2333.644) (-2334.158) (-2340.451) [-2328.890] -- 0:02:10 546000 -- (-2336.632) (-2337.367) [-2334.391] (-2330.585) * (-2330.381) [-2330.458] (-2333.732) (-2332.496) -- 0:02:10 546500 -- (-2332.456) [-2333.172] (-2330.134) (-2336.732) * [-2328.676] (-2334.045) (-2330.775) (-2338.835) -- 0:02:10 547000 -- (-2332.444) (-2330.351) [-2334.166] (-2332.618) * [-2336.018] (-2333.571) (-2337.330) (-2338.300) -- 0:02:10 547500 -- (-2332.942) [-2333.416] (-2332.900) (-2330.039) * (-2332.808) [-2331.343] (-2333.782) (-2342.673) -- 0:02:09 548000 -- (-2334.524) (-2332.174) [-2337.748] (-2340.465) * (-2332.306) (-2343.355) (-2327.312) [-2335.649] -- 0:02:09 548500 -- (-2329.910) (-2338.127) (-2331.580) [-2333.612] * [-2335.653] (-2339.269) (-2328.829) (-2332.358) -- 0:02:10 549000 -- (-2344.984) (-2331.360) [-2334.490] (-2333.705) * [-2335.369] (-2328.493) (-2332.939) (-2333.221) -- 0:02:09 549500 -- (-2332.733) (-2332.182) (-2335.427) [-2338.121] * (-2332.439) (-2336.193) [-2329.431] (-2331.729) -- 0:02:09 550000 -- (-2338.488) [-2336.707] (-2342.031) (-2338.441) * [-2333.545] (-2335.328) (-2329.207) (-2330.823) -- 0:02:09 Average standard deviation of split frequencies: 0.000571 550500 -- (-2346.257) [-2327.565] (-2330.484) (-2341.442) * (-2327.587) (-2337.595) (-2330.260) [-2335.096] -- 0:02:09 551000 -- (-2338.068) (-2326.747) [-2331.569] (-2332.625) * [-2330.628] (-2329.383) (-2330.612) (-2330.886) -- 0:02:08 551500 -- (-2332.100) [-2331.168] (-2329.610) (-2339.415) * (-2334.062) (-2334.351) [-2328.812] (-2336.889) -- 0:02:08 552000 -- (-2330.488) [-2339.522] (-2332.847) (-2331.451) * (-2333.555) (-2335.723) [-2332.160] (-2339.439) -- 0:02:09 552500 -- (-2335.286) (-2339.392) (-2335.706) [-2334.712] * (-2334.741) [-2339.054] (-2331.137) (-2350.140) -- 0:02:08 553000 -- (-2327.203) (-2335.843) (-2336.411) [-2332.172] * (-2334.282) (-2330.421) [-2335.976] (-2341.092) -- 0:02:08 553500 -- (-2331.288) (-2337.866) [-2329.520] (-2334.207) * (-2345.588) (-2330.557) (-2335.503) [-2334.427] -- 0:02:08 554000 -- (-2331.590) (-2332.554) [-2331.943] (-2329.073) * (-2335.842) [-2343.653] (-2331.379) (-2338.429) -- 0:02:08 554500 -- (-2327.651) (-2336.937) (-2332.983) [-2331.559] * (-2328.836) (-2343.094) [-2332.792] (-2329.391) -- 0:02:07 555000 -- (-2336.242) (-2338.258) (-2344.077) [-2330.189] * [-2332.359] (-2338.879) (-2347.545) (-2333.832) -- 0:02:07 Average standard deviation of split frequencies: 0.000283 555500 -- (-2334.881) (-2331.697) [-2330.453] (-2340.777) * [-2330.240] (-2342.277) (-2338.398) (-2326.111) -- 0:02:08 556000 -- (-2331.378) (-2337.137) [-2328.935] (-2343.622) * [-2329.623] (-2345.054) (-2329.943) (-2333.270) -- 0:02:07 556500 -- (-2333.740) [-2329.058] (-2329.740) (-2335.605) * (-2336.594) (-2332.401) (-2336.109) [-2338.245] -- 0:02:07 557000 -- (-2334.735) (-2333.587) [-2331.913] (-2330.571) * (-2327.182) (-2334.212) [-2334.732] (-2335.491) -- 0:02:07 557500 -- (-2330.804) (-2333.895) (-2327.785) [-2336.453] * [-2331.468] (-2331.490) (-2330.527) (-2339.341) -- 0:02:06 558000 -- (-2339.489) (-2336.443) [-2335.367] (-2342.743) * (-2336.170) (-2332.843) (-2337.473) [-2333.774] -- 0:02:06 558500 -- (-2329.003) (-2328.855) [-2333.268] (-2340.100) * (-2331.946) (-2331.326) (-2331.736) [-2333.571] -- 0:02:06 559000 -- (-2338.543) [-2330.265] (-2328.342) (-2338.795) * (-2332.509) [-2328.957] (-2333.963) (-2328.173) -- 0:02:07 559500 -- (-2332.123) (-2333.879) [-2329.555] (-2337.250) * [-2328.755] (-2332.026) (-2333.876) (-2331.237) -- 0:02:06 560000 -- (-2339.268) [-2332.082] (-2331.842) (-2338.565) * (-2335.620) [-2334.063] (-2335.793) (-2329.579) -- 0:02:06 Average standard deviation of split frequencies: 0.000561 560500 -- (-2326.964) (-2340.591) (-2333.845) [-2331.223] * [-2326.768] (-2337.463) (-2334.787) (-2336.206) -- 0:02:06 561000 -- (-2337.105) (-2333.392) [-2334.935] (-2336.406) * (-2330.579) [-2330.836] (-2331.284) (-2335.430) -- 0:02:05 561500 -- (-2332.346) (-2332.531) [-2334.651] (-2338.390) * (-2331.728) [-2328.735] (-2333.717) (-2337.911) -- 0:02:05 562000 -- (-2332.466) (-2337.863) [-2339.113] (-2337.713) * (-2334.328) (-2331.319) [-2328.248] (-2331.182) -- 0:02:05 562500 -- [-2341.042] (-2337.862) (-2334.513) (-2337.703) * (-2330.915) (-2330.055) (-2331.115) [-2330.450] -- 0:02:06 563000 -- (-2331.319) (-2333.098) [-2333.276] (-2336.280) * (-2331.324) [-2332.419] (-2331.649) (-2330.906) -- 0:02:05 563500 -- [-2329.901] (-2333.332) (-2334.387) (-2345.384) * (-2330.130) (-2330.134) [-2333.852] (-2335.259) -- 0:02:05 564000 -- (-2331.899) [-2332.831] (-2332.101) (-2331.216) * [-2327.888] (-2330.353) (-2338.022) (-2338.182) -- 0:02:05 564500 -- (-2335.765) (-2330.615) [-2332.222] (-2330.480) * [-2330.075] (-2333.208) (-2336.508) (-2335.415) -- 0:02:04 565000 -- (-2333.728) [-2330.137] (-2339.662) (-2331.138) * [-2329.976] (-2328.950) (-2332.878) (-2333.498) -- 0:02:04 Average standard deviation of split frequencies: 0.000555 565500 -- (-2331.898) (-2330.771) (-2336.825) [-2339.265] * (-2332.073) (-2331.023) (-2331.724) [-2330.282] -- 0:02:04 566000 -- [-2330.742] (-2336.163) (-2333.478) (-2339.691) * (-2334.883) (-2334.566) (-2329.344) [-2326.465] -- 0:02:04 566500 -- [-2328.199] (-2347.718) (-2334.793) (-2333.450) * (-2333.740) [-2336.862] (-2332.360) (-2341.797) -- 0:02:04 567000 -- (-2331.170) (-2336.648) [-2330.462] (-2338.959) * (-2334.225) (-2333.051) [-2328.622] (-2331.769) -- 0:02:04 567500 -- (-2329.893) (-2338.892) [-2334.026] (-2340.805) * (-2331.847) (-2335.436) (-2339.389) [-2328.260] -- 0:02:04 568000 -- (-2332.585) (-2336.002) [-2333.441] (-2343.462) * (-2336.215) [-2330.297] (-2329.353) (-2338.515) -- 0:02:03 568500 -- [-2327.646] (-2343.735) (-2337.050) (-2331.057) * (-2335.452) [-2327.698] (-2337.503) (-2331.657) -- 0:02:03 569000 -- (-2332.424) (-2328.700) (-2329.000) [-2332.587] * (-2333.848) [-2329.959] (-2336.238) (-2342.526) -- 0:02:03 569500 -- [-2330.998] (-2333.402) (-2334.300) (-2330.873) * [-2332.660] (-2333.178) (-2338.796) (-2335.113) -- 0:02:03 570000 -- (-2335.017) (-2336.021) [-2332.393] (-2334.231) * [-2331.741] (-2334.866) (-2338.192) (-2334.756) -- 0:02:03 Average standard deviation of split frequencies: 0.000551 570500 -- (-2333.737) (-2330.913) [-2329.101] (-2330.613) * (-2336.946) [-2335.981] (-2330.722) (-2330.419) -- 0:02:03 571000 -- (-2338.497) [-2335.241] (-2332.287) (-2339.146) * (-2330.062) (-2330.925) (-2332.557) [-2330.496] -- 0:02:03 571500 -- (-2339.188) (-2352.194) (-2339.441) [-2327.516] * (-2332.143) (-2339.238) [-2333.439] (-2330.384) -- 0:02:02 572000 -- [-2335.688] (-2337.166) (-2341.866) (-2333.762) * (-2332.818) [-2329.156] (-2343.282) (-2336.682) -- 0:02:02 572500 -- (-2333.677) (-2336.467) (-2341.809) [-2335.182] * (-2334.838) (-2334.536) [-2336.970] (-2335.239) -- 0:02:02 573000 -- (-2333.134) (-2340.557) (-2336.091) [-2329.091] * [-2332.373] (-2332.550) (-2333.962) (-2334.916) -- 0:02:02 573500 -- [-2331.497] (-2329.405) (-2330.090) (-2328.367) * [-2335.463] (-2326.935) (-2335.844) (-2337.063) -- 0:02:02 574000 -- (-2332.985) [-2328.817] (-2334.588) (-2327.466) * (-2341.096) (-2337.401) (-2340.021) [-2330.303] -- 0:02:02 574500 -- (-2332.604) [-2331.525] (-2329.345) (-2333.891) * (-2341.267) (-2330.293) (-2333.141) [-2334.066] -- 0:02:02 575000 -- [-2330.334] (-2335.260) (-2334.731) (-2334.593) * [-2336.962] (-2335.955) (-2331.279) (-2337.190) -- 0:02:01 Average standard deviation of split frequencies: 0.000818 575500 -- [-2332.359] (-2330.586) (-2339.905) (-2332.464) * (-2330.363) (-2337.711) [-2340.856] (-2335.305) -- 0:02:01 576000 -- (-2337.107) (-2333.201) (-2337.327) [-2328.988] * [-2334.673] (-2331.874) (-2335.542) (-2334.920) -- 0:02:01 576500 -- (-2337.695) (-2335.983) (-2338.803) [-2328.818] * (-2335.568) [-2330.834] (-2332.794) (-2341.705) -- 0:02:01 577000 -- (-2341.718) [-2327.726] (-2337.928) (-2333.170) * (-2336.150) [-2330.732] (-2335.349) (-2334.579) -- 0:02:01 577500 -- (-2341.724) (-2331.431) [-2335.103] (-2337.818) * (-2333.235) (-2331.585) (-2332.355) [-2333.943] -- 0:02:01 578000 -- (-2341.858) [-2336.599] (-2333.713) (-2336.466) * (-2339.765) [-2332.281] (-2332.564) (-2328.836) -- 0:02:01 578500 -- (-2337.844) [-2332.980] (-2334.938) (-2335.604) * [-2335.250] (-2332.812) (-2333.820) (-2335.233) -- 0:02:00 579000 -- (-2331.818) (-2337.517) [-2330.399] (-2327.969) * [-2336.166] (-2341.071) (-2335.215) (-2339.322) -- 0:02:00 579500 -- (-2334.052) (-2338.001) [-2331.487] (-2330.164) * [-2330.580] (-2335.930) (-2336.434) (-2335.072) -- 0:02:00 580000 -- (-2339.253) (-2335.814) [-2329.553] (-2338.928) * (-2332.104) [-2332.179] (-2339.305) (-2331.651) -- 0:02:00 Average standard deviation of split frequencies: 0.000541 580500 -- (-2337.376) (-2329.097) (-2331.440) [-2333.265] * [-2337.512] (-2330.595) (-2342.684) (-2332.192) -- 0:02:00 581000 -- [-2331.206] (-2330.907) (-2334.658) (-2336.598) * (-2332.923) (-2336.847) (-2335.112) [-2335.396] -- 0:02:00 581500 -- (-2332.443) [-2329.277] (-2335.695) (-2329.101) * (-2326.930) (-2338.728) (-2333.208) [-2341.698] -- 0:02:00 582000 -- (-2338.458) [-2328.787] (-2335.658) (-2331.145) * (-2331.474) (-2333.293) [-2330.505] (-2337.932) -- 0:01:59 582500 -- (-2339.982) [-2332.059] (-2331.998) (-2333.372) * (-2332.149) (-2337.886) [-2327.597] (-2337.723) -- 0:01:59 583000 -- (-2329.057) (-2343.885) (-2336.449) [-2337.788] * (-2339.326) (-2330.999) [-2328.337] (-2333.464) -- 0:01:59 583500 -- (-2335.505) (-2334.986) [-2329.965] (-2339.002) * (-2336.236) [-2328.340] (-2331.914) (-2335.729) -- 0:01:59 584000 -- [-2334.678] (-2329.807) (-2339.452) (-2338.600) * (-2335.405) (-2327.061) [-2330.489] (-2331.310) -- 0:01:59 584500 -- [-2329.667] (-2330.559) (-2331.515) (-2333.056) * (-2332.171) [-2331.182] (-2333.505) (-2334.547) -- 0:01:59 585000 -- (-2332.285) [-2340.536] (-2338.937) (-2329.740) * [-2342.207] (-2335.412) (-2331.896) (-2329.207) -- 0:01:59 Average standard deviation of split frequencies: 0.000536 585500 -- [-2332.528] (-2328.061) (-2332.352) (-2332.869) * (-2339.350) (-2336.991) [-2336.030] (-2332.295) -- 0:01:58 586000 -- (-2337.809) (-2335.838) [-2330.566] (-2331.736) * (-2341.086) (-2332.782) [-2336.669] (-2335.587) -- 0:01:58 586500 -- (-2333.024) (-2344.273) [-2329.051] (-2332.962) * (-2332.754) (-2337.746) [-2330.618] (-2335.498) -- 0:01:58 587000 -- [-2326.947] (-2344.187) (-2334.260) (-2334.114) * (-2332.697) (-2333.743) (-2335.229) [-2333.314] -- 0:01:58 587500 -- (-2331.463) [-2336.874] (-2333.745) (-2335.244) * [-2332.231] (-2337.365) (-2336.117) (-2343.789) -- 0:01:58 588000 -- (-2341.281) (-2333.142) [-2336.622] (-2331.687) * (-2326.758) (-2335.632) [-2331.255] (-2335.309) -- 0:01:58 588500 -- (-2334.497) (-2329.902) (-2333.018) [-2334.304] * [-2329.985] (-2335.107) (-2333.233) (-2337.106) -- 0:01:58 589000 -- (-2336.845) (-2339.381) [-2332.698] (-2332.044) * (-2338.039) (-2332.340) (-2333.863) [-2334.705] -- 0:01:57 589500 -- (-2330.476) [-2330.490] (-2328.951) (-2331.644) * (-2333.111) [-2332.018] (-2336.788) (-2338.181) -- 0:01:57 590000 -- [-2330.516] (-2331.374) (-2333.624) (-2338.672) * (-2339.973) (-2333.947) [-2341.138] (-2328.598) -- 0:01:57 Average standard deviation of split frequencies: 0.000266 590500 -- (-2340.948) (-2332.624) [-2341.434] (-2338.384) * (-2328.862) [-2327.632] (-2332.498) (-2329.349) -- 0:01:57 591000 -- (-2337.258) (-2332.824) [-2335.112] (-2335.692) * [-2335.112] (-2346.721) (-2333.510) (-2335.719) -- 0:01:57 591500 -- (-2345.095) [-2331.638] (-2333.534) (-2331.903) * (-2331.554) [-2333.437] (-2339.729) (-2332.854) -- 0:01:57 592000 -- (-2336.569) (-2327.795) (-2332.012) [-2335.320] * [-2335.834] (-2333.933) (-2329.837) (-2335.590) -- 0:01:57 592500 -- [-2332.951] (-2331.108) (-2332.000) (-2337.674) * (-2335.017) [-2327.871] (-2330.480) (-2327.786) -- 0:01:56 593000 -- (-2333.469) (-2336.386) (-2338.345) [-2332.752] * [-2330.650] (-2335.577) (-2338.503) (-2328.923) -- 0:01:56 593500 -- (-2330.890) (-2335.374) [-2327.583] (-2331.600) * (-2332.371) (-2327.935) (-2332.829) [-2336.227] -- 0:01:56 594000 -- (-2332.689) (-2338.558) (-2336.299) [-2336.151] * (-2329.238) (-2333.520) [-2334.705] (-2332.979) -- 0:01:56 594500 -- [-2333.524] (-2334.791) (-2334.212) (-2333.252) * (-2334.303) [-2331.217] (-2330.903) (-2331.357) -- 0:01:56 595000 -- [-2337.566] (-2335.445) (-2333.967) (-2332.644) * (-2331.426) [-2328.566] (-2332.029) (-2331.792) -- 0:01:56 Average standard deviation of split frequencies: 0.000264 595500 -- (-2333.778) [-2329.589] (-2335.030) (-2329.273) * [-2336.781] (-2340.982) (-2337.028) (-2334.022) -- 0:01:56 596000 -- (-2337.208) (-2332.104) [-2329.976] (-2340.757) * (-2334.310) (-2333.084) (-2332.261) [-2327.872] -- 0:01:55 596500 -- (-2330.954) [-2333.579] (-2332.894) (-2329.454) * (-2332.200) (-2329.635) (-2340.447) [-2332.011] -- 0:01:55 597000 -- (-2331.811) [-2336.077] (-2334.443) (-2332.622) * (-2334.808) (-2341.016) (-2327.536) [-2330.453] -- 0:01:55 597500 -- (-2333.689) [-2328.480] (-2329.486) (-2335.187) * (-2340.270) [-2332.383] (-2334.516) (-2328.518) -- 0:01:55 598000 -- (-2330.463) [-2334.145] (-2337.880) (-2332.417) * (-2338.079) (-2335.664) [-2325.573] (-2339.255) -- 0:01:55 598500 -- [-2331.341] (-2335.272) (-2340.784) (-2334.404) * [-2333.541] (-2330.442) (-2334.886) (-2337.453) -- 0:01:55 599000 -- [-2333.310] (-2336.530) (-2331.941) (-2338.884) * [-2328.720] (-2330.136) (-2332.524) (-2336.064) -- 0:01:55 599500 -- [-2338.198] (-2331.396) (-2335.268) (-2336.673) * [-2328.636] (-2335.577) (-2330.381) (-2335.188) -- 0:01:54 600000 -- [-2334.686] (-2334.686) (-2337.251) (-2331.716) * [-2333.042] (-2337.038) (-2330.672) (-2332.697) -- 0:01:54 Average standard deviation of split frequencies: 0.000262 600500 -- (-2333.018) (-2330.001) [-2333.802] (-2336.925) * (-2334.880) (-2334.963) (-2337.585) [-2327.288] -- 0:01:54 601000 -- (-2328.851) [-2332.787] (-2339.586) (-2335.657) * (-2331.549) (-2330.354) [-2333.747] (-2330.611) -- 0:01:54 601500 -- [-2330.909] (-2331.752) (-2339.933) (-2331.155) * [-2332.369] (-2336.252) (-2332.093) (-2333.737) -- 0:01:54 602000 -- (-2336.191) (-2337.251) [-2335.119] (-2334.720) * [-2338.776] (-2333.498) (-2328.330) (-2330.450) -- 0:01:54 602500 -- [-2328.588] (-2340.105) (-2335.042) (-2336.722) * [-2340.548] (-2330.437) (-2333.755) (-2327.177) -- 0:01:54 603000 -- (-2331.191) (-2333.414) [-2345.631] (-2338.083) * (-2336.859) [-2333.515] (-2331.681) (-2334.019) -- 0:01:53 603500 -- (-2330.627) (-2329.769) [-2332.720] (-2335.876) * (-2328.094) [-2337.811] (-2330.218) (-2329.257) -- 0:01:53 604000 -- [-2339.629] (-2335.101) (-2331.138) (-2333.750) * (-2332.682) [-2331.370] (-2340.848) (-2330.872) -- 0:01:53 604500 -- (-2334.627) (-2338.957) (-2328.633) [-2335.696] * (-2338.075) (-2335.877) (-2328.680) [-2337.266] -- 0:01:53 605000 -- (-2332.690) [-2330.372] (-2334.663) (-2333.015) * (-2337.574) [-2336.091] (-2328.974) (-2333.692) -- 0:01:53 Average standard deviation of split frequencies: 0.000519 605500 -- (-2333.123) (-2340.210) (-2330.654) [-2331.744] * (-2338.139) (-2335.869) [-2331.945] (-2332.547) -- 0:01:53 606000 -- (-2336.917) (-2333.089) [-2333.693] (-2331.365) * (-2327.119) [-2334.877] (-2333.609) (-2336.115) -- 0:01:53 606500 -- [-2331.372] (-2340.963) (-2329.768) (-2336.793) * (-2332.992) (-2330.578) [-2334.836] (-2335.584) -- 0:01:52 607000 -- [-2335.074] (-2330.901) (-2332.930) (-2332.576) * (-2341.843) (-2330.154) (-2338.399) [-2330.183] -- 0:01:52 607500 -- (-2340.251) [-2344.692] (-2331.248) (-2336.216) * [-2328.729] (-2331.009) (-2326.673) (-2334.129) -- 0:01:52 608000 -- (-2332.007) (-2341.088) [-2326.968] (-2334.006) * [-2329.854] (-2328.066) (-2330.960) (-2332.542) -- 0:01:52 608500 -- [-2329.569] (-2338.518) (-2343.551) (-2335.394) * (-2339.125) [-2327.278] (-2331.054) (-2332.830) -- 0:01:52 609000 -- [-2331.528] (-2338.638) (-2341.789) (-2333.570) * [-2337.188] (-2333.191) (-2327.531) (-2346.227) -- 0:01:52 609500 -- (-2339.382) (-2334.846) (-2335.956) [-2334.367] * (-2337.555) (-2335.316) (-2331.193) [-2331.522] -- 0:01:52 610000 -- (-2330.371) (-2333.291) (-2335.977) [-2327.760] * (-2339.127) [-2337.099] (-2332.716) (-2331.297) -- 0:01:51 Average standard deviation of split frequencies: 0.000515 610500 -- [-2332.722] (-2335.820) (-2334.237) (-2336.893) * (-2333.892) (-2334.288) (-2328.432) [-2336.032] -- 0:01:51 611000 -- (-2334.517) [-2331.144] (-2334.611) (-2334.302) * (-2335.456) [-2330.984] (-2333.153) (-2329.434) -- 0:01:51 611500 -- (-2335.255) (-2334.289) [-2329.400] (-2330.411) * (-2332.811) [-2333.501] (-2329.674) (-2327.773) -- 0:01:51 612000 -- [-2331.922] (-2338.603) (-2330.377) (-2329.095) * (-2327.825) (-2333.609) [-2327.439] (-2327.624) -- 0:01:51 612500 -- (-2333.199) [-2333.531] (-2338.419) (-2339.735) * (-2330.276) [-2334.592] (-2337.921) (-2328.654) -- 0:01:51 613000 -- (-2330.680) (-2331.486) [-2331.108] (-2332.257) * [-2335.435] (-2341.076) (-2330.313) (-2341.950) -- 0:01:51 613500 -- (-2330.098) (-2328.630) [-2335.141] (-2335.468) * [-2337.681] (-2331.359) (-2335.096) (-2340.076) -- 0:01:50 614000 -- [-2334.719] (-2334.447) (-2341.012) (-2334.542) * (-2335.538) (-2335.459) (-2340.899) [-2331.804] -- 0:01:50 614500 -- (-2333.618) (-2328.925) [-2332.574] (-2338.481) * [-2331.248] (-2335.046) (-2332.160) (-2333.476) -- 0:01:50 615000 -- (-2331.995) [-2331.393] (-2330.788) (-2332.499) * (-2332.222) (-2331.545) [-2334.788] (-2333.788) -- 0:01:50 Average standard deviation of split frequencies: 0.000255 615500 -- (-2333.804) (-2336.820) (-2336.347) [-2331.323] * (-2332.450) [-2329.995] (-2335.030) (-2333.322) -- 0:01:50 616000 -- (-2337.017) (-2334.354) (-2334.238) [-2331.464] * (-2331.964) (-2336.319) (-2335.182) [-2336.423] -- 0:01:50 616500 -- (-2337.140) (-2337.513) [-2334.111] (-2333.206) * (-2331.615) (-2334.860) (-2332.214) [-2331.319] -- 0:01:50 617000 -- (-2330.712) (-2334.806) (-2337.485) [-2333.640] * (-2329.889) (-2336.223) (-2334.162) [-2331.015] -- 0:01:49 617500 -- (-2340.314) (-2337.296) (-2336.456) [-2333.170] * [-2333.454] (-2332.657) (-2333.250) (-2336.920) -- 0:01:49 618000 -- (-2336.769) (-2341.252) (-2338.507) [-2331.766] * (-2334.080) (-2331.312) (-2337.677) [-2328.333] -- 0:01:49 618500 -- [-2334.270] (-2330.084) (-2336.288) (-2331.063) * (-2334.033) (-2336.567) (-2332.891) [-2328.751] -- 0:01:49 619000 -- (-2336.063) (-2338.201) (-2328.825) [-2330.752] * (-2329.553) [-2327.194] (-2326.523) (-2334.602) -- 0:01:49 619500 -- (-2329.128) (-2337.717) [-2335.165] (-2329.510) * (-2338.496) (-2330.635) (-2332.198) [-2329.627] -- 0:01:49 620000 -- (-2337.819) (-2332.371) (-2341.786) [-2329.152] * (-2332.149) [-2335.592] (-2331.235) (-2326.362) -- 0:01:49 Average standard deviation of split frequencies: 0.000253 620500 -- (-2328.819) [-2334.537] (-2329.762) (-2332.308) * (-2341.501) (-2329.349) [-2333.738] (-2338.400) -- 0:01:48 621000 -- (-2332.153) (-2333.045) (-2343.527) [-2335.204] * [-2329.777] (-2328.809) (-2327.604) (-2330.927) -- 0:01:48 621500 -- [-2326.928] (-2329.133) (-2339.836) (-2335.538) * (-2334.108) [-2328.177] (-2337.929) (-2332.127) -- 0:01:48 622000 -- [-2330.342] (-2336.614) (-2340.350) (-2329.583) * (-2331.997) [-2330.057] (-2333.721) (-2341.498) -- 0:01:48 622500 -- [-2332.808] (-2335.404) (-2340.661) (-2331.522) * (-2340.125) (-2333.322) [-2327.977] (-2343.868) -- 0:01:48 623000 -- (-2331.735) (-2328.178) [-2327.981] (-2334.400) * (-2337.464) (-2336.250) (-2330.744) [-2335.853] -- 0:01:48 623500 -- (-2332.182) [-2328.137] (-2335.977) (-2331.862) * [-2333.793] (-2332.835) (-2336.609) (-2332.571) -- 0:01:48 624000 -- [-2329.228] (-2333.784) (-2334.265) (-2330.905) * (-2332.447) [-2331.274] (-2329.746) (-2328.884) -- 0:01:47 624500 -- (-2330.418) [-2332.662] (-2332.291) (-2333.952) * (-2331.972) (-2336.582) [-2331.229] (-2328.608) -- 0:01:47 625000 -- [-2328.322] (-2332.615) (-2336.596) (-2336.151) * (-2333.886) [-2336.210] (-2328.481) (-2334.880) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 625500 -- (-2334.128) (-2331.598) [-2328.187] (-2331.537) * (-2331.916) (-2334.167) [-2330.822] (-2332.269) -- 0:01:47 626000 -- (-2331.017) (-2333.717) (-2337.140) [-2336.216] * (-2331.916) (-2336.163) (-2326.704) [-2335.411] -- 0:01:47 626500 -- (-2333.614) [-2331.460] (-2332.946) (-2336.344) * (-2336.162) [-2335.888] (-2330.719) (-2334.165) -- 0:01:47 627000 -- [-2335.593] (-2333.677) (-2330.560) (-2333.500) * (-2332.463) (-2333.235) [-2330.019] (-2331.119) -- 0:01:47 627500 -- (-2335.403) (-2337.008) [-2335.475] (-2328.165) * (-2336.520) (-2331.503) [-2338.026] (-2330.773) -- 0:01:46 628000 -- (-2339.285) [-2329.931] (-2327.518) (-2333.162) * [-2329.914] (-2331.897) (-2338.015) (-2335.552) -- 0:01:46 628500 -- (-2337.482) (-2328.005) [-2329.878] (-2329.887) * (-2334.053) [-2335.657] (-2342.082) (-2331.209) -- 0:01:46 629000 -- (-2332.227) (-2337.121) (-2331.312) [-2330.248] * (-2328.929) (-2332.129) (-2338.251) [-2328.793] -- 0:01:46 629500 -- (-2340.541) (-2334.104) (-2334.567) [-2333.196] * (-2337.644) (-2328.821) (-2335.470) [-2338.321] -- 0:01:46 630000 -- (-2339.379) (-2336.089) (-2325.392) [-2330.419] * [-2332.498] (-2326.871) (-2329.819) (-2335.057) -- 0:01:46 Average standard deviation of split frequencies: 0.000000 630500 -- (-2333.545) [-2332.479] (-2337.079) (-2330.184) * (-2330.727) (-2338.046) (-2330.569) [-2331.089] -- 0:01:46 631000 -- (-2330.518) [-2336.656] (-2334.362) (-2336.145) * (-2334.439) (-2332.571) [-2334.894] (-2331.142) -- 0:01:45 631500 -- (-2330.111) (-2334.830) (-2333.232) [-2331.671] * (-2329.485) [-2331.853] (-2335.592) (-2335.496) -- 0:01:45 632000 -- (-2333.703) (-2337.595) (-2339.568) [-2330.940] * [-2329.321] (-2332.020) (-2335.554) (-2330.170) -- 0:01:45 632500 -- (-2335.014) [-2334.035] (-2332.214) (-2332.855) * (-2327.151) [-2336.631] (-2334.623) (-2333.343) -- 0:01:45 633000 -- (-2328.929) (-2333.124) [-2331.783] (-2328.606) * (-2336.842) (-2335.154) [-2334.800] (-2339.408) -- 0:01:45 633500 -- (-2328.724) [-2332.027] (-2331.451) (-2334.467) * (-2329.283) (-2336.444) [-2329.510] (-2343.672) -- 0:01:45 634000 -- (-2333.357) (-2330.535) [-2332.936] (-2338.194) * (-2340.841) (-2332.845) [-2333.454] (-2335.892) -- 0:01:45 634500 -- (-2331.452) (-2337.025) (-2333.352) [-2334.005] * (-2336.056) (-2331.198) (-2331.994) [-2330.106] -- 0:01:44 635000 -- [-2332.683] (-2341.276) (-2337.386) (-2332.610) * (-2336.645) (-2336.618) [-2333.389] (-2328.964) -- 0:01:44 Average standard deviation of split frequencies: 0.000000 635500 -- (-2330.119) (-2327.236) (-2336.766) [-2326.857] * (-2341.489) [-2341.996] (-2339.793) (-2328.469) -- 0:01:44 636000 -- [-2333.066] (-2333.499) (-2331.369) (-2330.311) * [-2331.737] (-2338.115) (-2341.252) (-2337.486) -- 0:01:44 636500 -- (-2330.860) (-2334.472) (-2335.762) [-2329.164] * [-2331.979] (-2333.812) (-2339.234) (-2326.971) -- 0:01:44 637000 -- (-2334.078) [-2336.250] (-2329.122) (-2334.394) * (-2333.417) (-2328.862) (-2335.090) [-2333.839] -- 0:01:44 637500 -- [-2336.643] (-2335.523) (-2331.913) (-2334.862) * (-2340.176) (-2326.721) [-2335.952] (-2333.889) -- 0:01:44 638000 -- (-2343.508) [-2346.746] (-2339.650) (-2328.106) * (-2339.775) (-2340.787) [-2328.555] (-2333.971) -- 0:01:43 638500 -- (-2332.219) [-2331.194] (-2338.547) (-2330.990) * (-2336.251) (-2335.201) (-2326.545) [-2333.010] -- 0:01:43 639000 -- (-2329.745) (-2337.512) (-2336.122) [-2328.762] * [-2335.378] (-2338.344) (-2332.198) (-2331.697) -- 0:01:43 639500 -- (-2333.320) (-2340.872) [-2331.048] (-2330.547) * (-2331.174) (-2329.067) [-2330.719] (-2329.147) -- 0:01:43 640000 -- (-2333.257) (-2337.058) (-2337.207) [-2337.054] * (-2327.427) [-2329.790] (-2332.872) (-2335.893) -- 0:01:43 Average standard deviation of split frequencies: 0.000000 640500 -- (-2334.415) [-2334.160] (-2328.619) (-2335.035) * (-2329.330) [-2332.151] (-2327.908) (-2342.542) -- 0:01:43 641000 -- (-2332.461) [-2333.927] (-2331.558) (-2333.856) * [-2337.755] (-2329.690) (-2328.219) (-2335.463) -- 0:01:43 641500 -- [-2332.054] (-2332.201) (-2335.624) (-2331.029) * (-2341.755) [-2332.552] (-2332.403) (-2334.401) -- 0:01:42 642000 -- (-2332.869) (-2329.621) (-2334.640) [-2336.272] * (-2335.731) (-2331.550) [-2338.776] (-2332.034) -- 0:01:42 642500 -- [-2337.025] (-2331.317) (-2337.138) (-2336.772) * [-2333.715] (-2332.615) (-2343.809) (-2332.148) -- 0:01:42 643000 -- (-2332.980) (-2329.892) [-2330.230] (-2337.522) * (-2326.193) [-2327.170] (-2330.522) (-2331.417) -- 0:01:42 643500 -- (-2338.115) (-2329.496) [-2336.601] (-2337.640) * (-2327.409) [-2332.690] (-2327.077) (-2335.799) -- 0:01:42 644000 -- [-2336.020] (-2334.169) (-2336.363) (-2330.799) * [-2332.359] (-2336.440) (-2328.172) (-2337.912) -- 0:01:42 644500 -- (-2330.197) (-2336.487) [-2333.634] (-2337.065) * (-2337.815) (-2331.924) [-2337.428] (-2331.808) -- 0:01:42 645000 -- (-2330.821) (-2338.440) [-2334.258] (-2335.796) * [-2333.219] (-2334.448) (-2330.211) (-2326.736) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 645500 -- (-2338.016) [-2331.076] (-2329.098) (-2335.711) * (-2340.721) (-2332.292) [-2329.181] (-2327.481) -- 0:01:41 646000 -- [-2332.818] (-2332.561) (-2348.596) (-2333.933) * (-2340.602) (-2333.487) (-2338.188) [-2331.084] -- 0:01:41 646500 -- (-2332.888) [-2336.694] (-2335.492) (-2338.611) * (-2334.592) [-2334.975] (-2335.020) (-2338.573) -- 0:01:41 647000 -- (-2335.554) (-2333.803) (-2336.919) [-2335.075] * (-2329.533) (-2327.303) (-2329.290) [-2331.458] -- 0:01:41 647500 -- (-2336.815) (-2328.997) [-2331.069] (-2332.440) * (-2335.062) (-2336.008) [-2329.956] (-2331.924) -- 0:01:41 648000 -- (-2333.519) (-2330.565) [-2329.970] (-2329.239) * (-2337.753) (-2337.775) (-2332.641) [-2333.374] -- 0:01:41 648500 -- (-2351.974) (-2341.996) (-2331.504) [-2328.333] * (-2337.344) (-2328.313) [-2332.273] (-2331.316) -- 0:01:40 649000 -- (-2336.633) (-2333.744) [-2333.246] (-2337.827) * (-2336.874) [-2328.583] (-2331.063) (-2332.668) -- 0:01:40 649500 -- (-2328.211) (-2335.109) (-2335.485) [-2335.364] * (-2337.967) [-2331.021] (-2333.037) (-2331.018) -- 0:01:40 650000 -- (-2335.744) [-2333.557] (-2334.842) (-2343.940) * (-2337.850) [-2334.883] (-2335.937) (-2329.440) -- 0:01:40 Average standard deviation of split frequencies: 0.000000 650500 -- (-2339.090) (-2331.775) (-2333.642) [-2330.463] * (-2331.613) [-2341.275] (-2335.705) (-2333.622) -- 0:01:40 651000 -- (-2346.767) (-2334.982) [-2334.896] (-2331.983) * (-2332.467) (-2335.465) (-2337.799) [-2333.508] -- 0:01:40 651500 -- [-2334.303] (-2336.629) (-2334.220) (-2328.528) * [-2336.862] (-2347.128) (-2332.602) (-2330.062) -- 0:01:40 652000 -- (-2334.945) (-2338.018) [-2342.344] (-2337.822) * (-2333.945) (-2335.622) [-2334.832] (-2337.843) -- 0:01:39 652500 -- (-2333.526) (-2342.358) (-2333.479) [-2330.243] * (-2335.258) [-2330.274] (-2332.640) (-2334.557) -- 0:01:39 653000 -- (-2329.202) (-2330.459) [-2330.516] (-2330.694) * [-2332.243] (-2338.629) (-2340.095) (-2334.189) -- 0:01:39 653500 -- [-2334.343] (-2334.053) (-2334.611) (-2333.447) * [-2334.933] (-2335.076) (-2339.765) (-2341.501) -- 0:01:39 654000 -- [-2337.554] (-2335.565) (-2331.783) (-2335.739) * [-2327.337] (-2332.467) (-2328.332) (-2339.762) -- 0:01:39 654500 -- [-2332.640] (-2334.280) (-2334.798) (-2333.566) * [-2333.422] (-2337.391) (-2336.361) (-2337.215) -- 0:01:39 655000 -- (-2328.389) [-2334.251] (-2336.703) (-2336.115) * (-2337.482) (-2337.901) [-2332.386] (-2341.008) -- 0:01:39 Average standard deviation of split frequencies: 0.000240 655500 -- (-2330.208) (-2341.478) (-2326.671) [-2329.322] * [-2335.924] (-2332.820) (-2330.842) (-2338.639) -- 0:01:38 656000 -- (-2331.374) (-2329.629) (-2329.520) [-2327.951] * (-2336.677) (-2334.815) [-2329.797] (-2332.905) -- 0:01:38 656500 -- (-2338.527) (-2332.928) [-2333.329] (-2338.209) * (-2336.015) (-2334.806) [-2333.615] (-2332.424) -- 0:01:38 657000 -- [-2325.728] (-2331.621) (-2328.478) (-2337.520) * [-2332.011] (-2338.375) (-2332.888) (-2333.315) -- 0:01:38 657500 -- (-2328.702) [-2333.105] (-2331.501) (-2339.123) * (-2335.319) (-2335.406) [-2336.015] (-2339.563) -- 0:01:38 658000 -- (-2329.023) [-2335.720] (-2337.339) (-2335.118) * (-2335.284) [-2331.219] (-2329.245) (-2326.995) -- 0:01:38 658500 -- (-2340.404) [-2337.692] (-2337.865) (-2341.879) * (-2332.604) [-2328.484] (-2334.866) (-2331.371) -- 0:01:38 659000 -- (-2331.557) (-2330.645) (-2328.874) [-2333.240] * [-2330.419] (-2334.642) (-2329.911) (-2342.638) -- 0:01:37 659500 -- (-2331.886) (-2345.431) [-2333.161] (-2333.033) * (-2331.348) (-2330.859) (-2334.306) [-2333.691] -- 0:01:37 660000 -- [-2335.209] (-2332.692) (-2337.512) (-2331.941) * (-2334.680) (-2335.564) [-2330.457] (-2327.424) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 660500 -- [-2328.956] (-2342.496) (-2338.277) (-2334.070) * (-2332.117) (-2330.111) (-2332.612) [-2328.264] -- 0:01:37 661000 -- (-2327.828) (-2338.131) [-2333.010] (-2335.860) * [-2331.291] (-2336.636) (-2331.909) (-2328.594) -- 0:01:37 661500 -- (-2333.688) [-2333.919] (-2342.681) (-2335.897) * (-2333.226) (-2336.442) [-2335.302] (-2334.797) -- 0:01:37 662000 -- (-2330.874) (-2336.399) (-2341.891) [-2334.321] * (-2333.692) (-2331.058) (-2328.682) [-2335.960] -- 0:01:37 662500 -- (-2331.819) (-2331.289) (-2330.444) [-2330.598] * (-2329.910) (-2333.021) (-2331.878) [-2329.507] -- 0:01:36 663000 -- [-2337.752] (-2333.171) (-2332.727) (-2330.346) * (-2334.427) (-2331.629) (-2334.072) [-2333.555] -- 0:01:36 663500 -- (-2339.351) [-2328.270] (-2333.972) (-2331.760) * (-2331.495) (-2331.364) (-2329.927) [-2332.137] -- 0:01:36 664000 -- [-2332.593] (-2335.951) (-2336.661) (-2334.546) * (-2330.746) [-2336.287] (-2331.188) (-2335.035) -- 0:01:36 664500 -- (-2336.095) (-2334.666) [-2342.099] (-2328.372) * [-2335.717] (-2332.230) (-2332.923) (-2326.058) -- 0:01:36 665000 -- (-2340.483) (-2335.506) (-2338.937) [-2333.356] * (-2337.523) (-2334.571) (-2330.651) [-2330.101] -- 0:01:36 Average standard deviation of split frequencies: 0.000472 665500 -- (-2338.314) (-2339.535) [-2328.389] (-2331.688) * (-2329.030) (-2330.758) [-2330.374] (-2329.261) -- 0:01:36 666000 -- (-2338.260) [-2337.243] (-2331.239) (-2341.993) * [-2326.357] (-2337.121) (-2333.332) (-2335.674) -- 0:01:35 666500 -- [-2333.083] (-2335.272) (-2332.049) (-2339.256) * [-2329.124] (-2331.183) (-2332.691) (-2336.645) -- 0:01:35 667000 -- (-2329.452) (-2345.021) (-2334.926) [-2330.479] * (-2337.174) (-2340.707) (-2329.724) [-2331.417] -- 0:01:35 667500 -- [-2331.158] (-2337.067) (-2330.346) (-2329.730) * (-2331.511) (-2337.262) [-2330.226] (-2337.599) -- 0:01:35 668000 -- (-2330.176) (-2337.176) [-2338.645] (-2329.124) * (-2328.564) (-2329.768) [-2334.902] (-2337.224) -- 0:01:35 668500 -- [-2341.573] (-2335.053) (-2335.480) (-2332.219) * (-2331.907) (-2341.974) (-2334.552) [-2335.379] -- 0:01:35 669000 -- (-2336.222) (-2329.129) (-2338.426) [-2340.331] * (-2336.744) (-2336.821) (-2336.281) [-2334.132] -- 0:01:34 669500 -- (-2337.260) [-2329.315] (-2337.546) (-2339.290) * (-2336.582) (-2330.528) (-2333.046) [-2335.567] -- 0:01:34 670000 -- (-2328.235) [-2326.334] (-2330.577) (-2331.493) * (-2333.212) (-2336.319) [-2331.884] (-2336.597) -- 0:01:34 Average standard deviation of split frequencies: 0.000469 670500 -- (-2333.135) [-2333.264] (-2331.365) (-2333.091) * [-2337.990] (-2329.687) (-2339.534) (-2327.188) -- 0:01:34 671000 -- (-2337.368) [-2329.017] (-2342.020) (-2336.311) * (-2329.992) (-2331.906) (-2331.108) [-2339.562] -- 0:01:34 671500 -- [-2332.538] (-2337.818) (-2338.132) (-2339.758) * (-2330.886) (-2338.514) (-2330.239) [-2332.887] -- 0:01:34 672000 -- [-2331.197] (-2330.595) (-2331.665) (-2333.647) * [-2334.430] (-2333.203) (-2331.752) (-2328.267) -- 0:01:34 672500 -- (-2328.517) (-2331.122) [-2334.938] (-2338.941) * (-2340.938) [-2332.874] (-2339.789) (-2333.674) -- 0:01:33 673000 -- [-2336.147] (-2331.559) (-2337.459) (-2338.227) * (-2336.818) (-2347.750) [-2329.762] (-2334.916) -- 0:01:33 673500 -- (-2327.198) (-2332.026) [-2326.839] (-2332.130) * (-2331.378) (-2332.668) [-2333.038] (-2326.481) -- 0:01:33 674000 -- (-2340.826) (-2329.187) (-2333.598) [-2338.033] * (-2329.423) [-2330.494] (-2334.654) (-2330.251) -- 0:01:33 674500 -- (-2330.573) [-2333.862] (-2333.543) (-2339.041) * [-2333.867] (-2329.110) (-2330.095) (-2338.555) -- 0:01:33 675000 -- (-2335.689) (-2329.985) (-2334.711) [-2327.605] * (-2331.827) (-2344.299) [-2330.700] (-2330.905) -- 0:01:33 Average standard deviation of split frequencies: 0.000232 675500 -- (-2334.186) (-2331.351) [-2328.438] (-2332.837) * [-2333.288] (-2335.129) (-2327.619) (-2337.020) -- 0:01:33 676000 -- [-2332.972] (-2331.666) (-2337.234) (-2334.566) * (-2331.136) [-2336.709] (-2327.202) (-2334.362) -- 0:01:32 676500 -- (-2336.443) (-2331.112) [-2330.918] (-2331.846) * (-2331.531) (-2335.942) [-2329.288] (-2337.745) -- 0:01:32 677000 -- [-2331.059] (-2331.762) (-2329.328) (-2339.861) * (-2336.059) (-2335.239) [-2332.149] (-2334.282) -- 0:01:32 677500 -- (-2328.467) [-2328.410] (-2327.815) (-2329.656) * (-2334.207) (-2329.348) (-2328.111) [-2329.369] -- 0:01:32 678000 -- (-2333.335) (-2336.579) (-2340.089) [-2330.580] * (-2336.158) (-2340.081) [-2332.296] (-2342.920) -- 0:01:32 678500 -- (-2340.629) (-2341.338) (-2332.119) [-2337.412] * (-2333.387) (-2336.595) [-2331.339] (-2337.045) -- 0:01:32 679000 -- (-2331.378) (-2335.337) [-2335.331] (-2334.162) * (-2334.457) [-2337.404] (-2333.395) (-2334.864) -- 0:01:32 679500 -- (-2328.651) (-2335.172) (-2330.495) [-2333.599] * (-2332.349) [-2338.442] (-2338.500) (-2336.023) -- 0:01:31 680000 -- (-2332.970) (-2332.294) [-2333.997] (-2331.253) * (-2338.233) [-2331.745] (-2333.153) (-2336.324) -- 0:01:31 Average standard deviation of split frequencies: 0.000693 680500 -- (-2331.012) (-2330.900) [-2335.527] (-2329.426) * (-2326.674) (-2329.919) (-2334.127) [-2333.316] -- 0:01:31 681000 -- (-2337.588) [-2332.833] (-2330.684) (-2328.970) * (-2333.435) (-2343.882) [-2332.011] (-2336.308) -- 0:01:31 681500 -- (-2332.843) (-2335.204) (-2334.974) [-2333.698] * (-2335.466) (-2336.163) (-2326.109) [-2329.645] -- 0:01:31 682000 -- (-2336.388) (-2343.396) (-2330.854) [-2329.267] * [-2335.140] (-2330.115) (-2332.444) (-2336.729) -- 0:01:31 682500 -- [-2330.885] (-2331.190) (-2328.479) (-2332.064) * (-2330.653) [-2331.017] (-2336.221) (-2330.307) -- 0:01:31 683000 -- (-2332.317) [-2336.985] (-2330.952) (-2340.042) * (-2330.993) (-2331.684) [-2341.325] (-2326.947) -- 0:01:30 683500 -- (-2328.575) (-2333.845) (-2333.888) [-2328.940] * (-2343.060) (-2336.680) [-2342.959] (-2331.864) -- 0:01:30 684000 -- (-2337.250) [-2328.140] (-2332.984) (-2336.374) * (-2342.390) (-2334.116) (-2341.384) [-2332.076] -- 0:01:30 684500 -- (-2335.382) (-2337.046) (-2345.577) [-2330.486] * (-2339.513) (-2332.481) [-2332.768] (-2333.559) -- 0:01:30 685000 -- (-2333.766) [-2334.550] (-2327.460) (-2338.374) * (-2329.424) (-2341.060) [-2326.415] (-2334.352) -- 0:01:30 Average standard deviation of split frequencies: 0.000458 685500 -- (-2341.971) (-2332.675) [-2329.527] (-2337.245) * (-2335.617) (-2332.471) [-2331.230] (-2336.984) -- 0:01:30 686000 -- (-2343.445) (-2336.819) [-2328.927] (-2331.719) * (-2334.258) (-2336.083) (-2330.639) [-2330.986] -- 0:01:30 686500 -- (-2331.991) (-2337.127) (-2332.094) [-2332.993] * [-2329.607] (-2331.776) (-2334.357) (-2335.161) -- 0:01:29 687000 -- (-2334.269) (-2340.551) [-2332.269] (-2336.090) * (-2329.733) (-2336.349) (-2337.741) [-2331.540] -- 0:01:29 687500 -- (-2347.022) (-2335.431) [-2330.036] (-2339.515) * [-2328.794] (-2338.513) (-2337.900) (-2332.852) -- 0:01:29 688000 -- (-2332.564) (-2336.420) [-2335.219] (-2332.481) * [-2330.213] (-2348.295) (-2329.061) (-2334.833) -- 0:01:29 688500 -- (-2331.760) [-2331.292] (-2331.239) (-2334.498) * (-2333.706) (-2334.263) [-2331.047] (-2337.201) -- 0:01:29 689000 -- [-2330.684] (-2328.746) (-2324.387) (-2340.280) * [-2329.847] (-2331.346) (-2337.132) (-2334.275) -- 0:01:29 689500 -- (-2332.749) (-2335.792) [-2330.975] (-2346.787) * [-2331.487] (-2327.302) (-2333.421) (-2331.335) -- 0:01:29 690000 -- (-2334.104) (-2329.930) [-2328.552] (-2342.005) * (-2335.642) [-2333.026] (-2330.279) (-2335.989) -- 0:01:28 Average standard deviation of split frequencies: 0.000455 690500 -- (-2334.898) [-2331.791] (-2332.819) (-2325.716) * [-2330.504] (-2329.409) (-2334.314) (-2333.661) -- 0:01:28 691000 -- (-2339.449) (-2341.049) (-2328.048) [-2337.046] * (-2327.315) [-2342.085] (-2339.184) (-2331.380) -- 0:01:28 691500 -- (-2333.527) [-2335.740] (-2331.370) (-2336.554) * (-2338.113) (-2333.160) (-2333.902) [-2329.662] -- 0:01:28 692000 -- (-2329.121) [-2334.066] (-2329.632) (-2329.649) * [-2331.083] (-2329.098) (-2332.595) (-2334.938) -- 0:01:28 692500 -- [-2330.366] (-2332.488) (-2335.762) (-2340.677) * (-2329.047) (-2328.081) [-2331.417] (-2337.713) -- 0:01:28 693000 -- [-2330.149] (-2335.285) (-2338.731) (-2333.022) * [-2331.824] (-2331.569) (-2330.199) (-2337.231) -- 0:01:28 693500 -- [-2325.504] (-2333.246) (-2335.995) (-2336.747) * (-2333.981) [-2329.312] (-2332.511) (-2331.884) -- 0:01:27 694000 -- (-2329.341) (-2335.774) [-2331.516] (-2330.662) * (-2329.556) (-2331.053) [-2335.419] (-2327.315) -- 0:01:27 694500 -- (-2330.681) [-2333.541] (-2336.125) (-2331.522) * (-2335.863) (-2333.812) (-2331.640) [-2333.658] -- 0:01:27 695000 -- (-2336.434) (-2331.675) [-2337.683] (-2336.186) * [-2344.134] (-2335.121) (-2337.608) (-2330.761) -- 0:01:27 Average standard deviation of split frequencies: 0.000903 695500 -- (-2340.650) (-2331.151) [-2331.595] (-2330.456) * (-2335.145) [-2340.033] (-2329.436) (-2338.331) -- 0:01:27 696000 -- [-2330.515] (-2336.611) (-2333.894) (-2338.966) * (-2345.633) (-2332.037) [-2328.787] (-2336.916) -- 0:01:27 696500 -- (-2331.842) (-2349.285) (-2338.323) [-2333.028] * (-2332.692) [-2328.578] (-2336.091) (-2331.383) -- 0:01:27 697000 -- (-2330.404) (-2333.078) [-2334.726] (-2336.174) * [-2332.619] (-2335.345) (-2331.678) (-2330.549) -- 0:01:26 697500 -- (-2334.518) (-2336.161) (-2333.550) [-2327.229] * [-2329.549] (-2331.878) (-2328.430) (-2333.946) -- 0:01:26 698000 -- (-2330.883) (-2332.472) [-2329.277] (-2329.700) * [-2336.055] (-2329.452) (-2328.657) (-2344.363) -- 0:01:26 698500 -- (-2330.868) [-2333.737] (-2335.744) (-2334.946) * (-2336.236) [-2331.310] (-2333.372) (-2325.639) -- 0:01:26 699000 -- (-2338.876) [-2327.167] (-2335.615) (-2342.916) * (-2334.807) [-2330.524] (-2334.239) (-2337.112) -- 0:01:26 699500 -- (-2330.938) (-2332.547) (-2332.719) [-2334.911] * (-2334.425) (-2333.072) [-2325.977] (-2331.015) -- 0:01:26 700000 -- (-2335.035) (-2333.860) [-2337.090] (-2338.200) * [-2329.839] (-2337.267) (-2330.893) (-2330.828) -- 0:01:26 Average standard deviation of split frequencies: 0.001121 700500 -- (-2342.276) (-2331.102) [-2330.551] (-2334.948) * (-2342.691) (-2333.674) [-2331.949] (-2339.310) -- 0:01:25 701000 -- [-2335.725] (-2330.291) (-2342.493) (-2332.371) * (-2331.946) (-2338.466) [-2332.863] (-2328.105) -- 0:01:25 701500 -- [-2342.277] (-2332.274) (-2335.373) (-2336.779) * (-2336.917) (-2335.319) [-2332.278] (-2332.223) -- 0:01:25 702000 -- [-2332.825] (-2329.474) (-2341.731) (-2332.733) * [-2334.128] (-2336.447) (-2333.153) (-2335.969) -- 0:01:25 702500 -- (-2329.211) (-2334.140) [-2330.169] (-2333.763) * [-2330.914] (-2338.736) (-2329.498) (-2332.218) -- 0:01:25 703000 -- [-2338.414] (-2339.622) (-2333.414) (-2336.094) * (-2327.075) (-2327.812) [-2331.372] (-2331.955) -- 0:01:25 703500 -- (-2328.742) (-2336.134) (-2335.748) [-2328.440] * (-2338.937) [-2332.446] (-2328.379) (-2333.009) -- 0:01:25 704000 -- (-2333.223) (-2327.127) (-2340.613) [-2330.144] * (-2340.131) (-2329.889) (-2328.797) [-2336.192] -- 0:01:24 704500 -- (-2331.069) [-2331.890] (-2333.865) (-2331.304) * [-2330.445] (-2343.256) (-2331.243) (-2338.983) -- 0:01:24 705000 -- [-2328.767] (-2333.034) (-2333.913) (-2333.947) * (-2334.896) (-2330.862) [-2332.980] (-2337.728) -- 0:01:24 Average standard deviation of split frequencies: 0.001558 705500 -- [-2333.572] (-2339.922) (-2337.459) (-2327.488) * (-2334.694) (-2338.731) [-2331.055] (-2330.574) -- 0:01:24 706000 -- (-2345.234) [-2330.217] (-2333.724) (-2338.172) * (-2341.848) (-2330.851) [-2336.890] (-2330.658) -- 0:01:24 706500 -- (-2331.999) [-2333.400] (-2334.094) (-2341.959) * (-2334.651) [-2334.992] (-2331.036) (-2334.453) -- 0:01:24 707000 -- [-2329.031] (-2330.811) (-2338.393) (-2339.297) * (-2331.478) (-2335.475) [-2334.115] (-2337.355) -- 0:01:24 707500 -- [-2327.856] (-2330.506) (-2333.662) (-2334.349) * (-2333.910) (-2345.603) (-2327.676) [-2336.138] -- 0:01:23 708000 -- [-2331.637] (-2332.494) (-2342.303) (-2340.637) * [-2335.238] (-2334.337) (-2334.526) (-2339.314) -- 0:01:23 708500 -- (-2334.899) (-2336.507) (-2337.185) [-2333.229] * (-2328.914) (-2331.632) [-2334.547] (-2335.886) -- 0:01:23 709000 -- (-2333.262) (-2348.147) [-2335.782] (-2330.382) * (-2338.108) (-2327.328) [-2332.585] (-2331.113) -- 0:01:23 709500 -- [-2334.288] (-2335.712) (-2333.184) (-2341.240) * (-2328.645) (-2337.874) (-2331.669) [-2336.307] -- 0:01:23 710000 -- (-2329.679) (-2335.147) (-2337.412) [-2329.446] * (-2329.320) (-2331.346) (-2330.414) [-2332.567] -- 0:01:23 Average standard deviation of split frequencies: 0.001327 710500 -- (-2337.446) [-2337.617] (-2333.588) (-2335.369) * (-2333.683) [-2336.798] (-2332.879) (-2334.210) -- 0:01:23 711000 -- (-2330.673) [-2332.294] (-2331.243) (-2334.102) * (-2335.132) (-2331.762) (-2337.374) [-2331.632] -- 0:01:22 711500 -- (-2348.314) (-2335.849) (-2327.163) [-2333.785] * (-2344.785) (-2340.294) (-2332.992) [-2331.857] -- 0:01:22 712000 -- [-2329.969] (-2342.317) (-2333.397) (-2327.445) * (-2337.903) (-2329.259) [-2341.407] (-2337.080) -- 0:01:22 712500 -- [-2335.473] (-2328.404) (-2332.964) (-2332.929) * (-2332.776) (-2331.377) [-2332.735] (-2336.143) -- 0:01:22 713000 -- (-2340.075) [-2331.352] (-2335.313) (-2334.067) * [-2328.386] (-2336.187) (-2334.652) (-2332.484) -- 0:01:22 713500 -- (-2334.606) [-2329.448] (-2340.990) (-2331.987) * (-2333.298) [-2326.779] (-2332.599) (-2335.518) -- 0:01:22 714000 -- [-2329.828] (-2329.051) (-2333.185) (-2330.464) * (-2333.965) (-2337.056) (-2332.602) [-2329.619] -- 0:01:22 714500 -- (-2332.582) (-2331.511) (-2330.644) [-2333.220] * [-2331.199] (-2331.522) (-2337.777) (-2336.707) -- 0:01:21 715000 -- (-2334.884) (-2345.158) (-2334.203) [-2338.560] * (-2333.385) [-2328.835] (-2346.362) (-2332.961) -- 0:01:21 Average standard deviation of split frequencies: 0.001317 715500 -- (-2331.410) (-2338.461) (-2332.906) [-2328.268] * (-2340.575) [-2332.526] (-2335.439) (-2333.375) -- 0:01:21 716000 -- [-2331.488] (-2331.315) (-2332.313) (-2332.233) * (-2335.412) (-2335.388) (-2338.740) [-2334.315] -- 0:01:21 716500 -- (-2332.148) [-2326.178] (-2331.988) (-2337.431) * (-2337.640) [-2330.131] (-2328.889) (-2331.006) -- 0:01:21 717000 -- (-2332.685) (-2326.272) [-2329.840] (-2337.054) * [-2329.133] (-2328.787) (-2333.035) (-2331.800) -- 0:01:21 717500 -- (-2328.352) [-2332.245] (-2336.748) (-2335.249) * (-2332.579) (-2337.182) (-2338.622) [-2331.896] -- 0:01:21 718000 -- [-2331.603] (-2340.689) (-2342.476) (-2336.417) * (-2329.223) (-2340.896) (-2341.944) [-2326.980] -- 0:01:20 718500 -- (-2332.431) (-2341.605) (-2331.444) [-2336.191] * (-2334.737) (-2340.508) [-2328.347] (-2338.416) -- 0:01:20 719000 -- (-2335.137) [-2332.618] (-2337.407) (-2328.936) * [-2332.729] (-2342.224) (-2331.249) (-2330.289) -- 0:01:20 719500 -- [-2332.156] (-2331.263) (-2333.183) (-2332.381) * (-2332.271) (-2330.343) (-2332.583) [-2330.489] -- 0:01:20 720000 -- (-2339.635) [-2343.080] (-2335.355) (-2336.931) * [-2334.523] (-2337.249) (-2329.315) (-2329.814) -- 0:01:20 Average standard deviation of split frequencies: 0.001526 720500 -- [-2333.601] (-2332.415) (-2334.766) (-2334.237) * (-2329.789) (-2341.531) [-2331.182] (-2332.528) -- 0:01:20 721000 -- (-2333.314) (-2332.412) [-2328.322] (-2338.372) * (-2335.958) (-2328.470) [-2330.198] (-2334.959) -- 0:01:20 721500 -- (-2329.445) (-2328.217) [-2333.365] (-2339.646) * (-2328.059) [-2328.276] (-2327.939) (-2328.474) -- 0:01:19 722000 -- (-2333.334) (-2334.460) (-2332.946) [-2332.335] * [-2332.390] (-2330.339) (-2336.276) (-2332.842) -- 0:01:19 722500 -- (-2331.131) (-2331.876) [-2335.048] (-2330.505) * [-2334.921] (-2332.215) (-2343.872) (-2330.990) -- 0:01:19 723000 -- [-2338.368] (-2327.646) (-2335.670) (-2326.813) * (-2331.062) (-2338.479) (-2349.070) [-2333.672] -- 0:01:19 723500 -- (-2333.887) (-2328.281) [-2327.796] (-2337.129) * (-2330.194) (-2343.873) [-2330.710] (-2333.913) -- 0:01:19 724000 -- [-2332.776] (-2342.957) (-2332.798) (-2334.015) * (-2329.435) (-2337.118) [-2328.637] (-2330.699) -- 0:01:19 724500 -- (-2325.842) (-2332.054) [-2329.428] (-2329.568) * [-2333.331] (-2336.727) (-2339.065) (-2327.478) -- 0:01:19 725000 -- [-2329.657] (-2334.441) (-2336.390) (-2332.218) * [-2337.845] (-2334.118) (-2328.123) (-2333.827) -- 0:01:18 Average standard deviation of split frequencies: 0.001515 725500 -- (-2333.781) [-2329.683] (-2333.838) (-2333.938) * (-2333.963) [-2331.842] (-2326.011) (-2334.577) -- 0:01:18 726000 -- (-2340.296) (-2328.824) [-2338.383] (-2328.730) * (-2335.022) (-2330.234) [-2331.370] (-2340.010) -- 0:01:18 726500 -- (-2332.677) (-2335.609) [-2330.139] (-2330.466) * (-2332.497) (-2329.177) (-2332.370) [-2336.463] -- 0:01:18 727000 -- (-2328.290) (-2329.230) (-2330.802) [-2336.782] * (-2331.511) [-2332.321] (-2335.917) (-2347.494) -- 0:01:18 727500 -- (-2332.345) [-2325.469] (-2327.013) (-2335.184) * [-2329.290] (-2328.111) (-2333.780) (-2337.538) -- 0:01:18 728000 -- [-2333.849] (-2337.582) (-2332.527) (-2326.746) * (-2332.391) (-2335.591) [-2336.316] (-2333.572) -- 0:01:18 728500 -- [-2327.746] (-2336.588) (-2325.131) (-2331.581) * (-2332.664) (-2329.029) [-2327.131] (-2335.773) -- 0:01:17 729000 -- [-2330.280] (-2339.884) (-2328.585) (-2332.319) * (-2330.326) (-2337.307) (-2329.941) [-2332.123] -- 0:01:17 729500 -- (-2334.519) [-2337.851] (-2333.588) (-2334.356) * [-2330.762] (-2331.464) (-2332.324) (-2332.238) -- 0:01:17 730000 -- [-2332.266] (-2336.342) (-2334.032) (-2331.546) * [-2331.236] (-2333.522) (-2332.143) (-2335.534) -- 0:01:17 Average standard deviation of split frequencies: 0.001505 730500 -- (-2337.843) (-2335.570) (-2338.521) [-2333.754] * [-2330.718] (-2330.890) (-2334.408) (-2342.597) -- 0:01:17 731000 -- (-2328.295) [-2329.191] (-2331.690) (-2340.195) * (-2329.077) [-2333.042] (-2340.497) (-2335.902) -- 0:01:17 731500 -- (-2329.553) (-2332.446) [-2331.948] (-2334.134) * [-2335.931] (-2337.527) (-2330.913) (-2341.298) -- 0:01:17 732000 -- (-2333.829) (-2328.048) (-2336.817) [-2331.136] * (-2335.664) (-2337.326) [-2333.210] (-2330.374) -- 0:01:16 732500 -- [-2326.636] (-2338.152) (-2341.081) (-2334.825) * (-2336.726) (-2330.351) [-2327.684] (-2327.988) -- 0:01:16 733000 -- (-2331.708) [-2332.295] (-2335.615) (-2332.321) * [-2329.728] (-2337.965) (-2342.304) (-2333.542) -- 0:01:16 733500 -- (-2339.525) (-2331.002) [-2328.184] (-2332.975) * (-2328.581) (-2329.650) [-2331.034] (-2334.331) -- 0:01:16 734000 -- (-2333.733) (-2336.867) [-2333.832] (-2335.889) * (-2338.573) (-2335.442) [-2328.565] (-2328.289) -- 0:01:16 734500 -- (-2333.202) (-2338.427) (-2337.282) [-2340.521] * [-2333.890] (-2333.621) (-2334.178) (-2333.243) -- 0:01:16 735000 -- (-2327.233) (-2342.623) [-2339.218] (-2331.546) * (-2331.887) (-2334.492) [-2332.340] (-2340.746) -- 0:01:16 Average standard deviation of split frequencies: 0.001494 735500 -- (-2329.811) (-2336.124) [-2331.535] (-2340.053) * (-2332.111) [-2335.518] (-2338.589) (-2333.450) -- 0:01:15 736000 -- (-2333.263) [-2334.161] (-2335.656) (-2333.702) * (-2337.059) [-2337.410] (-2327.850) (-2337.448) -- 0:01:15 736500 -- (-2329.481) (-2334.942) (-2340.019) [-2333.417] * (-2336.268) (-2337.460) (-2338.487) [-2332.348] -- 0:01:15 737000 -- (-2327.275) (-2335.900) (-2334.949) [-2336.981] * (-2344.988) (-2330.104) (-2345.458) [-2330.804] -- 0:01:15 737500 -- (-2334.305) (-2336.411) (-2330.387) [-2337.106] * (-2341.493) [-2338.539] (-2337.225) (-2336.219) -- 0:01:15 738000 -- (-2333.025) (-2338.012) (-2332.073) [-2330.380] * (-2339.549) (-2338.924) [-2338.097] (-2335.223) -- 0:01:15 738500 -- [-2333.901] (-2332.020) (-2333.334) (-2334.514) * (-2341.727) (-2337.951) [-2330.574] (-2332.655) -- 0:01:15 739000 -- (-2330.783) [-2332.902] (-2334.521) (-2339.963) * [-2331.982] (-2336.564) (-2332.614) (-2335.671) -- 0:01:14 739500 -- (-2330.691) (-2328.601) [-2326.875] (-2334.497) * [-2340.356] (-2330.662) (-2335.620) (-2344.675) -- 0:01:14 740000 -- (-2331.165) [-2331.411] (-2333.282) (-2330.420) * (-2332.799) (-2333.111) (-2348.845) [-2332.461] -- 0:01:14 Average standard deviation of split frequencies: 0.001909 740500 -- [-2328.978] (-2331.374) (-2332.169) (-2340.058) * [-2332.157] (-2330.404) (-2354.063) (-2337.689) -- 0:01:14 741000 -- (-2345.423) (-2336.904) [-2332.904] (-2338.208) * [-2337.759] (-2334.600) (-2335.028) (-2344.760) -- 0:01:14 741500 -- (-2338.373) (-2330.114) [-2328.948] (-2332.451) * (-2344.084) [-2333.198] (-2338.861) (-2332.982) -- 0:01:14 742000 -- [-2331.704] (-2330.112) (-2331.287) (-2333.195) * (-2346.586) [-2337.896] (-2343.545) (-2338.213) -- 0:01:14 742500 -- (-2336.727) (-2336.117) (-2333.233) [-2332.795] * (-2341.610) (-2333.515) [-2338.629] (-2344.672) -- 0:01:13 743000 -- (-2339.228) (-2340.544) (-2338.150) [-2332.660] * (-2331.825) (-2328.901) [-2333.717] (-2330.629) -- 0:01:13 743500 -- (-2338.285) (-2335.965) [-2330.153] (-2327.373) * [-2329.784] (-2332.286) (-2329.638) (-2327.344) -- 0:01:13 744000 -- [-2330.611] (-2331.122) (-2336.336) (-2326.740) * (-2337.068) [-2334.599] (-2329.327) (-2330.510) -- 0:01:13 744500 -- (-2336.554) [-2331.236] (-2327.861) (-2330.050) * (-2331.350) (-2346.858) (-2335.205) [-2330.844] -- 0:01:13 745000 -- (-2333.450) [-2334.049] (-2334.441) (-2331.170) * (-2328.532) [-2330.947] (-2330.214) (-2333.254) -- 0:01:13 Average standard deviation of split frequencies: 0.001896 745500 -- (-2330.404) [-2340.989] (-2329.880) (-2337.601) * (-2336.625) (-2331.395) (-2337.103) [-2330.025] -- 0:01:13 746000 -- (-2340.912) (-2337.847) [-2331.554] (-2329.540) * (-2330.645) (-2332.358) (-2335.768) [-2335.657] -- 0:01:12 746500 -- [-2332.885] (-2341.082) (-2329.447) (-2327.733) * [-2339.730] (-2336.504) (-2336.457) (-2337.580) -- 0:01:12 747000 -- (-2333.665) [-2328.155] (-2333.743) (-2332.112) * (-2336.612) (-2331.273) (-2333.146) [-2328.591] -- 0:01:12 747500 -- (-2331.675) [-2336.103] (-2335.991) (-2332.830) * [-2333.872] (-2333.654) (-2337.470) (-2329.760) -- 0:01:12 748000 -- [-2331.760] (-2330.575) (-2334.375) (-2334.982) * (-2329.950) [-2328.835] (-2337.105) (-2329.259) -- 0:01:12 748500 -- (-2335.646) (-2331.877) [-2332.436] (-2336.427) * (-2333.524) [-2335.257] (-2335.460) (-2338.036) -- 0:01:12 749000 -- (-2341.178) (-2335.187) [-2335.163] (-2334.406) * (-2335.503) (-2330.175) (-2332.876) [-2335.238] -- 0:01:12 749500 -- (-2344.704) (-2336.066) [-2342.330] (-2329.438) * (-2335.692) [-2332.183] (-2342.195) (-2328.545) -- 0:01:11 750000 -- (-2335.763) [-2327.457] (-2338.876) (-2336.012) * (-2334.712) (-2333.258) (-2332.053) [-2331.090] -- 0:01:11 Average standard deviation of split frequencies: 0.002093 750500 -- [-2333.477] (-2348.149) (-2336.183) (-2332.174) * (-2335.717) [-2326.328] (-2339.347) (-2327.480) -- 0:01:11 751000 -- (-2333.834) (-2333.950) (-2339.658) [-2331.926] * [-2329.106] (-2336.886) (-2337.434) (-2331.580) -- 0:01:11 751500 -- (-2332.454) (-2331.760) (-2338.505) [-2327.914] * (-2330.336) [-2331.467] (-2338.305) (-2342.693) -- 0:01:11 752000 -- (-2336.201) (-2338.767) (-2335.101) [-2333.738] * [-2334.920] (-2334.607) (-2337.275) (-2336.059) -- 0:01:11 752500 -- [-2336.005] (-2337.054) (-2335.558) (-2330.476) * (-2331.330) (-2334.234) [-2341.088] (-2332.726) -- 0:01:11 753000 -- [-2331.754] (-2330.714) (-2333.058) (-2339.583) * (-2330.818) (-2331.231) (-2336.586) [-2330.413] -- 0:01:10 753500 -- (-2331.790) [-2332.637] (-2332.477) (-2339.105) * (-2332.043) [-2329.738] (-2337.380) (-2328.877) -- 0:01:10 754000 -- (-2333.047) [-2327.411] (-2338.988) (-2327.499) * (-2330.614) (-2331.557) [-2335.663] (-2332.531) -- 0:01:10 754500 -- (-2328.598) [-2328.514] (-2339.906) (-2332.206) * (-2337.414) (-2332.415) (-2339.520) [-2330.136] -- 0:01:10 755000 -- (-2332.967) (-2334.840) [-2332.350] (-2335.448) * (-2327.176) (-2330.542) [-2332.844] (-2336.563) -- 0:01:10 Average standard deviation of split frequencies: 0.001871 755500 -- (-2333.435) (-2338.944) [-2334.164] (-2334.165) * (-2331.979) [-2334.310] (-2329.813) (-2333.855) -- 0:01:10 756000 -- (-2327.949) [-2334.327] (-2338.425) (-2337.096) * [-2332.719] (-2332.579) (-2335.925) (-2332.354) -- 0:01:10 756500 -- (-2329.541) (-2333.939) [-2338.705] (-2328.733) * (-2336.194) (-2330.606) (-2330.874) [-2330.592] -- 0:01:09 757000 -- (-2345.035) [-2329.269] (-2338.975) (-2334.490) * (-2332.767) (-2331.818) [-2327.008] (-2330.250) -- 0:01:09 757500 -- (-2336.650) (-2331.023) [-2333.242] (-2326.888) * (-2331.577) (-2332.424) (-2343.137) [-2329.871] -- 0:01:09 758000 -- (-2328.199) (-2337.252) [-2327.441] (-2329.506) * [-2329.258] (-2343.885) (-2333.247) (-2331.710) -- 0:01:09 758500 -- (-2328.700) (-2337.526) (-2329.683) [-2330.045] * (-2332.589) (-2331.107) (-2340.390) [-2331.589] -- 0:01:09 759000 -- (-2335.328) (-2329.472) (-2333.759) [-2329.059] * (-2334.904) [-2329.074] (-2333.668) (-2330.834) -- 0:01:09 759500 -- (-2327.047) [-2329.477] (-2334.222) (-2330.762) * (-2331.287) (-2339.372) [-2332.972] (-2334.949) -- 0:01:09 760000 -- [-2330.750] (-2339.653) (-2331.058) (-2332.678) * (-2330.778) [-2332.119] (-2329.375) (-2333.238) -- 0:01:08 Average standard deviation of split frequencies: 0.001859 760500 -- (-2333.902) [-2328.399] (-2329.944) (-2338.135) * (-2330.558) (-2339.167) (-2336.724) [-2338.365] -- 0:01:08 761000 -- [-2329.331] (-2330.980) (-2333.421) (-2331.186) * (-2328.904) (-2344.007) (-2339.586) [-2339.288] -- 0:01:08 761500 -- (-2334.027) [-2333.866] (-2333.155) (-2339.835) * (-2337.242) [-2342.556] (-2339.382) (-2330.271) -- 0:01:08 762000 -- (-2334.330) [-2331.705] (-2336.184) (-2335.583) * [-2338.904] (-2335.379) (-2334.446) (-2335.142) -- 0:01:08 762500 -- (-2332.501) (-2333.672) [-2334.516] (-2338.190) * (-2335.654) [-2330.154] (-2331.826) (-2339.004) -- 0:01:08 763000 -- (-2336.693) (-2333.503) (-2330.642) [-2333.256] * [-2329.098] (-2328.530) (-2332.867) (-2327.785) -- 0:01:08 763500 -- (-2332.979) (-2331.295) [-2330.879] (-2338.265) * [-2325.388] (-2332.039) (-2332.361) (-2334.895) -- 0:01:07 764000 -- (-2332.357) (-2336.812) [-2329.019] (-2336.109) * [-2324.831] (-2343.156) (-2334.206) (-2338.274) -- 0:01:07 764500 -- (-2337.541) [-2329.949] (-2330.801) (-2335.453) * [-2331.900] (-2336.975) (-2332.068) (-2333.138) -- 0:01:07 765000 -- [-2332.633] (-2337.857) (-2335.769) (-2333.612) * (-2341.450) [-2332.785] (-2337.779) (-2330.379) -- 0:01:07 Average standard deviation of split frequencies: 0.001641 765500 -- (-2329.534) (-2339.310) [-2331.803] (-2339.278) * (-2342.256) (-2334.959) [-2333.024] (-2339.379) -- 0:01:07 766000 -- (-2331.853) (-2331.774) [-2337.300] (-2329.293) * (-2339.979) (-2342.504) (-2336.150) [-2336.462] -- 0:01:07 766500 -- (-2334.789) (-2332.274) (-2337.657) [-2334.416] * (-2341.926) [-2335.061] (-2334.715) (-2328.237) -- 0:01:07 767000 -- (-2346.743) (-2332.279) (-2339.516) [-2330.563] * (-2332.814) (-2331.723) [-2334.399] (-2337.370) -- 0:01:06 767500 -- [-2333.352] (-2333.255) (-2332.762) (-2341.731) * (-2340.625) (-2325.852) (-2334.279) [-2336.708] -- 0:01:06 768000 -- (-2345.707) [-2330.520] (-2338.041) (-2333.685) * (-2329.823) (-2331.368) [-2337.378] (-2329.969) -- 0:01:06 768500 -- (-2342.932) [-2330.487] (-2334.672) (-2332.997) * (-2331.816) (-2336.091) (-2338.851) [-2326.880] -- 0:01:06 769000 -- (-2336.819) (-2333.086) (-2332.724) [-2329.504] * (-2330.104) (-2336.650) [-2334.678] (-2332.739) -- 0:01:06 769500 -- (-2331.914) (-2334.846) [-2331.352] (-2329.006) * (-2330.391) (-2331.680) (-2333.133) [-2330.721] -- 0:01:06 770000 -- (-2328.159) (-2334.243) [-2330.561] (-2333.261) * (-2331.079) (-2341.745) [-2332.243] (-2332.560) -- 0:01:06 Average standard deviation of split frequencies: 0.001631 770500 -- [-2331.277] (-2330.106) (-2345.832) (-2326.842) * (-2334.760) [-2329.545] (-2330.280) (-2332.314) -- 0:01:05 771000 -- (-2338.104) (-2332.575) (-2337.683) [-2337.460] * (-2329.446) [-2328.014] (-2333.888) (-2332.107) -- 0:01:05 771500 -- (-2334.234) (-2331.143) [-2330.477] (-2332.019) * [-2341.348] (-2337.786) (-2333.557) (-2337.874) -- 0:01:05 772000 -- [-2336.837] (-2333.423) (-2328.682) (-2325.058) * (-2343.128) (-2334.077) (-2329.551) [-2331.095] -- 0:01:05 772500 -- [-2332.494] (-2333.001) (-2331.484) (-2331.711) * (-2330.803) (-2328.307) (-2333.563) [-2329.689] -- 0:01:05 773000 -- (-2336.298) (-2331.028) (-2333.369) [-2332.111] * (-2329.903) [-2327.673] (-2334.132) (-2333.927) -- 0:01:05 773500 -- (-2332.217) [-2334.302] (-2337.418) (-2330.734) * (-2332.005) (-2339.810) (-2326.730) [-2335.444] -- 0:01:05 774000 -- (-2339.890) (-2344.678) [-2328.102] (-2333.885) * (-2336.876) (-2334.237) (-2328.372) [-2332.410] -- 0:01:04 774500 -- (-2333.092) (-2336.738) (-2331.342) [-2329.566] * (-2331.709) [-2334.950] (-2328.791) (-2335.037) -- 0:01:04 775000 -- [-2329.173] (-2338.387) (-2335.129) (-2328.965) * (-2332.431) [-2333.010] (-2330.089) (-2328.373) -- 0:01:04 Average standard deviation of split frequencies: 0.001417 775500 -- (-2331.236) (-2330.391) [-2329.324] (-2328.945) * (-2325.628) (-2329.766) [-2334.020] (-2331.039) -- 0:01:04 776000 -- (-2338.153) (-2337.209) [-2330.518] (-2332.180) * [-2326.584] (-2336.065) (-2334.565) (-2334.419) -- 0:01:04 776500 -- (-2335.723) [-2330.768] (-2330.834) (-2330.205) * [-2330.969] (-2339.198) (-2340.240) (-2332.096) -- 0:01:04 777000 -- (-2335.325) (-2335.705) [-2330.337] (-2333.676) * (-2338.477) [-2333.846] (-2331.974) (-2340.491) -- 0:01:04 777500 -- (-2333.283) (-2333.190) (-2328.991) [-2332.517] * (-2333.321) (-2329.556) [-2333.753] (-2345.383) -- 0:01:03 778000 -- (-2331.343) (-2329.532) [-2334.520] (-2337.526) * (-2331.191) [-2333.099] (-2341.426) (-2342.968) -- 0:01:03 778500 -- (-2331.044) (-2344.940) (-2333.472) [-2331.923] * (-2328.673) [-2339.349] (-2330.639) (-2334.061) -- 0:01:03 779000 -- (-2341.189) [-2327.586] (-2327.773) (-2333.974) * (-2336.949) (-2330.445) (-2334.739) [-2331.378] -- 0:01:03 779500 -- (-2343.406) (-2329.601) [-2333.313] (-2336.716) * (-2333.987) (-2333.485) [-2336.153] (-2334.034) -- 0:01:03 780000 -- (-2337.918) [-2329.962] (-2333.925) (-2336.196) * (-2333.670) (-2340.840) [-2333.614] (-2335.243) -- 0:01:03 Average standard deviation of split frequencies: 0.001409 780500 -- (-2328.778) [-2331.582] (-2334.270) (-2338.810) * (-2329.042) [-2331.323] (-2334.288) (-2335.038) -- 0:01:02 781000 -- (-2332.340) (-2329.456) (-2334.631) [-2333.644] * (-2332.147) (-2331.621) [-2333.452] (-2336.203) -- 0:01:02 781500 -- (-2338.970) [-2332.853] (-2333.571) (-2332.619) * (-2326.749) [-2340.721] (-2333.730) (-2343.860) -- 0:01:02 782000 -- (-2338.521) [-2329.149] (-2332.309) (-2331.922) * (-2337.006) (-2338.226) [-2335.079] (-2342.524) -- 0:01:02 782500 -- (-2331.837) [-2329.220] (-2332.163) (-2327.962) * [-2329.430] (-2329.990) (-2339.583) (-2336.176) -- 0:01:02 783000 -- (-2330.196) [-2336.252] (-2328.687) (-2328.947) * (-2334.364) (-2328.744) [-2332.551] (-2333.902) -- 0:01:02 783500 -- (-2339.493) (-2333.664) [-2328.885] (-2335.540) * (-2337.949) (-2333.948) (-2335.047) [-2327.787] -- 0:01:02 784000 -- (-2331.101) (-2333.306) [-2329.882] (-2331.664) * [-2337.595] (-2337.639) (-2334.766) (-2331.695) -- 0:01:01 784500 -- (-2328.392) (-2332.466) (-2326.738) [-2333.332] * [-2344.405] (-2336.029) (-2333.512) (-2330.768) -- 0:01:01 785000 -- (-2333.622) (-2334.551) [-2329.144] (-2327.046) * (-2331.026) [-2329.689] (-2326.929) (-2330.637) -- 0:01:01 Average standard deviation of split frequencies: 0.001399 785500 -- [-2331.216] (-2334.733) (-2331.719) (-2334.249) * (-2335.517) [-2337.857] (-2332.505) (-2336.277) -- 0:01:01 786000 -- (-2339.539) (-2329.076) [-2340.038] (-2329.261) * (-2330.292) [-2328.718] (-2334.716) (-2330.144) -- 0:01:01 786500 -- (-2333.036) [-2336.927] (-2339.894) (-2335.867) * (-2330.903) (-2329.816) (-2330.851) [-2329.327] -- 0:01:01 787000 -- (-2327.645) (-2335.775) [-2338.989] (-2338.826) * (-2335.209) (-2328.724) (-2335.010) [-2330.821] -- 0:01:01 787500 -- [-2338.306] (-2325.191) (-2332.857) (-2335.485) * [-2333.694] (-2331.731) (-2348.140) (-2333.800) -- 0:01:00 788000 -- (-2327.513) (-2330.286) [-2331.299] (-2337.061) * (-2339.606) (-2331.949) [-2332.581] (-2335.349) -- 0:01:00 788500 -- (-2337.351) (-2337.012) [-2328.785] (-2335.906) * (-2335.047) (-2332.383) (-2333.735) [-2335.547] -- 0:01:00 789000 -- (-2337.499) (-2335.983) (-2330.149) [-2332.806] * (-2328.471) (-2332.926) (-2332.774) [-2329.023] -- 0:01:00 789500 -- (-2334.238) [-2324.581] (-2334.655) (-2336.223) * [-2330.059] (-2335.050) (-2335.635) (-2334.798) -- 0:01:00 790000 -- (-2333.848) (-2329.238) [-2329.391] (-2337.858) * (-2333.692) (-2329.898) [-2335.693] (-2331.214) -- 0:01:00 Average standard deviation of split frequencies: 0.001391 790500 -- (-2339.146) (-2337.690) [-2336.836] (-2332.618) * [-2336.221] (-2330.148) (-2330.584) (-2331.708) -- 0:01:00 791000 -- (-2338.783) [-2330.544] (-2335.731) (-2329.575) * (-2330.590) [-2327.507] (-2337.693) (-2341.897) -- 0:00:59 791500 -- (-2339.483) (-2332.237) [-2329.082] (-2330.429) * (-2338.308) (-2332.218) (-2340.459) [-2332.056] -- 0:00:59 792000 -- (-2337.546) (-2331.314) [-2335.705] (-2331.254) * [-2330.559] (-2331.604) (-2335.553) (-2331.709) -- 0:00:59 792500 -- (-2336.751) (-2340.021) [-2328.033] (-2340.164) * (-2332.332) (-2342.655) (-2331.293) [-2329.008] -- 0:00:59 793000 -- [-2331.349] (-2332.703) (-2339.825) (-2333.398) * (-2329.905) [-2337.124] (-2344.952) (-2330.664) -- 0:00:59 793500 -- (-2330.744) [-2337.069] (-2335.084) (-2331.292) * (-2336.134) (-2329.450) (-2335.967) [-2327.276] -- 0:00:59 794000 -- (-2328.284) (-2334.066) [-2333.202] (-2339.263) * (-2332.427) [-2332.209] (-2333.788) (-2340.668) -- 0:00:59 794500 -- (-2331.473) (-2336.466) [-2333.164] (-2333.079) * [-2332.447] (-2330.719) (-2334.965) (-2330.434) -- 0:00:58 795000 -- (-2333.796) [-2334.847] (-2333.280) (-2334.215) * [-2329.092] (-2336.035) (-2333.778) (-2332.510) -- 0:00:58 Average standard deviation of split frequencies: 0.001382 795500 -- [-2326.820] (-2336.441) (-2333.090) (-2332.134) * (-2333.838) (-2338.880) (-2336.101) [-2331.159] -- 0:00:58 796000 -- [-2334.374] (-2332.638) (-2329.927) (-2329.088) * (-2328.582) (-2333.826) [-2327.104] (-2329.493) -- 0:00:58 796500 -- (-2336.075) (-2336.173) (-2333.610) [-2330.388] * [-2329.378] (-2332.410) (-2331.158) (-2333.255) -- 0:00:58 797000 -- (-2329.652) (-2342.883) [-2330.653] (-2337.516) * (-2340.234) [-2337.246] (-2333.875) (-2340.655) -- 0:00:58 797500 -- (-2327.384) (-2339.979) [-2327.699] (-2328.534) * [-2328.663] (-2337.638) (-2339.311) (-2326.867) -- 0:00:58 798000 -- [-2331.930] (-2334.182) (-2331.641) (-2330.051) * (-2332.586) (-2329.140) (-2333.610) [-2331.841] -- 0:00:57 798500 -- (-2333.630) (-2334.728) [-2331.809] (-2326.730) * (-2337.991) [-2337.241] (-2331.448) (-2334.383) -- 0:00:57 799000 -- (-2333.816) (-2335.593) (-2331.614) [-2329.646] * (-2332.520) (-2332.854) [-2332.957] (-2336.532) -- 0:00:57 799500 -- (-2340.206) [-2332.432] (-2332.426) (-2335.105) * (-2330.545) [-2328.768] (-2334.334) (-2339.460) -- 0:00:57 800000 -- (-2333.620) (-2336.514) (-2338.217) [-2328.474] * (-2341.549) [-2329.155] (-2334.102) (-2338.958) -- 0:00:57 Average standard deviation of split frequencies: 0.001374 800500 -- (-2334.727) [-2339.226] (-2327.587) (-2331.134) * [-2334.889] (-2334.962) (-2328.294) (-2334.519) -- 0:00:57 801000 -- (-2340.386) (-2329.917) [-2330.352] (-2339.582) * [-2334.171] (-2333.327) (-2329.078) (-2330.062) -- 0:00:57 801500 -- (-2335.938) (-2332.651) [-2329.895] (-2332.774) * (-2338.433) (-2330.362) (-2336.078) [-2326.593] -- 0:00:56 802000 -- (-2332.340) [-2333.527] (-2329.201) (-2330.732) * (-2338.792) (-2331.445) (-2331.469) [-2329.482] -- 0:00:56 802500 -- (-2329.161) (-2330.888) [-2332.902] (-2343.099) * [-2334.646] (-2333.952) (-2329.308) (-2333.623) -- 0:00:56 803000 -- [-2337.683] (-2334.469) (-2333.936) (-2336.622) * (-2331.431) [-2330.384] (-2337.110) (-2335.438) -- 0:00:56 803500 -- [-2335.084] (-2331.861) (-2330.927) (-2330.596) * [-2333.196] (-2335.265) (-2336.936) (-2333.401) -- 0:00:56 804000 -- [-2332.155] (-2344.050) (-2339.782) (-2338.019) * (-2335.543) (-2333.174) (-2330.130) [-2327.331] -- 0:00:56 804500 -- (-2333.694) [-2328.041] (-2328.679) (-2338.318) * (-2341.173) [-2332.042] (-2335.472) (-2328.809) -- 0:00:56 805000 -- (-2329.322) [-2331.573] (-2338.789) (-2337.370) * [-2335.065] (-2331.703) (-2335.161) (-2331.466) -- 0:00:55 Average standard deviation of split frequencies: 0.001560 805500 -- (-2333.965) (-2328.407) (-2334.996) [-2333.650] * (-2330.900) [-2335.174] (-2326.671) (-2333.089) -- 0:00:55 806000 -- (-2338.845) (-2343.190) [-2329.524] (-2330.194) * [-2330.388] (-2343.102) (-2339.261) (-2331.552) -- 0:00:55 806500 -- (-2328.422) (-2328.065) [-2332.743] (-2338.264) * (-2333.657) [-2332.324] (-2333.499) (-2331.191) -- 0:00:55 807000 -- (-2334.866) [-2336.608] (-2331.294) (-2328.376) * (-2338.525) [-2335.947] (-2337.492) (-2339.158) -- 0:00:55 807500 -- (-2328.943) (-2337.590) [-2333.767] (-2337.613) * (-2341.944) (-2331.597) [-2329.781] (-2333.590) -- 0:00:55 808000 -- (-2333.543) (-2336.894) (-2328.216) [-2340.811] * [-2333.340] (-2332.370) (-2328.277) (-2333.591) -- 0:00:55 808500 -- (-2336.567) (-2334.285) (-2331.858) [-2329.057] * (-2335.711) (-2337.004) (-2332.201) [-2335.750] -- 0:00:54 809000 -- (-2334.915) (-2341.613) [-2329.910] (-2328.208) * (-2334.377) (-2330.612) (-2331.277) [-2331.508] -- 0:00:54 809500 -- (-2330.548) (-2339.826) [-2333.975] (-2330.096) * (-2338.322) (-2330.785) [-2332.289] (-2334.264) -- 0:00:54 810000 -- (-2330.544) (-2337.523) (-2337.325) [-2334.478] * [-2345.342] (-2338.592) (-2328.401) (-2342.478) -- 0:00:54 Average standard deviation of split frequencies: 0.001357 810500 -- [-2328.133] (-2338.938) (-2331.943) (-2336.447) * (-2337.809) (-2329.175) [-2332.131] (-2336.002) -- 0:00:54 811000 -- (-2330.671) [-2338.612] (-2330.191) (-2330.250) * (-2335.009) [-2333.298] (-2336.820) (-2329.689) -- 0:00:54 811500 -- (-2332.201) (-2337.645) (-2332.703) [-2331.883] * (-2330.883) (-2340.881) (-2338.868) [-2333.640] -- 0:00:54 812000 -- [-2329.410] (-2345.253) (-2338.113) (-2329.426) * (-2336.057) [-2329.358] (-2330.035) (-2338.066) -- 0:00:53 812500 -- [-2329.119] (-2334.263) (-2333.638) (-2335.825) * [-2333.038] (-2336.913) (-2329.840) (-2332.701) -- 0:00:53 813000 -- (-2337.243) (-2337.855) [-2331.805] (-2332.655) * (-2332.942) (-2335.332) (-2336.453) [-2338.238] -- 0:00:53 813500 -- [-2332.219] (-2331.822) (-2333.183) (-2328.902) * [-2334.866] (-2329.973) (-2330.951) (-2335.753) -- 0:00:53 814000 -- (-2332.906) (-2331.372) [-2326.871] (-2331.302) * [-2328.808] (-2327.063) (-2343.047) (-2338.450) -- 0:00:53 814500 -- (-2334.218) (-2339.312) [-2325.955] (-2335.920) * (-2330.402) [-2331.835] (-2334.134) (-2333.070) -- 0:00:53 815000 -- (-2335.889) (-2338.644) [-2331.630] (-2332.930) * [-2329.848] (-2332.879) (-2341.394) (-2332.230) -- 0:00:53 Average standard deviation of split frequencies: 0.001348 815500 -- (-2334.516) (-2338.902) [-2327.098] (-2332.709) * (-2326.739) [-2337.633] (-2334.766) (-2335.389) -- 0:00:52 816000 -- (-2329.829) [-2332.737] (-2331.971) (-2339.700) * (-2330.105) (-2331.688) (-2344.686) [-2336.194] -- 0:00:52 816500 -- (-2328.955) [-2328.662] (-2334.688) (-2330.094) * (-2332.828) [-2330.183] (-2336.264) (-2340.393) -- 0:00:52 817000 -- (-2333.085) (-2332.383) (-2333.217) [-2328.165] * [-2330.619] (-2327.929) (-2331.988) (-2327.484) -- 0:00:52 817500 -- [-2330.913] (-2330.178) (-2330.655) (-2339.020) * [-2329.705] (-2334.171) (-2333.889) (-2338.636) -- 0:00:52 818000 -- (-2331.419) (-2333.524) [-2332.616] (-2341.064) * (-2333.877) [-2333.017] (-2332.743) (-2331.817) -- 0:00:52 818500 -- (-2332.114) (-2339.802) (-2331.474) [-2328.438] * (-2339.348) [-2335.611] (-2329.018) (-2334.322) -- 0:00:52 819000 -- (-2331.156) (-2338.605) (-2330.133) [-2337.340] * (-2328.618) (-2329.876) (-2328.035) [-2342.477] -- 0:00:51 819500 -- [-2329.314] (-2334.001) (-2327.893) (-2340.464) * (-2342.172) (-2331.829) (-2334.469) [-2335.498] -- 0:00:51 820000 -- (-2342.207) (-2337.074) (-2330.804) [-2338.664] * (-2338.173) [-2332.806] (-2339.512) (-2331.771) -- 0:00:51 Average standard deviation of split frequencies: 0.000957 820500 -- (-2335.212) [-2333.153] (-2339.340) (-2334.951) * (-2331.752) [-2334.826] (-2332.001) (-2333.996) -- 0:00:51 821000 -- [-2331.223] (-2337.341) (-2334.689) (-2336.033) * [-2331.628] (-2334.449) (-2339.941) (-2345.994) -- 0:00:51 821500 -- [-2333.840] (-2339.100) (-2345.756) (-2333.881) * [-2331.268] (-2328.635) (-2330.848) (-2338.599) -- 0:00:51 822000 -- (-2331.241) (-2333.989) [-2328.494] (-2339.519) * (-2332.690) (-2334.910) [-2327.361] (-2338.513) -- 0:00:51 822500 -- (-2337.301) (-2330.131) [-2328.111] (-2334.755) * (-2335.263) (-2338.007) (-2332.297) [-2334.766] -- 0:00:50 823000 -- (-2333.504) (-2332.613) (-2327.840) [-2337.070] * (-2336.104) [-2334.978] (-2335.772) (-2334.225) -- 0:00:50 823500 -- (-2337.150) (-2336.713) [-2330.880] (-2330.909) * (-2329.897) (-2329.802) [-2332.531] (-2341.126) -- 0:00:50 824000 -- (-2332.569) [-2333.755] (-2334.071) (-2338.973) * (-2339.083) (-2330.896) [-2330.693] (-2332.912) -- 0:00:50 824500 -- (-2331.297) (-2333.035) [-2334.915] (-2339.865) * (-2336.759) (-2328.471) [-2337.615] (-2334.488) -- 0:00:50 825000 -- (-2333.131) (-2329.554) [-2335.701] (-2334.507) * (-2341.215) [-2333.099] (-2327.836) (-2333.427) -- 0:00:50 Average standard deviation of split frequencies: 0.000571 825500 -- (-2328.151) [-2333.602] (-2338.514) (-2334.110) * [-2331.384] (-2332.537) (-2328.924) (-2338.679) -- 0:00:50 826000 -- [-2327.531] (-2337.395) (-2330.508) (-2331.149) * (-2338.281) (-2332.341) (-2332.914) [-2332.152] -- 0:00:49 826500 -- [-2337.369] (-2331.939) (-2329.158) (-2334.922) * (-2327.899) [-2326.731] (-2343.046) (-2336.530) -- 0:00:49 827000 -- [-2328.779] (-2332.610) (-2330.606) (-2339.284) * (-2328.735) [-2329.356] (-2337.282) (-2333.243) -- 0:00:49 827500 -- (-2335.034) (-2334.146) (-2331.251) [-2335.348] * (-2329.290) [-2336.062] (-2330.979) (-2327.486) -- 0:00:49 828000 -- (-2330.651) (-2326.669) (-2333.043) [-2330.732] * (-2329.303) (-2333.733) [-2331.463] (-2336.447) -- 0:00:49 828500 -- (-2333.039) [-2335.623] (-2343.042) (-2333.386) * (-2330.649) (-2332.570) [-2330.882] (-2334.392) -- 0:00:49 829000 -- (-2331.952) (-2333.747) (-2341.999) [-2334.255] * (-2333.354) (-2332.434) (-2331.264) [-2328.020] -- 0:00:49 829500 -- (-2333.691) [-2333.026] (-2327.152) (-2333.040) * (-2328.562) (-2347.300) (-2332.206) [-2337.176] -- 0:00:48 830000 -- (-2337.065) (-2332.305) [-2331.256] (-2335.113) * (-2334.952) [-2337.459] (-2334.554) (-2331.526) -- 0:00:48 Average standard deviation of split frequencies: 0.000568 830500 -- [-2331.586] (-2330.398) (-2335.204) (-2336.485) * (-2336.883) (-2332.590) (-2337.163) [-2332.449] -- 0:00:48 831000 -- (-2336.096) (-2331.729) [-2334.485] (-2339.661) * [-2329.132] (-2334.317) (-2333.707) (-2332.509) -- 0:00:48 831500 -- (-2339.100) (-2335.151) [-2336.489] (-2338.881) * (-2333.778) (-2340.918) [-2337.047] (-2332.390) -- 0:00:48 832000 -- (-2335.055) (-2333.669) (-2332.811) [-2333.240] * (-2331.649) [-2331.006] (-2338.938) (-2329.629) -- 0:00:48 832500 -- [-2340.171] (-2334.406) (-2338.838) (-2333.119) * (-2329.581) [-2332.814] (-2331.014) (-2337.355) -- 0:00:48 833000 -- [-2332.882] (-2330.380) (-2333.777) (-2331.648) * (-2329.595) (-2331.918) [-2329.195] (-2332.551) -- 0:00:47 833500 -- (-2335.730) [-2336.987] (-2329.107) (-2330.501) * (-2338.544) (-2329.939) [-2331.230] (-2335.931) -- 0:00:47 834000 -- (-2330.756) (-2336.288) [-2330.485] (-2332.830) * [-2327.220] (-2337.409) (-2337.271) (-2333.853) -- 0:00:47 834500 -- (-2329.278) (-2332.069) (-2334.056) [-2333.107] * (-2331.166) (-2340.014) (-2337.059) [-2330.516] -- 0:00:47 835000 -- (-2329.744) [-2335.830] (-2332.310) (-2336.042) * [-2329.952] (-2332.102) (-2340.733) (-2335.614) -- 0:00:47 Average standard deviation of split frequencies: 0.000564 835500 -- (-2335.174) (-2339.859) (-2338.831) [-2327.834] * (-2335.022) (-2330.274) [-2334.545] (-2336.761) -- 0:00:47 836000 -- (-2331.695) [-2332.802] (-2339.479) (-2331.838) * (-2334.271) [-2330.190] (-2332.918) (-2339.712) -- 0:00:47 836500 -- (-2331.323) [-2331.908] (-2337.886) (-2333.354) * (-2342.950) (-2339.920) [-2326.533] (-2335.981) -- 0:00:46 837000 -- [-2330.902] (-2336.176) (-2339.898) (-2338.684) * (-2333.636) (-2327.643) [-2329.010] (-2335.946) -- 0:00:46 837500 -- (-2332.401) (-2346.081) [-2331.153] (-2334.109) * (-2344.646) (-2327.013) (-2331.809) [-2333.469] -- 0:00:46 838000 -- (-2337.777) (-2334.618) (-2335.901) [-2332.647] * (-2337.074) (-2327.229) [-2332.340] (-2334.775) -- 0:00:46 838500 -- (-2344.647) [-2332.636] (-2340.571) (-2335.906) * (-2334.172) (-2331.326) (-2331.214) [-2330.030] -- 0:00:46 839000 -- (-2336.073) [-2326.956] (-2334.354) (-2338.715) * [-2328.902] (-2335.708) (-2330.239) (-2335.749) -- 0:00:46 839500 -- (-2342.086) (-2334.893) [-2328.944] (-2340.074) * (-2334.780) (-2333.040) [-2337.213] (-2327.985) -- 0:00:46 840000 -- (-2331.854) (-2330.460) [-2331.262] (-2333.941) * (-2336.297) (-2330.245) (-2329.538) [-2329.776] -- 0:00:45 Average standard deviation of split frequencies: 0.000561 840500 -- [-2329.007] (-2333.139) (-2330.889) (-2336.713) * (-2334.738) (-2335.705) [-2330.040] (-2332.078) -- 0:00:45 841000 -- (-2332.320) (-2332.132) [-2325.667] (-2329.825) * (-2337.736) [-2330.782] (-2336.415) (-2341.918) -- 0:00:45 841500 -- (-2338.948) [-2332.909] (-2329.553) (-2327.633) * (-2333.145) (-2334.333) [-2333.848] (-2327.605) -- 0:00:45 842000 -- [-2331.347] (-2330.988) (-2333.535) (-2335.556) * (-2334.815) [-2338.647] (-2342.477) (-2330.852) -- 0:00:45 842500 -- [-2329.883] (-2329.531) (-2332.738) (-2331.169) * (-2335.036) (-2324.886) (-2348.248) [-2333.379] -- 0:00:45 843000 -- (-2335.952) (-2333.670) [-2326.996] (-2335.370) * [-2340.998] (-2332.745) (-2347.716) (-2336.650) -- 0:00:45 843500 -- (-2341.611) (-2333.246) (-2335.936) [-2329.169] * (-2337.975) [-2331.686] (-2343.873) (-2330.118) -- 0:00:44 844000 -- [-2332.469] (-2336.514) (-2344.693) (-2338.975) * (-2344.739) (-2336.560) (-2337.606) [-2333.626] -- 0:00:44 844500 -- (-2338.184) (-2335.252) [-2334.676] (-2340.517) * (-2330.290) (-2337.402) (-2340.023) [-2330.951] -- 0:00:44 845000 -- (-2336.390) (-2332.048) [-2334.234] (-2329.979) * [-2333.005] (-2330.465) (-2330.405) (-2330.655) -- 0:00:44 Average standard deviation of split frequencies: 0.000371 845500 -- (-2327.217) (-2330.578) [-2332.251] (-2347.081) * (-2334.534) (-2335.104) (-2344.702) [-2330.253] -- 0:00:44 846000 -- [-2326.093] (-2338.929) (-2334.539) (-2333.896) * (-2329.376) [-2332.267] (-2338.240) (-2332.384) -- 0:00:44 846500 -- (-2330.065) (-2331.554) (-2328.422) [-2335.488] * [-2328.431] (-2336.288) (-2331.299) (-2331.889) -- 0:00:44 847000 -- (-2340.355) (-2329.659) [-2332.557] (-2344.184) * (-2331.807) [-2332.547] (-2328.990) (-2338.267) -- 0:00:43 847500 -- (-2341.303) (-2331.045) (-2338.142) [-2332.457] * (-2333.669) (-2345.466) [-2336.040] (-2342.773) -- 0:00:43 848000 -- (-2335.330) (-2339.130) (-2339.642) [-2332.439] * (-2346.051) (-2352.261) [-2330.954] (-2343.111) -- 0:00:43 848500 -- [-2336.593] (-2339.242) (-2334.547) (-2333.349) * (-2335.317) (-2335.864) [-2332.554] (-2334.847) -- 0:00:43 849000 -- (-2337.746) (-2345.102) (-2333.510) [-2331.948] * (-2339.632) (-2336.308) (-2334.243) [-2328.844] -- 0:00:43 849500 -- (-2331.841) (-2336.205) [-2326.697] (-2334.587) * (-2338.920) (-2336.866) (-2342.455) [-2331.535] -- 0:00:43 850000 -- [-2330.146] (-2343.411) (-2332.374) (-2329.951) * (-2334.093) (-2342.997) (-2329.077) [-2330.206] -- 0:00:43 Average standard deviation of split frequencies: 0.000369 850500 -- (-2336.403) (-2336.456) (-2342.824) [-2328.382] * [-2339.520] (-2334.067) (-2332.715) (-2336.642) -- 0:00:42 851000 -- (-2338.567) (-2331.625) [-2333.634] (-2332.775) * (-2337.757) [-2334.805] (-2343.920) (-2332.521) -- 0:00:42 851500 -- (-2329.721) (-2330.489) [-2336.091] (-2333.650) * (-2329.674) [-2327.568] (-2330.862) (-2334.528) -- 0:00:42 852000 -- [-2333.572] (-2334.727) (-2334.933) (-2331.019) * [-2335.032] (-2337.361) (-2335.695) (-2332.829) -- 0:00:42 852500 -- (-2330.320) [-2332.075] (-2330.310) (-2328.561) * [-2336.328] (-2327.137) (-2332.901) (-2336.901) -- 0:00:42 853000 -- (-2336.358) [-2335.235] (-2334.313) (-2328.369) * [-2330.977] (-2336.041) (-2339.857) (-2334.794) -- 0:00:42 853500 -- (-2337.686) [-2330.187] (-2334.481) (-2332.469) * (-2333.659) (-2335.297) [-2330.234] (-2339.006) -- 0:00:42 854000 -- (-2330.855) (-2332.908) [-2336.717] (-2330.834) * [-2336.159] (-2332.116) (-2336.431) (-2339.372) -- 0:00:41 854500 -- (-2328.183) [-2332.286] (-2336.616) (-2333.631) * (-2341.938) (-2336.869) (-2332.830) [-2329.105] -- 0:00:41 855000 -- (-2334.914) [-2336.927] (-2336.928) (-2340.694) * (-2338.693) [-2329.949] (-2332.948) (-2328.667) -- 0:00:41 Average standard deviation of split frequencies: 0.000551 855500 -- (-2329.503) (-2334.662) (-2332.200) [-2332.079] * (-2338.956) (-2327.035) (-2333.423) [-2337.157] -- 0:00:41 856000 -- (-2336.783) [-2336.962] (-2337.003) (-2330.306) * [-2330.233] (-2330.803) (-2331.785) (-2335.360) -- 0:00:41 856500 -- [-2336.603] (-2336.877) (-2333.582) (-2331.109) * (-2326.817) [-2328.914] (-2336.125) (-2334.799) -- 0:00:41 857000 -- [-2335.316] (-2330.635) (-2328.728) (-2334.959) * (-2334.423) [-2334.629] (-2329.509) (-2334.954) -- 0:00:41 857500 -- (-2335.894) (-2329.610) [-2324.801] (-2339.556) * (-2336.953) [-2335.284] (-2329.396) (-2333.148) -- 0:00:40 858000 -- [-2334.272] (-2335.544) (-2324.746) (-2333.494) * (-2334.294) (-2337.210) (-2332.717) [-2335.953] -- 0:00:40 858500 -- (-2337.274) (-2335.364) (-2336.602) [-2332.741] * (-2333.602) [-2328.758] (-2328.111) (-2335.287) -- 0:00:40 859000 -- (-2344.508) (-2331.654) (-2339.698) [-2331.989] * [-2335.385] (-2333.919) (-2333.695) (-2331.118) -- 0:00:40 859500 -- [-2334.858] (-2327.248) (-2337.397) (-2336.203) * (-2329.644) [-2333.498] (-2343.103) (-2328.756) -- 0:00:40 860000 -- [-2332.523] (-2328.497) (-2329.720) (-2336.026) * (-2344.515) (-2333.854) [-2327.984] (-2331.494) -- 0:00:40 Average standard deviation of split frequencies: 0.000365 860500 -- (-2330.256) (-2333.265) (-2329.450) [-2335.292] * [-2332.386] (-2332.282) (-2335.970) (-2337.595) -- 0:00:40 861000 -- (-2334.542) [-2333.425] (-2332.170) (-2329.082) * [-2331.224] (-2336.173) (-2337.143) (-2338.750) -- 0:00:39 861500 -- (-2331.921) [-2333.551] (-2329.981) (-2330.230) * (-2329.518) (-2332.056) (-2332.859) [-2331.303] -- 0:00:39 862000 -- (-2333.508) [-2340.189] (-2342.538) (-2341.603) * (-2334.236) (-2326.526) (-2330.166) [-2333.045] -- 0:00:39 862500 -- (-2330.635) [-2334.945] (-2335.377) (-2332.799) * (-2333.406) (-2332.436) [-2329.916] (-2327.228) -- 0:00:39 863000 -- (-2332.054) (-2331.580) [-2330.701] (-2329.949) * [-2330.241] (-2334.881) (-2333.085) (-2332.113) -- 0:00:39 863500 -- (-2332.847) (-2332.686) [-2328.466] (-2332.728) * (-2333.411) [-2328.796] (-2331.208) (-2341.595) -- 0:00:39 864000 -- (-2333.008) (-2336.834) (-2335.910) [-2333.605] * (-2328.597) [-2334.677] (-2331.517) (-2333.697) -- 0:00:39 864500 -- (-2344.005) [-2331.631] (-2327.582) (-2331.525) * (-2335.639) (-2335.231) (-2332.301) [-2329.785] -- 0:00:38 865000 -- (-2326.360) (-2335.093) [-2335.854] (-2332.924) * (-2340.150) (-2342.654) (-2330.660) [-2333.110] -- 0:00:38 Average standard deviation of split frequencies: 0.000363 865500 -- (-2332.106) (-2334.218) [-2328.407] (-2329.018) * (-2336.488) [-2335.556] (-2336.801) (-2338.468) -- 0:00:38 866000 -- [-2330.215] (-2331.472) (-2333.701) (-2333.770) * [-2334.043] (-2332.228) (-2333.419) (-2329.447) -- 0:00:38 866500 -- (-2339.117) [-2332.554] (-2336.499) (-2339.217) * [-2333.187] (-2329.670) (-2341.157) (-2334.351) -- 0:00:38 867000 -- [-2330.985] (-2329.565) (-2330.904) (-2331.677) * (-2334.122) (-2326.592) [-2334.518] (-2330.396) -- 0:00:38 867500 -- (-2336.071) (-2329.232) (-2330.974) [-2333.824] * (-2331.027) [-2334.755] (-2328.369) (-2335.333) -- 0:00:38 868000 -- (-2339.550) (-2334.073) [-2331.585] (-2334.170) * [-2328.296] (-2333.528) (-2329.500) (-2340.048) -- 0:00:37 868500 -- (-2346.345) [-2333.130] (-2335.765) (-2329.025) * [-2333.419] (-2333.208) (-2332.336) (-2336.419) -- 0:00:37 869000 -- (-2332.955) (-2338.026) (-2330.165) [-2331.587] * [-2327.600] (-2333.764) (-2340.512) (-2338.203) -- 0:00:37 869500 -- (-2331.217) (-2332.743) (-2328.304) [-2327.921] * (-2332.733) (-2333.765) (-2344.425) [-2329.853] -- 0:00:37 870000 -- (-2330.308) (-2338.128) [-2327.416] (-2336.831) * [-2338.136] (-2335.929) (-2331.320) (-2329.824) -- 0:00:37 Average standard deviation of split frequencies: 0.000180 870500 -- (-2335.051) (-2335.903) [-2336.840] (-2329.082) * [-2329.840] (-2343.274) (-2336.842) (-2327.479) -- 0:00:37 871000 -- (-2335.680) (-2328.959) (-2331.896) [-2335.393] * (-2332.570) (-2333.535) (-2330.936) [-2329.800] -- 0:00:37 871500 -- (-2331.987) (-2335.408) (-2330.267) [-2328.253] * (-2333.275) [-2328.185] (-2332.138) (-2335.220) -- 0:00:36 872000 -- (-2330.822) (-2335.375) (-2330.668) [-2337.754] * [-2330.245] (-2333.843) (-2334.594) (-2338.124) -- 0:00:36 872500 -- (-2338.420) [-2332.458] (-2330.030) (-2335.784) * (-2330.545) [-2329.946] (-2341.222) (-2338.959) -- 0:00:36 873000 -- (-2331.852) (-2335.740) (-2327.488) [-2331.415] * (-2333.507) (-2333.738) [-2329.456] (-2338.464) -- 0:00:36 873500 -- (-2331.723) [-2332.273] (-2333.051) (-2338.371) * (-2338.193) [-2329.414] (-2336.756) (-2335.282) -- 0:00:36 874000 -- [-2334.744] (-2330.739) (-2337.184) (-2335.968) * (-2332.890) [-2332.853] (-2338.196) (-2334.979) -- 0:00:36 874500 -- (-2332.265) [-2338.497] (-2330.200) (-2339.134) * (-2334.434) (-2330.623) [-2332.080] (-2330.340) -- 0:00:36 875000 -- (-2337.080) [-2337.182] (-2333.062) (-2341.502) * [-2334.178] (-2336.075) (-2332.634) (-2337.584) -- 0:00:35 Average standard deviation of split frequencies: 0.000179 875500 -- (-2331.446) [-2333.315] (-2331.814) (-2329.985) * (-2328.758) [-2331.752] (-2333.362) (-2330.934) -- 0:00:35 876000 -- [-2333.591] (-2330.711) (-2335.561) (-2343.724) * (-2332.782) [-2329.152] (-2335.285) (-2338.009) -- 0:00:35 876500 -- (-2341.262) (-2339.523) [-2331.998] (-2332.741) * (-2338.437) [-2331.623] (-2341.707) (-2328.818) -- 0:00:35 877000 -- (-2332.208) [-2333.072] (-2335.561) (-2334.344) * (-2344.281) [-2328.479] (-2340.189) (-2331.446) -- 0:00:35 877500 -- (-2332.755) (-2330.897) [-2327.048] (-2335.355) * (-2330.213) [-2330.683] (-2337.347) (-2330.400) -- 0:00:35 878000 -- [-2330.973] (-2337.756) (-2335.719) (-2338.085) * [-2326.686] (-2332.085) (-2332.543) (-2335.367) -- 0:00:35 878500 -- [-2326.038] (-2335.258) (-2333.184) (-2331.996) * (-2328.746) (-2335.292) (-2332.867) [-2335.841] -- 0:00:34 879000 -- (-2330.382) [-2332.888] (-2331.131) (-2332.025) * (-2332.966) (-2335.615) [-2330.469] (-2339.990) -- 0:00:34 879500 -- [-2330.401] (-2326.657) (-2335.084) (-2337.669) * (-2334.719) (-2336.740) [-2332.762] (-2329.945) -- 0:00:34 880000 -- [-2330.767] (-2330.886) (-2337.466) (-2331.225) * (-2334.460) (-2335.782) [-2330.322] (-2327.996) -- 0:00:34 Average standard deviation of split frequencies: 0.000535 880500 -- (-2335.452) (-2331.408) [-2330.814] (-2329.432) * [-2325.598] (-2332.774) (-2336.060) (-2335.748) -- 0:00:34 881000 -- (-2334.136) [-2326.820] (-2328.969) (-2332.241) * [-2327.320] (-2344.307) (-2337.647) (-2328.968) -- 0:00:34 881500 -- [-2333.154] (-2336.956) (-2331.683) (-2332.413) * (-2337.640) (-2331.968) [-2335.974] (-2328.607) -- 0:00:34 882000 -- (-2331.545) (-2332.835) [-2327.808] (-2330.616) * (-2338.461) (-2341.003) (-2338.128) [-2332.736] -- 0:00:33 882500 -- (-2338.244) (-2334.845) (-2336.163) [-2335.427] * [-2339.859] (-2330.827) (-2339.239) (-2332.284) -- 0:00:33 883000 -- (-2333.876) (-2338.343) [-2331.191] (-2336.955) * (-2336.581) [-2330.581] (-2336.028) (-2335.353) -- 0:00:33 883500 -- (-2333.998) (-2337.506) (-2328.854) [-2331.797] * [-2331.663] (-2333.243) (-2334.025) (-2332.221) -- 0:00:33 884000 -- (-2339.919) [-2340.579] (-2331.764) (-2333.134) * (-2330.082) [-2330.702] (-2332.036) (-2332.372) -- 0:00:33 884500 -- (-2337.638) (-2332.989) (-2333.568) [-2335.394] * (-2327.055) (-2328.221) (-2333.136) [-2333.263] -- 0:00:33 885000 -- (-2334.019) (-2326.096) (-2324.280) [-2326.065] * (-2333.586) (-2331.752) (-2337.027) [-2331.523] -- 0:00:33 Average standard deviation of split frequencies: 0.000532 885500 -- (-2330.324) (-2337.592) (-2329.913) [-2330.313] * (-2342.070) (-2341.674) (-2332.377) [-2331.635] -- 0:00:32 886000 -- [-2332.659] (-2333.648) (-2335.214) (-2327.766) * (-2339.600) (-2325.817) (-2331.947) [-2336.150] -- 0:00:32 886500 -- (-2331.006) [-2335.321] (-2332.397) (-2332.467) * [-2328.959] (-2329.572) (-2335.192) (-2332.891) -- 0:00:32 887000 -- (-2336.524) (-2326.843) [-2330.157] (-2337.697) * (-2334.333) [-2329.237] (-2336.984) (-2328.643) -- 0:00:32 887500 -- (-2332.424) (-2328.849) (-2329.915) [-2332.382] * (-2337.647) (-2334.403) (-2337.245) [-2330.864] -- 0:00:32 888000 -- [-2334.105] (-2335.572) (-2330.871) (-2335.052) * (-2327.512) [-2327.878] (-2337.819) (-2334.815) -- 0:00:32 888500 -- (-2334.243) [-2327.903] (-2332.830) (-2330.949) * (-2334.334) [-2332.817] (-2334.306) (-2337.902) -- 0:00:32 889000 -- (-2329.027) [-2329.341] (-2328.588) (-2348.263) * (-2336.560) (-2336.963) [-2324.815] (-2333.534) -- 0:00:31 889500 -- (-2332.546) (-2331.680) [-2336.783] (-2329.152) * (-2334.447) [-2334.378] (-2331.334) (-2339.777) -- 0:00:31 890000 -- [-2337.159] (-2331.224) (-2333.575) (-2331.844) * (-2340.607) [-2325.033] (-2333.640) (-2334.736) -- 0:00:31 Average standard deviation of split frequencies: 0.000353 890500 -- [-2333.124] (-2345.819) (-2333.564) (-2331.422) * (-2331.796) (-2336.389) (-2329.103) [-2330.792] -- 0:00:31 891000 -- [-2332.962] (-2331.710) (-2335.717) (-2333.215) * (-2325.951) (-2343.417) [-2326.749] (-2337.123) -- 0:00:31 891500 -- (-2330.478) [-2333.034] (-2335.602) (-2337.888) * (-2332.160) (-2332.908) (-2339.341) [-2334.516] -- 0:00:31 892000 -- (-2337.469) (-2328.397) (-2332.302) [-2330.087] * (-2332.895) (-2338.418) [-2331.141] (-2336.223) -- 0:00:30 892500 -- (-2338.442) (-2336.546) (-2330.385) [-2331.967] * [-2333.809] (-2335.027) (-2332.153) (-2340.094) -- 0:00:30 893000 -- (-2332.654) (-2328.845) [-2328.303] (-2329.604) * (-2335.977) (-2330.291) (-2339.318) [-2331.168] -- 0:00:30 893500 -- (-2333.385) (-2329.552) (-2331.528) [-2329.106] * (-2332.572) (-2329.147) [-2330.745] (-2331.782) -- 0:00:30 894000 -- (-2330.322) (-2335.213) (-2333.142) [-2331.414] * [-2329.525] (-2327.782) (-2333.425) (-2334.439) -- 0:00:30 894500 -- (-2334.307) [-2324.380] (-2331.740) (-2336.400) * (-2332.067) [-2331.699] (-2332.146) (-2341.102) -- 0:00:30 895000 -- (-2338.287) (-2329.510) (-2338.028) [-2327.124] * (-2328.309) [-2328.683] (-2331.806) (-2331.764) -- 0:00:30 Average standard deviation of split frequencies: 0.000351 895500 -- [-2336.895] (-2331.029) (-2343.806) (-2327.172) * (-2341.607) (-2329.121) (-2336.113) [-2332.900] -- 0:00:29 896000 -- [-2335.393] (-2341.259) (-2340.690) (-2331.879) * [-2333.707] (-2335.327) (-2337.764) (-2330.258) -- 0:00:29 896500 -- (-2343.929) (-2341.061) [-2337.366] (-2333.126) * (-2332.050) (-2337.111) (-2330.288) [-2337.186] -- 0:00:29 897000 -- (-2342.654) (-2344.658) (-2333.190) [-2336.567] * (-2330.231) (-2330.572) (-2330.159) [-2328.428] -- 0:00:29 897500 -- [-2335.537] (-2345.849) (-2338.650) (-2336.740) * (-2334.485) (-2330.200) (-2330.239) [-2336.550] -- 0:00:29 898000 -- (-2330.261) [-2338.306] (-2334.097) (-2334.783) * [-2334.975] (-2328.428) (-2332.124) (-2333.973) -- 0:00:29 898500 -- (-2331.013) (-2340.434) (-2338.998) [-2332.612] * [-2332.427] (-2326.838) (-2331.744) (-2329.076) -- 0:00:29 899000 -- (-2332.228) [-2335.753] (-2337.672) (-2337.063) * (-2335.291) (-2336.042) (-2328.212) [-2334.066] -- 0:00:28 899500 -- (-2329.887) [-2329.170] (-2338.363) (-2341.745) * (-2330.488) [-2330.131] (-2328.892) (-2339.695) -- 0:00:28 900000 -- (-2329.972) [-2336.041] (-2337.730) (-2329.449) * [-2330.263] (-2334.898) (-2335.668) (-2334.420) -- 0:00:28 Average standard deviation of split frequencies: 0.000174 900500 -- (-2329.585) (-2330.886) [-2331.951] (-2332.511) * (-2331.306) (-2339.799) [-2328.302] (-2332.288) -- 0:00:28 901000 -- [-2329.557] (-2328.532) (-2327.864) (-2336.434) * [-2330.964] (-2332.303) (-2328.825) (-2336.182) -- 0:00:28 901500 -- (-2336.927) [-2331.181] (-2329.969) (-2336.252) * (-2331.498) (-2330.031) (-2334.069) [-2328.600] -- 0:00:28 902000 -- (-2338.221) [-2333.635] (-2339.750) (-2335.003) * [-2329.808] (-2327.783) (-2332.541) (-2342.558) -- 0:00:28 902500 -- (-2329.549) (-2334.839) [-2327.839] (-2338.075) * (-2335.727) (-2333.130) (-2337.704) [-2338.012] -- 0:00:27 903000 -- (-2332.479) (-2339.845) (-2342.001) [-2328.568] * (-2333.228) (-2328.238) (-2332.498) [-2333.602] -- 0:00:27 903500 -- (-2327.326) (-2332.512) (-2329.185) [-2332.249] * (-2331.390) [-2330.546] (-2340.434) (-2339.938) -- 0:00:27 904000 -- (-2334.053) [-2330.469] (-2336.290) (-2334.141) * (-2334.053) [-2329.656] (-2343.721) (-2335.689) -- 0:00:27 904500 -- (-2335.841) (-2334.461) [-2337.987] (-2335.595) * [-2334.378] (-2327.566) (-2338.952) (-2332.577) -- 0:00:27 905000 -- (-2337.369) (-2335.160) (-2338.640) [-2328.318] * (-2339.746) (-2331.234) (-2332.234) [-2330.476] -- 0:00:27 Average standard deviation of split frequencies: 0.000173 905500 -- (-2335.899) (-2333.267) [-2331.734] (-2334.971) * (-2331.072) (-2337.173) [-2342.597] (-2330.840) -- 0:00:27 906000 -- (-2338.934) (-2333.460) [-2336.964] (-2328.873) * (-2341.399) (-2330.815) (-2328.240) [-2336.568] -- 0:00:26 906500 -- (-2345.041) [-2339.446] (-2331.881) (-2335.081) * [-2334.747] (-2335.173) (-2333.609) (-2333.565) -- 0:00:26 907000 -- (-2339.187) (-2327.449) [-2329.816] (-2333.954) * (-2339.362) (-2333.646) [-2328.671] (-2332.150) -- 0:00:26 907500 -- [-2335.373] (-2337.000) (-2332.947) (-2332.423) * (-2334.659) (-2340.692) [-2328.998] (-2334.338) -- 0:00:26 908000 -- (-2330.817) (-2337.937) (-2330.644) [-2329.636] * (-2332.378) (-2329.133) [-2339.648] (-2333.268) -- 0:00:26 908500 -- (-2331.562) (-2328.562) (-2333.381) [-2328.115] * (-2333.579) (-2340.802) [-2331.338] (-2330.729) -- 0:00:26 909000 -- (-2332.840) (-2335.124) (-2328.694) [-2329.769] * (-2337.402) (-2336.552) (-2336.703) [-2325.405] -- 0:00:26 909500 -- (-2326.674) (-2328.351) (-2332.666) [-2336.595] * (-2328.618) [-2336.437] (-2337.218) (-2331.239) -- 0:00:25 910000 -- (-2334.718) [-2333.201] (-2333.624) (-2337.464) * [-2330.473] (-2332.734) (-2331.653) (-2339.097) -- 0:00:25 Average standard deviation of split frequencies: 0.000173 910500 -- (-2332.679) (-2331.960) (-2329.804) [-2333.864] * (-2332.177) (-2347.333) [-2336.315] (-2333.484) -- 0:00:25 911000 -- (-2336.241) (-2334.383) [-2331.999] (-2333.308) * [-2329.667] (-2330.145) (-2330.108) (-2340.517) -- 0:00:25 911500 -- (-2341.155) (-2330.075) [-2329.813] (-2334.734) * (-2331.968) (-2333.152) [-2332.359] (-2331.749) -- 0:00:25 912000 -- (-2344.308) (-2336.915) (-2332.653) [-2331.545] * (-2330.878) (-2328.912) [-2329.722] (-2331.478) -- 0:00:25 912500 -- (-2334.714) (-2331.895) [-2328.387] (-2335.410) * [-2332.103] (-2333.650) (-2328.854) (-2332.092) -- 0:00:25 913000 -- (-2331.762) [-2329.566] (-2332.698) (-2334.735) * (-2333.876) [-2329.409] (-2330.887) (-2331.026) -- 0:00:24 913500 -- (-2333.483) (-2333.296) [-2335.655] (-2330.185) * (-2336.119) (-2334.495) [-2334.805] (-2337.067) -- 0:00:24 914000 -- (-2336.448) (-2332.932) [-2327.566] (-2329.365) * (-2332.225) (-2324.971) [-2334.891] (-2328.955) -- 0:00:24 914500 -- (-2338.464) (-2330.494) [-2332.751] (-2338.767) * (-2339.296) [-2328.230] (-2334.603) (-2332.559) -- 0:00:24 915000 -- (-2334.939) (-2331.568) [-2334.978] (-2334.799) * (-2337.643) [-2328.568] (-2326.446) (-2329.311) -- 0:00:24 Average standard deviation of split frequencies: 0.000343 915500 -- (-2330.400) [-2325.900] (-2332.140) (-2328.089) * (-2332.707) [-2328.724] (-2330.287) (-2332.722) -- 0:00:24 916000 -- (-2329.307) [-2330.279] (-2330.075) (-2327.930) * (-2333.480) (-2329.352) (-2330.278) [-2332.809] -- 0:00:24 916500 -- (-2332.504) (-2328.930) (-2331.759) [-2336.803] * (-2330.883) [-2328.246] (-2347.560) (-2329.664) -- 0:00:23 917000 -- (-2335.230) [-2336.224] (-2331.238) (-2332.790) * (-2341.199) (-2330.884) (-2332.991) [-2333.000] -- 0:00:23 917500 -- (-2334.017) (-2333.410) [-2329.129] (-2332.245) * (-2333.499) (-2332.853) (-2332.395) [-2334.556] -- 0:00:23 918000 -- (-2334.244) (-2329.865) [-2327.995] (-2342.360) * (-2336.065) (-2344.819) (-2339.964) [-2337.298] -- 0:00:23 918500 -- [-2334.999] (-2336.579) (-2330.287) (-2335.945) * [-2332.390] (-2329.119) (-2335.384) (-2345.247) -- 0:00:23 919000 -- [-2335.661] (-2334.549) (-2328.834) (-2335.419) * (-2332.940) (-2336.293) [-2335.965] (-2332.836) -- 0:00:23 919500 -- (-2333.125) (-2329.332) (-2330.665) [-2335.648] * (-2334.532) (-2339.391) (-2334.237) [-2333.130] -- 0:00:23 920000 -- (-2343.430) [-2328.666] (-2334.841) (-2331.052) * [-2333.169] (-2332.938) (-2341.385) (-2332.971) -- 0:00:22 Average standard deviation of split frequencies: 0.000341 920500 -- (-2336.803) [-2329.017] (-2328.918) (-2334.140) * (-2332.077) (-2334.561) (-2340.324) [-2337.086] -- 0:00:22 921000 -- (-2337.048) [-2331.210] (-2334.393) (-2336.033) * [-2330.990] (-2335.127) (-2336.122) (-2332.972) -- 0:00:22 921500 -- (-2329.672) (-2341.491) [-2330.552] (-2331.473) * (-2338.210) (-2336.898) [-2335.414] (-2332.724) -- 0:00:22 922000 -- [-2328.067] (-2339.937) (-2336.167) (-2330.407) * [-2336.422] (-2337.449) (-2339.896) (-2335.456) -- 0:00:22 922500 -- (-2335.218) (-2336.204) [-2328.319] (-2332.495) * (-2328.785) (-2335.856) [-2331.509] (-2335.456) -- 0:00:22 923000 -- (-2332.907) [-2332.758] (-2330.548) (-2334.480) * [-2330.757] (-2331.480) (-2340.081) (-2336.753) -- 0:00:22 923500 -- (-2326.050) (-2328.582) (-2341.970) [-2327.553] * (-2329.166) (-2328.427) (-2341.461) [-2336.151] -- 0:00:21 924000 -- (-2330.427) (-2328.210) (-2331.041) [-2326.808] * [-2331.221] (-2336.271) (-2331.643) (-2341.525) -- 0:00:21 924500 -- (-2327.792) [-2331.065] (-2329.040) (-2334.914) * (-2333.010) [-2331.964] (-2338.680) (-2331.526) -- 0:00:21 925000 -- (-2334.366) (-2341.166) [-2335.503] (-2332.767) * (-2335.428) [-2328.810] (-2336.886) (-2328.899) -- 0:00:21 Average standard deviation of split frequencies: 0.000339 925500 -- (-2332.620) [-2329.488] (-2340.793) (-2329.455) * (-2334.783) (-2329.027) (-2342.344) [-2332.927] -- 0:00:21 926000 -- (-2335.664) [-2326.528] (-2333.265) (-2330.245) * (-2331.347) [-2332.439] (-2334.683) (-2331.245) -- 0:00:21 926500 -- [-2329.172] (-2330.404) (-2334.336) (-2336.246) * (-2339.493) [-2337.462] (-2329.522) (-2334.004) -- 0:00:21 927000 -- (-2331.461) (-2332.950) [-2326.245] (-2330.776) * (-2336.269) [-2335.685] (-2332.260) (-2335.511) -- 0:00:20 927500 -- (-2333.654) (-2328.741) [-2330.772] (-2336.994) * (-2344.252) [-2331.198] (-2330.612) (-2337.881) -- 0:00:20 928000 -- (-2333.596) (-2333.158) [-2330.710] (-2333.344) * (-2341.933) (-2336.910) [-2329.472] (-2336.588) -- 0:00:20 928500 -- (-2340.667) (-2333.293) (-2330.652) [-2334.336] * (-2335.244) (-2340.287) [-2330.062] (-2335.677) -- 0:00:20 929000 -- (-2334.793) (-2336.206) [-2332.112] (-2328.311) * [-2337.886] (-2333.799) (-2338.069) (-2328.832) -- 0:00:20 929500 -- (-2341.758) (-2334.649) [-2329.436] (-2332.103) * (-2347.410) (-2330.936) [-2329.163] (-2329.271) -- 0:00:20 930000 -- (-2335.441) (-2333.091) [-2335.462] (-2335.191) * [-2330.801] (-2332.000) (-2332.927) (-2337.765) -- 0:00:20 Average standard deviation of split frequencies: 0.000507 930500 -- [-2333.888] (-2337.176) (-2333.525) (-2328.831) * (-2331.841) [-2333.284] (-2339.462) (-2335.412) -- 0:00:19 931000 -- [-2332.460] (-2330.999) (-2336.716) (-2338.474) * (-2338.734) (-2338.824) [-2332.596] (-2329.269) -- 0:00:19 931500 -- (-2340.392) [-2331.825] (-2332.267) (-2335.751) * [-2331.588] (-2337.313) (-2337.287) (-2336.992) -- 0:00:19 932000 -- (-2337.673) (-2335.394) [-2333.248] (-2333.403) * (-2328.732) [-2333.468] (-2341.787) (-2326.150) -- 0:00:19 932500 -- (-2334.235) [-2329.281] (-2335.778) (-2339.482) * (-2328.102) (-2333.918) (-2331.247) [-2326.847] -- 0:00:19 933000 -- (-2330.492) (-2330.792) [-2328.115] (-2333.172) * [-2330.376] (-2341.172) (-2326.855) (-2328.812) -- 0:00:19 933500 -- (-2327.736) (-2327.824) (-2338.932) [-2337.302] * (-2338.662) (-2332.708) (-2334.558) [-2330.496] -- 0:00:19 934000 -- [-2329.871] (-2337.632) (-2336.680) (-2331.047) * (-2334.885) (-2335.711) (-2327.881) [-2342.975] -- 0:00:18 934500 -- [-2335.699] (-2337.488) (-2333.623) (-2334.714) * (-2333.050) (-2331.690) [-2335.071] (-2339.079) -- 0:00:18 935000 -- (-2333.253) (-2331.996) [-2333.053] (-2329.633) * (-2338.041) (-2336.843) [-2334.146] (-2330.776) -- 0:00:18 Average standard deviation of split frequencies: 0.000504 935500 -- (-2338.022) (-2331.443) [-2333.766] (-2333.044) * (-2333.466) (-2331.114) [-2328.088] (-2330.953) -- 0:00:18 936000 -- (-2334.273) (-2334.223) (-2330.445) [-2329.763] * (-2334.139) [-2334.043] (-2328.579) (-2337.215) -- 0:00:18 936500 -- (-2332.682) [-2335.098] (-2335.125) (-2330.585) * (-2342.967) (-2333.910) [-2325.461] (-2337.579) -- 0:00:18 937000 -- (-2338.203) [-2331.343] (-2334.050) (-2335.992) * (-2341.210) (-2335.224) (-2334.358) [-2333.555] -- 0:00:18 937500 -- [-2335.811] (-2337.531) (-2337.810) (-2331.648) * (-2338.326) (-2334.598) [-2327.454] (-2331.740) -- 0:00:17 938000 -- (-2328.330) [-2334.526] (-2332.976) (-2337.063) * (-2340.800) (-2333.014) [-2336.908] (-2335.550) -- 0:00:17 938500 -- (-2332.492) (-2340.784) [-2328.352] (-2333.304) * (-2336.896) (-2333.658) [-2331.652] (-2332.805) -- 0:00:17 939000 -- (-2330.913) (-2331.529) [-2325.995] (-2337.372) * [-2328.334] (-2330.347) (-2342.157) (-2336.720) -- 0:00:17 939500 -- (-2330.651) (-2341.454) (-2340.526) [-2331.348] * [-2335.440] (-2329.878) (-2340.803) (-2339.099) -- 0:00:17 940000 -- [-2331.048] (-2330.521) (-2331.991) (-2336.108) * (-2340.922) (-2332.100) [-2333.580] (-2343.405) -- 0:00:17 Average standard deviation of split frequencies: 0.000501 940500 -- (-2339.302) (-2329.165) [-2327.328] (-2330.930) * (-2336.676) (-2328.331) [-2332.288] (-2337.904) -- 0:00:17 941000 -- (-2334.277) [-2329.986] (-2326.562) (-2340.461) * (-2339.278) (-2333.782) (-2334.404) [-2333.968] -- 0:00:16 941500 -- (-2331.053) (-2346.012) (-2328.632) [-2326.906] * [-2328.764] (-2333.889) (-2331.343) (-2334.047) -- 0:00:16 942000 -- (-2333.113) (-2336.606) [-2328.162] (-2330.843) * (-2332.924) (-2327.873) [-2325.562] (-2333.146) -- 0:00:16 942500 -- (-2334.432) [-2328.658] (-2328.523) (-2339.138) * (-2334.498) [-2331.437] (-2333.333) (-2335.386) -- 0:00:16 943000 -- [-2335.207] (-2331.689) (-2334.999) (-2332.800) * (-2334.865) [-2334.626] (-2330.632) (-2331.425) -- 0:00:16 943500 -- (-2331.608) [-2333.070] (-2334.316) (-2340.031) * (-2331.310) (-2337.541) [-2341.633] (-2337.257) -- 0:00:16 944000 -- [-2332.190] (-2336.169) (-2337.525) (-2335.450) * [-2334.516] (-2335.299) (-2330.706) (-2330.777) -- 0:00:16 944500 -- [-2332.623] (-2332.975) (-2340.590) (-2335.668) * (-2332.513) (-2332.108) (-2331.870) [-2334.941] -- 0:00:15 945000 -- (-2330.268) (-2331.323) (-2333.385) [-2331.641] * (-2336.457) [-2334.366] (-2330.908) (-2344.958) -- 0:00:15 Average standard deviation of split frequencies: 0.000498 945500 -- [-2331.686] (-2329.801) (-2332.221) (-2337.224) * (-2331.255) (-2333.060) (-2332.448) [-2328.654] -- 0:00:15 946000 -- [-2332.385] (-2343.885) (-2328.057) (-2341.694) * (-2337.119) (-2336.908) (-2330.442) [-2331.910] -- 0:00:15 946500 -- (-2331.754) (-2333.987) (-2333.526) [-2327.918] * (-2330.974) [-2330.026] (-2341.586) (-2332.096) -- 0:00:15 947000 -- [-2328.095] (-2339.846) (-2336.604) (-2328.929) * (-2329.167) (-2331.913) (-2332.446) [-2332.995] -- 0:00:15 947500 -- (-2331.798) [-2326.621] (-2338.735) (-2330.775) * (-2336.502) (-2347.764) [-2330.378] (-2338.427) -- 0:00:15 948000 -- [-2330.022] (-2331.520) (-2337.426) (-2333.956) * (-2335.983) (-2336.921) [-2337.838] (-2339.331) -- 0:00:14 948500 -- [-2334.886] (-2335.706) (-2341.740) (-2328.697) * (-2330.482) (-2333.109) (-2329.604) [-2332.854] -- 0:00:14 949000 -- (-2328.159) (-2330.120) (-2339.363) [-2336.735] * (-2327.233) (-2337.423) [-2330.144] (-2336.354) -- 0:00:14 949500 -- (-2333.176) (-2337.418) [-2331.239] (-2328.990) * (-2341.494) (-2340.972) (-2330.909) [-2335.741] -- 0:00:14 950000 -- (-2335.627) [-2326.642] (-2336.483) (-2329.313) * (-2333.977) (-2330.909) [-2339.399] (-2339.949) -- 0:00:14 Average standard deviation of split frequencies: 0.000496 950500 -- (-2329.511) [-2330.915] (-2327.806) (-2326.610) * (-2336.481) (-2333.811) [-2339.909] (-2333.926) -- 0:00:14 951000 -- (-2335.346) (-2332.312) (-2334.118) [-2329.230] * (-2334.759) [-2330.465] (-2334.053) (-2329.875) -- 0:00:14 951500 -- [-2332.118] (-2332.959) (-2335.560) (-2336.030) * (-2338.751) (-2334.778) [-2332.758] (-2341.764) -- 0:00:13 952000 -- [-2330.383] (-2327.351) (-2329.917) (-2333.075) * (-2334.195) (-2337.422) (-2337.784) [-2328.843] -- 0:00:13 952500 -- (-2335.159) (-2337.928) (-2341.458) [-2334.574] * (-2335.754) (-2331.503) [-2333.163] (-2337.603) -- 0:00:13 953000 -- (-2334.664) (-2331.102) (-2335.082) [-2328.767] * (-2333.045) (-2330.707) [-2339.201] (-2332.790) -- 0:00:13 953500 -- (-2333.617) [-2330.106] (-2332.927) (-2334.130) * (-2332.286) [-2331.663] (-2335.168) (-2340.657) -- 0:00:13 954000 -- (-2334.568) [-2328.332] (-2341.366) (-2337.159) * (-2335.620) [-2331.648] (-2338.063) (-2339.908) -- 0:00:13 954500 -- (-2342.295) (-2329.488) (-2348.036) [-2332.617] * [-2338.571] (-2337.530) (-2334.054) (-2338.264) -- 0:00:13 955000 -- (-2338.117) [-2336.243] (-2338.935) (-2333.347) * [-2327.853] (-2337.142) (-2335.228) (-2336.322) -- 0:00:12 Average standard deviation of split frequencies: 0.000493 955500 -- (-2335.005) [-2336.868] (-2337.559) (-2332.315) * (-2335.327) (-2334.221) (-2329.335) [-2338.422] -- 0:00:12 956000 -- [-2328.087] (-2339.992) (-2330.811) (-2329.768) * (-2331.251) (-2333.351) [-2332.362] (-2338.726) -- 0:00:12 956500 -- (-2332.251) [-2327.957] (-2331.959) (-2330.821) * (-2333.865) [-2332.915] (-2333.527) (-2329.871) -- 0:00:12 957000 -- (-2331.764) (-2338.914) [-2331.418] (-2331.876) * (-2333.201) (-2331.963) (-2346.866) [-2331.118] -- 0:00:12 957500 -- [-2332.260] (-2328.346) (-2342.998) (-2347.002) * (-2336.008) (-2335.038) [-2332.567] (-2332.116) -- 0:00:12 958000 -- (-2343.994) [-2329.005] (-2332.538) (-2327.734) * [-2332.939] (-2332.366) (-2331.413) (-2334.487) -- 0:00:12 958500 -- [-2336.557] (-2326.840) (-2334.384) (-2331.853) * [-2334.131] (-2329.779) (-2340.255) (-2340.341) -- 0:00:11 959000 -- (-2341.216) (-2325.860) [-2329.610] (-2341.303) * [-2328.504] (-2332.307) (-2339.210) (-2332.051) -- 0:00:11 959500 -- (-2333.885) [-2326.235] (-2328.183) (-2326.903) * (-2334.998) [-2333.234] (-2337.077) (-2334.389) -- 0:00:11 960000 -- [-2333.732] (-2332.433) (-2334.827) (-2332.381) * (-2338.130) (-2336.209) [-2331.732] (-2328.577) -- 0:00:11 Average standard deviation of split frequencies: 0.000327 960500 -- (-2338.699) (-2335.269) (-2335.370) [-2329.070] * (-2332.622) [-2333.383] (-2336.831) (-2330.402) -- 0:00:11 961000 -- (-2341.989) [-2326.712] (-2338.546) (-2334.145) * (-2331.100) [-2337.681] (-2335.852) (-2330.333) -- 0:00:11 961500 -- (-2328.456) [-2334.104] (-2336.885) (-2341.280) * [-2329.015] (-2328.988) (-2333.136) (-2334.018) -- 0:00:11 962000 -- (-2330.517) (-2334.477) (-2328.751) [-2328.524] * (-2328.864) (-2329.859) [-2338.673] (-2336.930) -- 0:00:10 962500 -- (-2328.706) [-2330.410] (-2330.645) (-2332.897) * (-2329.154) (-2341.286) (-2330.534) [-2337.502] -- 0:00:10 963000 -- (-2336.567) (-2331.543) (-2331.944) [-2327.354] * (-2333.847) [-2334.151] (-2334.336) (-2335.724) -- 0:00:10 963500 -- (-2334.119) [-2329.665] (-2335.627) (-2333.817) * (-2334.386) [-2334.852] (-2334.305) (-2333.550) -- 0:00:10 964000 -- (-2342.477) [-2326.701] (-2334.813) (-2338.839) * (-2334.688) [-2332.229] (-2328.829) (-2334.111) -- 0:00:10 964500 -- (-2334.440) [-2327.861] (-2331.551) (-2340.893) * (-2334.039) (-2331.981) (-2328.246) [-2335.506] -- 0:00:10 965000 -- (-2337.162) (-2339.439) (-2337.232) [-2331.434] * (-2329.062) (-2336.205) (-2340.048) [-2326.523] -- 0:00:10 Average standard deviation of split frequencies: 0.000325 965500 -- (-2337.893) [-2331.366] (-2334.332) (-2330.900) * (-2335.243) (-2333.662) [-2334.223] (-2331.826) -- 0:00:09 966000 -- [-2330.603] (-2337.749) (-2337.675) (-2334.546) * (-2326.894) (-2330.547) (-2335.573) [-2328.296] -- 0:00:09 966500 -- (-2331.360) (-2333.005) [-2330.197] (-2335.275) * (-2330.748) (-2334.347) [-2328.517] (-2335.969) -- 0:00:09 967000 -- (-2330.807) (-2335.906) (-2336.234) [-2331.943] * [-2331.599] (-2342.530) (-2334.275) (-2334.319) -- 0:00:09 967500 -- (-2326.642) [-2327.715] (-2336.290) (-2334.866) * (-2335.217) [-2338.502] (-2332.236) (-2331.711) -- 0:00:09 968000 -- (-2337.852) [-2334.663] (-2337.386) (-2329.475) * (-2337.548) (-2335.879) (-2335.872) [-2335.587] -- 0:00:09 968500 -- (-2341.653) (-2332.402) [-2334.858] (-2332.398) * [-2330.716] (-2336.977) (-2335.898) (-2332.907) -- 0:00:09 969000 -- (-2332.463) (-2332.822) [-2328.911] (-2334.820) * (-2329.571) (-2333.936) [-2330.806] (-2331.118) -- 0:00:08 969500 -- (-2334.982) (-2329.503) (-2330.950) [-2328.558] * (-2332.469) (-2336.886) [-2332.846] (-2331.039) -- 0:00:08 970000 -- [-2332.595] (-2336.540) (-2347.055) (-2334.583) * (-2335.336) (-2334.217) [-2337.491] (-2333.765) -- 0:00:08 Average standard deviation of split frequencies: 0.000324 970500 -- (-2334.953) [-2340.474] (-2339.618) (-2330.786) * (-2331.195) [-2331.215] (-2340.895) (-2342.674) -- 0:00:08 971000 -- (-2336.210) (-2326.468) [-2333.371] (-2332.317) * [-2329.565] (-2331.916) (-2339.899) (-2334.641) -- 0:00:08 971500 -- [-2331.700] (-2333.004) (-2336.384) (-2331.967) * (-2328.905) (-2341.762) (-2346.762) [-2332.673] -- 0:00:08 972000 -- (-2331.588) [-2331.327] (-2334.316) (-2328.612) * [-2328.443] (-2335.609) (-2340.062) (-2327.361) -- 0:00:08 972500 -- (-2334.813) [-2330.663] (-2326.078) (-2341.980) * (-2332.364) (-2331.918) (-2335.243) [-2330.100] -- 0:00:07 973000 -- [-2333.929] (-2332.478) (-2336.892) (-2333.028) * (-2336.452) [-2336.159] (-2337.708) (-2334.486) -- 0:00:07 973500 -- [-2333.065] (-2333.152) (-2330.191) (-2331.015) * (-2332.491) (-2330.312) [-2331.659] (-2330.651) -- 0:00:07 974000 -- (-2338.168) [-2329.488] (-2336.014) (-2340.961) * (-2335.336) (-2336.158) (-2337.758) [-2332.086] -- 0:00:07 974500 -- [-2328.349] (-2333.096) (-2333.449) (-2342.729) * [-2333.105] (-2334.511) (-2330.961) (-2338.627) -- 0:00:07 975000 -- (-2336.469) [-2332.269] (-2332.135) (-2334.544) * [-2331.744] (-2333.911) (-2333.817) (-2334.368) -- 0:00:07 Average standard deviation of split frequencies: 0.000322 975500 -- [-2333.443] (-2334.547) (-2334.508) (-2340.510) * (-2330.380) [-2328.709] (-2329.768) (-2333.528) -- 0:00:07 976000 -- (-2339.115) (-2330.217) [-2330.455] (-2335.477) * (-2331.315) (-2332.508) [-2333.613] (-2337.373) -- 0:00:06 976500 -- [-2332.504] (-2341.220) (-2335.950) (-2338.511) * (-2326.963) (-2334.995) [-2332.034] (-2332.834) -- 0:00:06 977000 -- (-2339.073) (-2343.416) (-2342.809) [-2327.661] * (-2328.501) (-2343.729) [-2328.989] (-2332.303) -- 0:00:06 977500 -- (-2341.679) (-2335.922) (-2338.644) [-2329.900] * [-2339.134] (-2333.134) (-2333.689) (-2334.862) -- 0:00:06 978000 -- (-2339.748) [-2340.083] (-2336.296) (-2330.181) * (-2336.980) (-2335.142) [-2330.915] (-2333.023) -- 0:00:06 978500 -- [-2338.546] (-2337.701) (-2336.718) (-2333.175) * [-2331.779] (-2332.818) (-2336.941) (-2328.485) -- 0:00:06 979000 -- (-2334.630) (-2335.757) [-2340.280] (-2332.285) * (-2335.363) (-2337.091) [-2328.010] (-2335.314) -- 0:00:06 979500 -- (-2330.664) (-2331.614) (-2337.207) [-2331.834] * (-2330.609) (-2329.569) [-2328.884] (-2326.709) -- 0:00:05 980000 -- (-2327.426) (-2329.621) (-2347.436) [-2330.684] * (-2330.712) [-2342.007] (-2335.545) (-2333.944) -- 0:00:05 Average standard deviation of split frequencies: 0.000160 980500 -- [-2326.890] (-2331.823) (-2342.933) (-2334.131) * (-2331.231) [-2326.241] (-2327.386) (-2338.519) -- 0:00:05 981000 -- [-2325.903] (-2338.245) (-2346.473) (-2332.054) * (-2333.183) (-2331.275) (-2329.793) [-2331.958] -- 0:00:05 981500 -- (-2332.595) (-2328.587) [-2332.980] (-2338.728) * (-2329.914) (-2332.632) (-2329.705) [-2332.873] -- 0:00:05 982000 -- (-2338.167) (-2330.757) [-2334.143] (-2338.065) * (-2324.794) (-2334.816) [-2331.534] (-2328.956) -- 0:00:05 982500 -- (-2328.219) (-2344.025) [-2330.203] (-2330.510) * (-2333.004) (-2336.455) (-2340.728) [-2341.166] -- 0:00:05 983000 -- (-2330.750) (-2337.669) [-2326.400] (-2328.958) * (-2342.393) [-2330.457] (-2335.403) (-2341.212) -- 0:00:04 983500 -- [-2336.242] (-2349.279) (-2329.063) (-2337.223) * [-2332.818] (-2331.588) (-2329.850) (-2338.142) -- 0:00:04 984000 -- (-2334.195) (-2337.351) (-2330.572) [-2332.364] * (-2331.894) [-2330.292] (-2336.129) (-2342.612) -- 0:00:04 984500 -- (-2333.997) [-2333.589] (-2336.626) (-2329.712) * (-2336.433) (-2332.445) [-2330.470] (-2332.162) -- 0:00:04 985000 -- (-2345.689) (-2332.170) [-2333.844] (-2334.057) * (-2334.303) [-2332.033] (-2332.459) (-2336.842) -- 0:00:04 Average standard deviation of split frequencies: 0.000159 985500 -- [-2330.608] (-2332.562) (-2331.980) (-2335.340) * [-2329.512] (-2332.768) (-2336.433) (-2336.523) -- 0:00:04 986000 -- (-2327.442) [-2329.124] (-2333.448) (-2328.606) * (-2328.055) [-2335.837] (-2339.195) (-2338.056) -- 0:00:04 986500 -- (-2335.974) [-2330.678] (-2337.347) (-2334.419) * (-2334.470) [-2338.412] (-2337.280) (-2332.761) -- 0:00:03 987000 -- (-2335.246) (-2342.736) [-2334.163] (-2329.625) * [-2331.987] (-2331.306) (-2324.293) (-2334.560) -- 0:00:03 987500 -- (-2334.541) (-2329.639) [-2339.197] (-2339.363) * (-2337.654) (-2341.922) (-2326.368) [-2327.010] -- 0:00:03 988000 -- [-2332.422] (-2334.363) (-2335.454) (-2339.775) * (-2332.590) (-2332.341) (-2332.982) [-2336.072] -- 0:00:03 988500 -- (-2334.647) (-2330.516) (-2334.106) [-2331.004] * (-2327.445) [-2330.091] (-2329.700) (-2342.081) -- 0:00:03 989000 -- (-2334.552) [-2331.352] (-2333.835) (-2333.410) * (-2337.235) (-2329.843) (-2329.828) [-2335.224] -- 0:00:03 989500 -- (-2327.433) [-2334.061] (-2327.327) (-2336.881) * (-2339.100) [-2330.112] (-2338.169) (-2329.423) -- 0:00:03 990000 -- [-2329.292] (-2330.682) (-2337.669) (-2335.810) * (-2326.739) [-2331.071] (-2339.195) (-2333.074) -- 0:00:02 Average standard deviation of split frequencies: 0.000159 990500 -- (-2333.510) (-2337.913) (-2331.626) [-2334.878] * [-2328.990] (-2333.788) (-2337.747) (-2335.757) -- 0:00:02 991000 -- (-2330.600) (-2337.511) [-2328.345] (-2334.576) * [-2331.023] (-2328.728) (-2333.928) (-2341.391) -- 0:00:02 991500 -- (-2340.178) (-2338.821) [-2334.984] (-2330.668) * (-2329.754) (-2339.286) (-2336.515) [-2329.811] -- 0:00:02 992000 -- (-2332.335) (-2334.445) [-2330.040] (-2334.789) * (-2332.037) (-2332.709) (-2334.602) [-2336.614] -- 0:00:02 992500 -- (-2329.175) [-2335.293] (-2338.975) (-2328.301) * [-2332.643] (-2331.517) (-2339.334) (-2342.420) -- 0:00:02 993000 -- [-2329.858] (-2337.053) (-2329.086) (-2330.282) * (-2331.960) [-2337.825] (-2335.965) (-2333.481) -- 0:00:02 993500 -- (-2340.281) [-2330.134] (-2332.981) (-2332.501) * [-2336.000] (-2342.605) (-2337.959) (-2332.170) -- 0:00:01 994000 -- (-2334.402) [-2331.646] (-2334.978) (-2341.231) * (-2329.290) (-2334.751) [-2329.189] (-2340.132) -- 0:00:01 994500 -- (-2338.040) [-2327.248] (-2332.903) (-2338.863) * [-2333.542] (-2334.505) (-2334.111) (-2328.865) -- 0:00:01 995000 -- [-2337.809] (-2331.079) (-2342.072) (-2335.441) * [-2331.703] (-2332.397) (-2332.033) (-2328.961) -- 0:00:01 Average standard deviation of split frequencies: 0.000000 995500 -- [-2329.404] (-2343.503) (-2328.185) (-2335.852) * [-2333.787] (-2335.630) (-2341.220) (-2336.667) -- 0:00:01 996000 -- [-2331.630] (-2331.126) (-2328.040) (-2345.680) * [-2339.299] (-2335.364) (-2328.347) (-2331.352) -- 0:00:01 996500 -- (-2333.742) (-2339.157) (-2334.041) [-2331.678] * (-2337.059) (-2340.710) [-2328.595] (-2333.744) -- 0:00:01 997000 -- [-2334.130] (-2329.554) (-2333.081) (-2329.336) * (-2334.859) (-2333.293) (-2342.363) [-2328.462] -- 0:00:00 997500 -- (-2333.432) (-2335.774) (-2340.341) [-2330.507] * (-2340.241) (-2333.454) [-2334.216] (-2334.417) -- 0:00:00 998000 -- (-2337.485) (-2332.141) (-2337.452) [-2331.107] * (-2331.568) (-2330.317) [-2331.012] (-2338.484) -- 0:00:00 998500 -- (-2327.136) [-2330.843] (-2330.256) (-2333.539) * [-2329.318] (-2332.589) (-2331.084) (-2330.599) -- 0:00:00 999000 -- (-2333.758) [-2332.672] (-2331.332) (-2331.612) * [-2328.679] (-2330.575) (-2327.809) (-2325.647) -- 0:00:00 999500 -- (-2345.301) [-2330.774] (-2334.065) (-2328.630) * (-2334.752) (-2336.402) [-2336.459] (-2335.757) -- 0:00:00 1000000 -- (-2334.136) (-2336.219) [-2334.410] (-2338.439) * [-2331.047] (-2337.988) (-2339.585) (-2327.365) -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2334.136036 -- 11.730331 Chain 1 -- -2334.136035 -- 11.730331 Chain 2 -- -2336.218852 -- 13.384355 Chain 2 -- -2336.218858 -- 13.384355 Chain 3 -- -2334.409897 -- 14.144258 Chain 3 -- -2334.409896 -- 14.144258 Chain 4 -- -2338.438768 -- 7.935571 Chain 4 -- -2338.438768 -- 7.935571 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2331.047443 -- 12.593625 Chain 1 -- -2331.047446 -- 12.593625 Chain 2 -- -2337.987906 -- 14.480233 Chain 2 -- -2337.987907 -- 14.480233 Chain 3 -- -2339.584910 -- 11.694534 Chain 3 -- -2339.584915 -- 11.694534 Chain 4 -- -2327.364519 -- 10.372215 Chain 4 -- -2327.364519 -- 10.372215 Analysis completed in 4 mins 46 seconds Analysis used 286.07 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2321.73 Likelihood of best state for "cold" chain of run 2 was -2321.75 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 48.6 % ( 38 %) Dirichlet(Revmat{all}) 63.6 % ( 46 %) Slider(Revmat{all}) 25.3 % ( 31 %) Dirichlet(Pi{all}) 27.3 % ( 23 %) Slider(Pi{all}) 59.4 % ( 34 %) Multiplier(Alpha{1,2}) 43.4 % ( 34 %) Multiplier(Alpha{3}) 58.6 % ( 28 %) Slider(Pinvar{all}) 0.7 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.3 % ( 0 %) ExtTBR(Tau{all},V{all}) 1.3 % ( 0 %) NNI(Tau{all},V{all}) 1.8 % ( 1 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 25 %) Multiplier(V{all}) 29.7 % ( 30 %) Nodeslider(V{all}) 25.4 % ( 25 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 48.5 % ( 36 %) Dirichlet(Revmat{all}) 63.0 % ( 48 %) Slider(Revmat{all}) 25.2 % ( 25 %) Dirichlet(Pi{all}) 27.1 % ( 28 %) Slider(Pi{all}) 58.3 % ( 25 %) Multiplier(Alpha{1,2}) 43.8 % ( 18 %) Multiplier(Alpha{3}) 58.1 % ( 33 %) Slider(Pinvar{all}) 0.6 % ( 2 %) ExtSPR(Tau{all},V{all}) 0.3 % ( 0 %) ExtTBR(Tau{all},V{all}) 1.3 % ( 3 %) NNI(Tau{all},V{all}) 1.8 % ( 2 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 25 %) Multiplier(V{all}) 29.7 % ( 26 %) Nodeslider(V{all}) 25.4 % ( 25 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.83 0.67 0.54 2 | 166783 0.84 0.70 3 | 166871 166335 0.85 4 | 166638 166879 166494 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.82 0.67 0.54 2 | 166470 0.84 0.69 3 | 166443 166417 0.85 4 | 166756 166820 167094 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2330.80 | 2 2 11 | | 1 1 1 1 1 | | 2 2 1 12 2 | | 2 1 1 22 | | 2 221 11 2 1 1 | |1 2 1 2 2 2 * 21 | | 2 1*2 1 1 2 1 * 1*| | 22 2 12 2 1 2 2 | | 1 112 1 1 1 * 1 11 2 2 1 2 2 | | 1122 * 1 22 2 1 2 | | 11 1 2 2 1 2 | |2 1 1 * 1 2 1 | | 2 2 1 2 1 | | 2 2 21 2 2 | | 1 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2334.04 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2328.89 -2343.18 2 -2328.98 -2339.51 -------------------------------------- TOTAL -2328.93 -2342.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.638287 0.005842 0.495139 0.788013 0.631348 1369.32 1401.92 1.000 r(A<->C){all} 0.104091 0.000918 0.046755 0.164655 0.101817 889.93 998.65 1.001 r(A<->G){all} 0.263061 0.001631 0.184446 0.339731 0.262263 721.68 942.39 1.001 r(A<->T){all} 0.105191 0.000547 0.060933 0.151164 0.103709 912.53 1105.87 1.001 r(C<->G){all} 0.051428 0.000489 0.012650 0.093778 0.048985 933.16 979.27 1.000 r(C<->T){all} 0.411496 0.002715 0.316031 0.514489 0.411491 898.91 961.32 1.001 r(G<->T){all} 0.064732 0.000339 0.030783 0.100917 0.063739 1142.71 1162.28 1.000 pi(A){all} 0.276166 0.000183 0.251236 0.303265 0.276065 1024.65 1103.55 1.000 pi(C){all} 0.184600 0.000139 0.162051 0.207237 0.184535 1056.44 1178.02 1.000 pi(G){all} 0.234878 0.000166 0.210972 0.261384 0.234523 1196.49 1284.73 1.000 pi(T){all} 0.304355 0.000192 0.276846 0.331488 0.303912 1094.16 1192.03 1.000 alpha{1,2} 0.056951 0.001179 0.000193 0.115211 0.055951 1036.26 1084.86 1.000 alpha{3} 2.869015 0.815578 1.348090 4.647137 2.734590 1303.79 1402.40 1.000 pinvar{all} 0.211430 0.005494 0.061652 0.356929 0.212182 1299.32 1309.27 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- ...*** 9 -- ...**. ------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 3002 1.000000 0.000000 1.000000 1.000000 2 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 2914 0.970686 0.000000 0.970686 0.970686 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.016742 0.000040 0.005507 0.029059 0.015896 1.002 2 length{all}[2] 0.005937 0.000010 0.000844 0.012263 0.005384 1.000 2 length{all}[3] 0.004836 0.000008 0.000447 0.010460 0.004311 1.000 2 length{all}[4] 0.074324 0.000222 0.047086 0.104437 0.073666 1.000 2 length{all}[5] 0.050386 0.000154 0.027433 0.075744 0.049276 1.000 2 length{all}[6] 0.372241 0.004012 0.258222 0.499482 0.364291 1.000 2 length{all}[7] 0.021719 0.000048 0.009113 0.035224 0.021058 1.000 2 length{all}[8] 0.058796 0.000323 0.024168 0.093898 0.056777 1.000 2 length{all}[9] 0.034014 0.000244 0.003820 0.062771 0.032865 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.002 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------ C4 (4) | /-----------97----------+ | | \------------------------ C5 (5) +----------100----------+ | \------------------------------------------------ C6 (6) | | /------------------------ C2 (2) \----------------------100----------------------+ \------------------------ C3 (3) Phylogram (based on average branch lengths): /--- C1 (1) | | /------------- C4 (4) | /----+ | | \--------- C5 (5) +---------+ | \-------------------------------------------------------------- C6 (6) | | /- C2 (2) \---+ \ C3 (3) |-------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (3 trees sampled): 99 % credible set contains 3 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 6 ls = 897 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sites with gaps or missing data are removed. 6 ambiguity characters in seq. 1 6 ambiguity characters in seq. 2 6 ambiguity characters in seq. 3 9 ambiguity characters in seq. 4 9 ambiguity characters in seq. 5 12 ambiguity characters in seq. 6 5 sites are removed. 75 76 258 298 299 Sequences read.. Counting site patterns.. 0:00 192 patterns at 294 / 294 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 187392 bytes for conP 26112 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 226 374784 bytes for conP, adjusted 0.036100 0.079196 0.075899 0.131359 0.099357 0.553446 0.035094 0.008966 0.008303 0.300000 1.300000 ntime & nrate & np: 9 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 11 lnL0 = -2482.925831 Iterating by ming2 Initial: fx= 2482.925831 x= 0.03610 0.07920 0.07590 0.13136 0.09936 0.55345 0.03509 0.00897 0.00830 0.30000 1.30000 1 h-m-p 0.0000 0.0005 313.1433 +++ 2454.199763 m 0.0005 17 | 0/11 2 h-m-p 0.0000 0.0000 90904.7070 +YCYCCC 2450.407169 5 0.0000 40 | 0/11 3 h-m-p 0.0000 0.0001 4166.1188 +YCYCCC 2420.643340 5 0.0001 63 | 0/11 4 h-m-p 0.0000 0.0002 1924.5680 +CYYYYYC 2378.883338 6 0.0002 85 | 0/11 5 h-m-p 0.0001 0.0006 4305.5460 CCCCC 2371.773305 4 0.0000 108 | 0/11 6 h-m-p 0.0001 0.0006 499.0910 +YCYCCCC 2330.480499 6 0.0005 133 | 0/11 7 h-m-p 0.0002 0.0011 291.0395 +CYCCC 2298.847382 4 0.0010 155 | 0/11 8 h-m-p 0.0000 0.0001 2998.7144 ++ 2267.998872 m 0.0001 169 | 0/11 9 h-m-p 0.0002 0.0009 245.2746 CYCCC 2262.774896 4 0.0003 190 | 0/11 10 h-m-p 0.0007 0.0033 124.2028 CCYC 2259.381885 3 0.0007 209 | 0/11 11 h-m-p 0.0003 0.0015 15.3479 ++ 2256.923386 m 0.0015 223 | 0/11 12 h-m-p -0.0000 -0.0000 39.4128 h-m-p: -2.07854819e-21 -1.03927410e-20 3.94128051e+01 2256.923386 .. | 0/11 13 h-m-p 0.0000 0.0002 3038.7001 +CYCCC 2222.742983 4 0.0000 256 | 0/11 14 h-m-p 0.0000 0.0001 392.2367 +YCYCCC 2210.644658 5 0.0001 279 | 0/11 15 h-m-p 0.0000 0.0000 840.7947 +YYYCCC 2207.024855 5 0.0000 301 | 0/11 16 h-m-p 0.0000 0.0001 1151.8349 +YYYCC 2196.161121 4 0.0001 321 | 0/11 17 h-m-p 0.0002 0.0011 207.6645 CCC 2192.740481 2 0.0003 339 | 0/11 18 h-m-p 0.0002 0.0008 209.9944 CCCC 2189.864786 3 0.0003 359 | 0/11 19 h-m-p 0.0008 0.0150 68.0607 YCCC 2187.505330 3 0.0015 378 | 0/11 20 h-m-p 0.0024 0.0120 18.3696 CCC 2187.401475 2 0.0007 396 | 0/11 21 h-m-p 0.0010 0.0888 12.6597 YCC 2187.306164 2 0.0017 413 | 0/11 22 h-m-p 0.0002 0.0205 96.6372 ++CCC 2185.917514 2 0.0036 433 | 0/11 23 h-m-p 0.0010 0.0048 100.3793 YYC 2185.609750 2 0.0007 449 | 0/11 24 h-m-p 0.7282 3.6408 0.0505 CCCC 2185.157773 3 0.7593 469 | 0/11 25 h-m-p 1.6000 8.0000 0.0209 CYC 2185.123794 2 1.4588 497 | 0/11 26 h-m-p 1.6000 8.0000 0.0033 CC 2185.117449 1 2.0566 524 | 0/11 27 h-m-p 1.6000 8.0000 0.0041 C 2185.116305 0 1.4487 549 | 0/11 28 h-m-p 1.6000 8.0000 0.0009 YC 2185.116018 1 2.8804 575 | 0/11 29 h-m-p 1.6000 8.0000 0.0004 +YC 2185.115452 1 4.7890 602 | 0/11 30 h-m-p 0.9139 8.0000 0.0020 C 2185.115285 0 1.4246 627 | 0/11 31 h-m-p 1.6000 8.0000 0.0003 Y 2185.115279 0 0.9671 652 | 0/11 32 h-m-p 1.6000 8.0000 0.0000 Y 2185.115279 0 1.1661 677 | 0/11 33 h-m-p 1.6000 8.0000 0.0000 Y 2185.115279 0 1.2454 702 | 0/11 34 h-m-p 1.6000 8.0000 0.0000 Y 2185.115279 0 1.0451 727 | 0/11 35 h-m-p 1.6000 8.0000 0.0000 ---------Y 2185.115279 0 0.0000 761 Out.. lnL = -2185.115279 762 lfun, 762 eigenQcodon, 6858 P(t) Time used: 0:03 Model 1: NearlyNeutral TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 226 0.036100 0.079196 0.075899 0.131359 0.099357 0.553446 0.035094 0.008966 0.008303 2.013962 0.747245 0.296991 ntime & nrate & np: 9 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.302425 np = 12 lnL0 = -2246.221055 Iterating by ming2 Initial: fx= 2246.221055 x= 0.03610 0.07920 0.07590 0.13136 0.09936 0.55345 0.03509 0.00897 0.00830 2.01396 0.74724 0.29699 1 h-m-p 0.0000 0.0016 236.9545 +++YCCYCCC 2192.982865 6 0.0013 31 | 0/12 2 h-m-p 0.0000 0.0001 622.9853 CYCCC 2190.550398 4 0.0000 53 | 0/12 3 h-m-p 0.0001 0.0003 108.3551 +YCCC 2189.788657 3 0.0001 74 | 0/12 4 h-m-p 0.0001 0.0007 160.9240 YCCCC 2188.575585 4 0.0002 96 | 0/12 5 h-m-p 0.0003 0.0015 23.6927 CCCC 2188.473558 3 0.0004 117 | 0/12 6 h-m-p 0.0002 0.0020 42.6906 CCC 2188.351707 2 0.0003 136 | 0/12 7 h-m-p 0.0006 0.0270 20.0357 YC 2188.176553 1 0.0013 152 | 0/12 8 h-m-p 0.0014 0.0126 17.7737 CYC 2188.040049 2 0.0012 170 | 0/12 9 h-m-p 0.0015 0.0206 14.6391 CCC 2187.807771 2 0.0025 189 | 0/12 10 h-m-p 0.0018 0.0798 20.0165 ++CYCCCC 2182.066867 5 0.0393 215 | 0/12 11 h-m-p 0.0002 0.0010 440.9111 YCCCC 2180.705384 4 0.0004 237 | 0/12 12 h-m-p 0.0116 0.0578 3.3429 CCC 2180.656092 2 0.0031 256 | 0/12 13 h-m-p 0.0011 0.1337 9.4777 +++YYCCC 2177.491609 4 0.0586 280 | 0/12 14 h-m-p 0.3766 1.8828 1.3252 YCCCC 2175.083591 4 0.3915 302 | 0/12 15 h-m-p 1.6000 8.0000 0.1957 YCCC 2174.622546 3 0.7842 322 | 0/12 16 h-m-p 0.3540 1.7702 0.0585 YYC 2174.566174 2 0.2781 351 | 0/12 17 h-m-p 0.2430 8.0000 0.0669 +YC 2174.525197 1 0.8238 380 | 0/12 18 h-m-p 1.6000 8.0000 0.0188 YC 2174.519500 1 0.8178 408 | 0/12 19 h-m-p 1.6000 8.0000 0.0018 YC 2174.517614 1 1.0820 436 | 0/12 20 h-m-p 1.6000 8.0000 0.0008 YC 2174.517518 1 0.9366 464 | 0/12 21 h-m-p 1.1192 8.0000 0.0006 Y 2174.517499 0 0.5781 491 | 0/12 22 h-m-p 1.6000 8.0000 0.0001 Y 2174.517498 0 1.0319 518 | 0/12 23 h-m-p 1.6000 8.0000 0.0000 Y 2174.517498 0 0.9483 545 | 0/12 24 h-m-p 1.1559 8.0000 0.0000 C 2174.517498 0 1.1559 572 | 0/12 25 h-m-p 1.6000 8.0000 0.0000 --C 2174.517498 0 0.0250 601 Out.. lnL = -2174.517498 602 lfun, 1806 eigenQcodon, 10836 P(t) Time used: 0:08 Model 2: PositiveSelection TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 226 initial w for M2:NSpselection reset. 0.036100 0.079196 0.075899 0.131359 0.099357 0.553446 0.035094 0.008966 0.008303 2.067036 0.896732 0.199894 0.157918 2.073080 ntime & nrate & np: 9 3 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.261064 np = 14 lnL0 = -2273.062778 Iterating by ming2 Initial: fx= 2273.062778 x= 0.03610 0.07920 0.07590 0.13136 0.09936 0.55345 0.03509 0.00897 0.00830 2.06704 0.89673 0.19989 0.15792 2.07308 1 h-m-p 0.0000 0.0012 229.3735 +++YCC 2263.052673 2 0.0008 25 | 0/14 2 h-m-p 0.0000 0.0001 470.1195 ++ 2252.047305 m 0.0001 42 | 1/14 3 h-m-p 0.0005 0.0095 80.5240 ++YCCC 2239.299933 3 0.0053 66 | 1/14 4 h-m-p 0.0022 0.0112 188.6266 YYCCC 2236.096746 4 0.0008 89 | 0/14 5 h-m-p 0.0002 0.0024 618.1299 YCCC 2234.303735 3 0.0001 111 | 0/14 6 h-m-p 0.0005 0.0043 128.5839 +CCCC 2227.773706 3 0.0020 135 | 0/14 7 h-m-p 0.0008 0.0038 67.5303 +CYCCC 2220.284889 4 0.0032 160 | 0/14 8 h-m-p 0.0004 0.0022 178.0373 +YYCCCC 2212.326344 5 0.0014 186 | 0/14 9 h-m-p 0.0003 0.0017 307.0541 +YCYCCC 2202.959733 5 0.0009 212 | 0/14 10 h-m-p 0.0007 0.0036 56.5027 CCCCC 2201.671061 4 0.0008 237 | 0/14 11 h-m-p 0.0007 0.0034 36.5466 CCCC 2200.652466 3 0.0012 260 | 0/14 12 h-m-p 0.0002 0.0012 102.8024 +YYCCCC 2198.786786 5 0.0007 286 | 0/14 13 h-m-p 0.0057 0.0517 13.3039 ++ 2193.838319 m 0.0517 303 | 1/14 14 h-m-p 0.1196 1.2883 3.5151 YCCC 2184.016889 3 0.2629 325 | 1/14 15 h-m-p 0.0369 0.1847 6.1326 +YCCC 2180.584070 3 0.1042 348 | 1/14 16 h-m-p 0.2466 1.2328 1.7559 CYCC 2178.502431 3 0.2826 370 | 1/14 17 h-m-p 0.0604 0.3022 3.3216 CYCCC 2176.643991 4 0.1176 394 | 1/14 18 h-m-p 0.1118 0.5591 1.1548 YCCCC 2176.035320 4 0.2215 418 | 1/14 19 h-m-p 1.6000 8.0000 0.1233 YCC 2175.224244 2 1.1686 438 | 1/14 20 h-m-p 0.6027 3.0135 0.0948 CCCC 2174.830465 3 0.6179 474 | 1/14 21 h-m-p 0.4879 5.6777 0.1201 CCC 2174.628074 2 0.7068 508 | 1/14 22 h-m-p 1.2864 8.0000 0.0660 CCC 2174.550479 2 1.0360 542 | 1/14 23 h-m-p 1.6000 8.0000 0.0365 YC 2174.527738 1 0.7793 573 | 1/14 24 h-m-p 1.6000 8.0000 0.0140 YC 2174.519079 1 1.2346 604 | 1/14 25 h-m-p 1.6000 8.0000 0.0090 CC 2174.517661 1 1.3578 636 | 1/14 26 h-m-p 1.6000 8.0000 0.0007 Y 2174.517525 0 1.2029 666 | 1/14 27 h-m-p 1.6000 8.0000 0.0005 C 2174.517501 0 1.2835 696 | 1/14 28 h-m-p 1.6000 8.0000 0.0003 Y 2174.517498 0 0.9937 726 | 1/14 29 h-m-p 1.6000 8.0000 0.0000 C 2174.517498 0 1.3451 756 | 1/14 30 h-m-p 1.6000 8.0000 0.0000 Y 2174.517498 0 1.0391 786 | 1/14 31 h-m-p 1.6000 8.0000 0.0000 C 2174.517498 0 0.5400 816 | 1/14 32 h-m-p 1.0228 8.0000 0.0000 -C 2174.517498 0 0.0639 847 | 1/14 33 h-m-p 0.0807 8.0000 0.0000 -------Y 2174.517498 0 0.0000 884 Out.. lnL = -2174.517498 885 lfun, 3540 eigenQcodon, 23895 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2184.657258 S = -2091.447123 -84.114991 Calculating f(w|X), posterior probabilities of site classes. did 10 / 192 patterns 0:18 did 20 / 192 patterns 0:18 did 30 / 192 patterns 0:18 did 40 / 192 patterns 0:18 did 50 / 192 patterns 0:18 did 60 / 192 patterns 0:18 did 70 / 192 patterns 0:18 did 80 / 192 patterns 0:18 did 90 / 192 patterns 0:18 did 100 / 192 patterns 0:18 did 110 / 192 patterns 0:18 did 120 / 192 patterns 0:19 did 130 / 192 patterns 0:19 did 140 / 192 patterns 0:19 did 150 / 192 patterns 0:19 did 160 / 192 patterns 0:19 did 170 / 192 patterns 0:19 did 180 / 192 patterns 0:19 did 190 / 192 patterns 0:19 did 192 / 192 patterns 0:19 Time used: 0:19 Model 3: discrete TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 226 0.036100 0.079196 0.075899 0.131359 0.099357 0.553446 0.035094 0.008966 0.008303 2.067036 0.215184 0.509770 0.042877 0.107404 0.155647 ntime & nrate & np: 9 4 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 12.909752 np = 15 lnL0 = -2184.385087 Iterating by ming2 Initial: fx= 2184.385087 x= 0.03610 0.07920 0.07590 0.13136 0.09936 0.55345 0.03509 0.00897 0.00830 2.06704 0.21518 0.50977 0.04288 0.10740 0.15565 1 h-m-p 0.0000 0.0006 111.2142 ++YCC 2182.563090 2 0.0003 25 | 0/15 2 h-m-p 0.0000 0.0001 258.2456 ++ 2181.197401 m 0.0001 43 | 1/15 3 h-m-p 0.0001 0.0003 97.7905 CCCCC 2181.016739 4 0.0001 69 | 1/15 4 h-m-p 0.0001 0.0013 112.7228 +CCCC 2180.149081 3 0.0004 94 | 1/15 5 h-m-p 0.0001 0.0003 252.2137 +YCYC 2179.063544 3 0.0002 117 | 1/15 6 h-m-p 0.0002 0.0008 64.9344 +YCCC 2178.656980 3 0.0005 141 | 1/15 7 h-m-p 0.0010 0.0088 29.2428 YCCC 2178.529610 3 0.0005 164 | 1/15 8 h-m-p 0.0044 0.1286 3.4538 YC 2178.523202 1 0.0008 183 | 0/15 9 h-m-p 0.0003 0.0517 10.7992 +YC 2178.485345 1 0.0007 203 | 0/15 10 h-m-p 0.0017 0.1017 4.1421 +CCC 2178.387548 2 0.0105 226 | 0/15 11 h-m-p 0.0012 0.0346 35.4054 +CYC 2178.019921 2 0.0044 248 | 0/15 12 h-m-p 0.0011 0.0064 148.2068 CCC 2177.614607 2 0.0012 270 | 0/15 13 h-m-p 0.0011 0.0054 96.0057 ++ 2175.956999 m 0.0054 288 | 1/15 14 h-m-p 0.2447 1.5864 2.1276 YCCC 2175.529618 3 0.1374 311 | 1/15 15 h-m-p 0.0654 0.3271 0.3600 ++ 2175.060126 m 0.3271 329 | 1/15 16 h-m-p 0.0010 0.0084 112.1723 CCC 2174.779675 2 0.0013 365 | 1/15 17 h-m-p 0.0728 0.3638 0.7675 +YC 2174.638307 1 0.2325 385 | 1/15 18 h-m-p 0.7987 8.0000 0.2234 YCCC 2174.487167 3 0.5100 422 | 0/15 19 h-m-p 0.0113 0.2899 10.1239 --C 2174.485335 0 0.0002 456 | 0/15 20 h-m-p 0.0160 8.0000 0.1520 +++CCC 2174.432582 2 0.9733 481 | 0/15 21 h-m-p 0.8600 8.0000 0.1721 +CCC 2174.279703 2 3.9745 519 | 0/15 22 h-m-p 1.6000 8.0000 0.2088 CCC 2174.185426 2 1.6440 556 | 0/15 23 h-m-p 1.6000 8.0000 0.1169 YC 2174.158280 1 0.9680 590 | 0/15 24 h-m-p 1.4491 8.0000 0.0781 CC 2174.121015 1 1.9039 625 | 0/15 25 h-m-p 1.2127 8.0000 0.1226 CCCC 2174.086699 3 1.6833 664 | 0/15 26 h-m-p 0.9465 4.7325 0.1647 YCC 2174.075886 2 0.6491 700 | 0/15 27 h-m-p 1.6000 8.0000 0.0501 CC 2174.071275 1 1.3897 735 | 0/15 28 h-m-p 1.2176 8.0000 0.0572 YC 2174.066283 1 2.6083 769 | 0/15 29 h-m-p 1.6000 8.0000 0.0918 CCC 2174.061842 2 1.8159 806 | 0/15 30 h-m-p 1.5805 8.0000 0.1055 YC 2174.058536 1 1.1919 840 | 0/15 31 h-m-p 0.6187 4.0838 0.2032 CCC 2174.056386 2 0.7982 877 | 0/15 32 h-m-p 1.6000 8.0000 0.0188 YC 2174.055964 1 1.0320 911 | 0/15 33 h-m-p 0.7571 8.0000 0.0256 +Y 2174.055829 0 2.3941 945 | 0/15 34 h-m-p 1.6000 8.0000 0.0120 C 2174.055723 0 1.7845 978 | 0/15 35 h-m-p 1.6000 8.0000 0.0120 Y 2174.055714 0 0.9430 1011 | 0/15 36 h-m-p 1.6000 8.0000 0.0007 Y 2174.055714 0 0.9691 1044 | 0/15 37 h-m-p 1.6000 8.0000 0.0003 Y 2174.055714 0 0.8133 1077 | 0/15 38 h-m-p 1.6000 8.0000 0.0001 Y 2174.055714 0 1.1095 1110 | 0/15 39 h-m-p 1.6000 8.0000 0.0000 C 2174.055714 0 1.3169 1143 | 0/15 40 h-m-p 1.6000 8.0000 0.0000 ---C 2174.055714 0 0.0063 1179 Out.. lnL = -2174.055714 1180 lfun, 4720 eigenQcodon, 31860 P(t) Time used: 0:32 Model 7: beta TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 226 0.036100 0.079196 0.075899 0.131359 0.099357 0.553446 0.035094 0.008966 0.008303 2.050399 0.603915 1.022819 ntime & nrate & np: 9 1 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 8.244756 np = 12 lnL0 = -2222.101681 Iterating by ming2 Initial: fx= 2222.101681 x= 0.03610 0.07920 0.07590 0.13136 0.09936 0.55345 0.03509 0.00897 0.00830 2.05040 0.60392 1.02282 1 h-m-p 0.0000 0.0025 144.3571 ++YCCCC 2219.228219 4 0.0004 26 | 0/12 2 h-m-p 0.0000 0.0002 349.8306 +YYYYCC 2215.313188 5 0.0001 48 | 0/12 3 h-m-p 0.0000 0.0001 1272.5132 +YYCYC 2211.578085 4 0.0000 69 | 0/12 4 h-m-p 0.0001 0.0008 717.5598 +YYCYYYYCC 2183.324859 8 0.0005 95 | 0/12 5 h-m-p 0.0004 0.0018 116.8859 CCCCC 2181.499236 4 0.0004 118 | 0/12 6 h-m-p 0.0002 0.0009 36.2533 CCY 2181.399418 2 0.0002 137 | 0/12 7 h-m-p 0.0002 0.0192 36.9120 ++CCC 2180.188428 2 0.0033 158 | 0/12 8 h-m-p 0.0010 0.0055 115.1702 CCCCC 2178.507134 4 0.0015 181 | 0/12 9 h-m-p 0.0019 0.0094 38.2329 YCC 2178.195703 2 0.0011 199 | 0/12 10 h-m-p 0.0065 0.1063 6.3408 CCC 2178.154735 2 0.0020 218 | 0/12 11 h-m-p 0.0013 0.0575 9.4246 CC 2178.109159 1 0.0017 235 | 0/12 12 h-m-p 0.0226 1.7332 0.7232 ++CCCCC 2175.328638 4 0.4871 260 | 0/12 13 h-m-p 0.1286 0.6843 2.7398 CCC 2174.613664 2 0.1055 291 | 0/12 14 h-m-p 0.6172 3.0862 0.0905 YYC 2174.372153 2 0.4870 308 | 0/12 15 h-m-p 1.6000 8.0000 0.0240 YYC 2174.306776 2 1.3082 337 | 0/12 16 h-m-p 1.6000 8.0000 0.0138 YC 2174.293446 1 1.3202 365 | 0/12 17 h-m-p 0.7051 8.0000 0.0258 +C 2174.278744 0 2.9160 393 | 0/12 18 h-m-p 1.6000 8.0000 0.0402 YCC 2174.257899 2 3.1111 423 | 0/12 19 h-m-p 1.6000 8.0000 0.0232 YC 2174.251995 1 1.2152 451 | 0/12 20 h-m-p 1.6000 8.0000 0.0054 YC 2174.251184 1 1.0522 479 | 0/12 21 h-m-p 1.6000 8.0000 0.0024 Y 2174.251159 0 0.9372 506 | 0/12 22 h-m-p 1.6000 8.0000 0.0002 Y 2174.251159 0 1.0079 533 | 0/12 23 h-m-p 1.6000 8.0000 0.0000 Y 2174.251159 0 1.0312 560 | 0/12 24 h-m-p 1.6000 8.0000 0.0000 C 2174.251159 0 1.6000 587 | 0/12 25 h-m-p 1.6000 8.0000 0.0000 --C 2174.251159 0 0.0250 616 | 0/12 26 h-m-p 0.0534 8.0000 0.0000 C 2174.251159 0 0.0134 643 Out.. lnL = -2174.251159 644 lfun, 7084 eigenQcodon, 57960 P(t) Time used: 0:57 Model 8: beta&w>1 TREE # 1 (1, ((4, 5), 6), (2, 3)); MP score: 226 initial w for M8:NSbetaw>1 reset. 0.036100 0.079196 0.075899 0.131359 0.099357 0.553446 0.035094 0.008966 0.008303 2.049014 0.900000 0.523761 1.873198 2.941449 ntime & nrate & np: 9 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 7.120693 np = 14 lnL0 = -2218.868471 Iterating by ming2 Initial: fx= 2218.868471 x= 0.03610 0.07920 0.07590 0.13136 0.09936 0.55345 0.03509 0.00897 0.00830 2.04901 0.90000 0.52376 1.87320 2.94145 1 h-m-p 0.0000 0.0003 372.2693 +++ 2197.047934 m 0.0003 20 | 1/14 2 h-m-p 0.0001 0.0004 154.6813 +YYYCCC 2193.754437 5 0.0003 45 | 1/14 3 h-m-p 0.0001 0.0003 216.6191 +YCYCCC 2192.000409 5 0.0002 71 | 1/14 4 h-m-p 0.0002 0.0009 216.0240 +YYCCC 2186.738081 4 0.0006 95 | 1/14 5 h-m-p 0.0001 0.0004 973.3014 CYCCCC 2182.718379 5 0.0001 121 | 1/14 6 h-m-p 0.0007 0.0036 62.3804 CYC 2181.861524 2 0.0007 141 | 0/14 7 h-m-p 0.0006 0.0124 71.3658 CYC 2181.451923 2 0.0002 161 | 0/14 8 h-m-p 0.0006 0.0110 22.4976 YCC 2181.248076 2 0.0010 181 | 0/14 9 h-m-p 0.0012 0.0216 18.9814 YC 2180.947115 1 0.0027 199 | 0/14 10 h-m-p 0.0024 0.0165 21.0610 YCC 2180.808815 2 0.0014 219 | 0/14 11 h-m-p 0.0048 0.1146 6.1637 +CYC 2180.494477 2 0.0181 240 | 0/14 12 h-m-p 0.0017 0.0136 65.8812 ++ 2177.869983 m 0.0136 257 | 0/14 13 h-m-p 0.0000 0.0000 4.5943 h-m-p: 0.00000000e+00 0.00000000e+00 4.59425095e+00 2177.869983 .. | 0/14 14 h-m-p 0.0000 0.0002 127.1811 +CYCCC 2177.232023 4 0.0001 296 | 0/14 15 h-m-p 0.0000 0.0004 190.0995 YCCC 2176.223572 3 0.0001 318 | 0/14 16 h-m-p 0.0001 0.0003 253.2086 YCC 2175.867525 2 0.0000 338 | 0/14 17 h-m-p 0.0000 0.0002 35.0730 ++ 2175.733138 m 0.0002 355 | 1/14 18 h-m-p 0.0002 0.0021 31.0747 CCC 2175.677102 2 0.0002 376 | 1/14 19 h-m-p 0.0004 0.0347 18.1511 +CCC 2175.494295 2 0.0017 398 | 1/14 20 h-m-p 0.0020 0.0410 15.2407 YC 2175.431511 1 0.0009 416 | 1/14 21 h-m-p 0.0020 0.0441 7.1594 YC 2175.404782 1 0.0015 434 | 1/14 22 h-m-p 0.0014 0.0648 7.3306 CC 2175.378681 1 0.0020 453 | 1/14 23 h-m-p 0.0017 0.0969 8.6831 +CCC 2175.266499 2 0.0088 475 | 1/14 24 h-m-p 0.0021 0.0658 35.9112 +YYC 2174.911308 2 0.0069 495 | 1/14 25 h-m-p 0.0159 0.0797 2.0431 -C 2174.909777 0 0.0010 513 | 1/14 26 h-m-p 0.0046 2.2988 1.0930 +++YCYCC 2174.490327 4 0.7869 539 | 1/14 27 h-m-p 0.3609 1.8047 1.0517 YYCCCCC 2174.308910 6 0.4134 566 | 1/14 28 h-m-p 1.4704 7.3520 0.2155 YC 2174.256027 1 0.7189 584 | 1/14 29 h-m-p 1.6000 8.0000 0.0886 CC 2174.251897 1 0.5711 616 | 1/14 30 h-m-p 1.6000 8.0000 0.0041 YC 2174.251752 1 0.9318 647 | 1/14 31 h-m-p 1.6000 8.0000 0.0016 Y 2174.251747 0 0.7422 677 | 1/14 32 h-m-p 1.6000 8.0000 0.0004 Y 2174.251746 0 3.2402 707 | 1/14 33 h-m-p 1.0164 8.0000 0.0014 ++ 2174.251739 m 8.0000 737 | 1/14 34 h-m-p 0.1757 8.0000 0.0647 ++Y 2174.251692 0 2.3270 769 | 1/14 35 h-m-p 1.6000 8.0000 0.0771 ++ 2174.251328 m 8.0000 799 | 1/14 36 h-m-p 0.0411 0.2053 1.0107 ++ 2174.251237 m 0.2053 829 | 2/14 37 h-m-p 0.1970 8.0000 0.0011 +C 2174.251203 0 0.9842 847 | 2/14 38 h-m-p 1.6000 8.0000 0.0003 Y 2174.251203 0 0.9683 876 | 2/14 39 h-m-p 1.6000 8.0000 0.0000 Y 2174.251203 0 0.2610 905 | 2/14 40 h-m-p 0.3971 8.0000 0.0000 --------C 2174.251203 0 0.0000 942 Out.. lnL = -2174.251203 943 lfun, 11316 eigenQcodon, 93357 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2186.499313 S = -2091.913866 -86.150711 Calculating f(w|X), posterior probabilities of site classes. did 10 / 192 patterns 1:37 did 20 / 192 patterns 1:37 did 30 / 192 patterns 1:37 did 40 / 192 patterns 1:37 did 50 / 192 patterns 1:37 did 60 / 192 patterns 1:38 did 70 / 192 patterns 1:38 did 80 / 192 patterns 1:38 did 90 / 192 patterns 1:38 did 100 / 192 patterns 1:38 did 110 / 192 patterns 1:39 did 120 / 192 patterns 1:39 did 130 / 192 patterns 1:39 did 140 / 192 patterns 1:39 did 150 / 192 patterns 1:39 did 160 / 192 patterns 1:39 did 170 / 192 patterns 1:40 did 180 / 192 patterns 1:40 did 190 / 192 patterns 1:40 did 192 / 192 patterns 1:40 Time used: 1:40 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=299 D_melanogaster_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT D_sechellia_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT D_simulans_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT D_yakuba_Zip102B-PF MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT D_erecta_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT D_takahashii_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT *:******:***************************************** D_melanogaster_Zip102B-PF ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV D_sechellia_Zip102B-PF ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV D_simulans_Zip102B-PF ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV D_yakuba_Zip102B-PF ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV D_erecta_Zip102B-PF ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV D_takahashii_Zip102B-PF ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV ** ***********:* . :. * **: ******************** D_melanogaster_Zip102B-PF DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF D_sechellia_Zip102B-PF DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF D_simulans_Zip102B-PF DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF D_yakuba_Zip102B-PF DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF D_erecta_Zip102B-PF DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF D_takahashii_Zip102B-PF DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF **.***:*.* :************************************** D_melanogaster_Zip102B-PF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI D_sechellia_Zip102B-PF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI D_simulans_Zip102B-PF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI D_yakuba_Zip102B-PF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI D_erecta_Zip102B-PF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI D_takahashii_Zip102B-PF LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI *************************:******.********:******** D_melanogaster_Zip102B-PF GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY D_sechellia_Zip102B-PF GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY D_simulans_Zip102B-PF GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY D_yakuba_Zip102B-PF GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY D_erecta_Zip102B-PF GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY D_takahashii_Zip102B-PF GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY *****:***********************************:::****:* D_melanogaster_Zip102B-PF CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH-- D_sechellia_Zip102B-PF CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- D_simulans_Zip102B-PF CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH-- D_yakuba_Zip102B-PF HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo- D_erecta_Zip102B-PF HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo- D_takahashii_Zip102B-PF RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo ****** .*:* *.**:::******.*:********:**:**:*
>D_melanogaster_Zip102B-PF ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------ >D_sechellia_Zip102B-PF ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------ >D_simulans_Zip102B-PF ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------ >D_yakuba_Zip102B-PF ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------ >D_erecta_Zip102B-PF ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------ >D_takahashii_Zip102B-PF ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------
>D_melanogaster_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH >D_sechellia_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH >D_simulans_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH >D_yakuba_Zip102B-PF MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH >D_erecta_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH >D_takahashii_Zip102B-PF MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKH
#NEXUS [ID: 1551362503] begin taxa; dimensions ntax=6; taxlabels D_melanogaster_Zip102B-PF D_sechellia_Zip102B-PF D_simulans_Zip102B-PF D_yakuba_Zip102B-PF D_erecta_Zip102B-PF D_takahashii_Zip102B-PF ; end; begin trees; translate 1 D_melanogaster_Zip102B-PF, 2 D_sechellia_Zip102B-PF, 3 D_simulans_Zip102B-PF, 4 D_yakuba_Zip102B-PF, 5 D_erecta_Zip102B-PF, 6 D_takahashii_Zip102B-PF ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01589635,((4:0.07366552,5:0.04927597)0.971:0.03286543,6:0.3642908)1.000:0.05677655,(2:0.005384163,3:0.004310623)1.000:0.02105818); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01589635,((4:0.07366552,5:0.04927597):0.03286543,6:0.3642908):0.05677655,(2:0.005384163,3:0.004310623):0.02105818); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2328.89 -2343.18 2 -2328.98 -2339.51 -------------------------------------- TOTAL -2328.93 -2342.52 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.638287 0.005842 0.495139 0.788013 0.631348 1369.32 1401.92 1.000 r(A<->C){all} 0.104091 0.000918 0.046755 0.164655 0.101817 889.93 998.65 1.001 r(A<->G){all} 0.263061 0.001631 0.184446 0.339731 0.262263 721.68 942.39 1.001 r(A<->T){all} 0.105191 0.000547 0.060933 0.151164 0.103709 912.53 1105.87 1.001 r(C<->G){all} 0.051428 0.000489 0.012650 0.093778 0.048985 933.16 979.27 1.000 r(C<->T){all} 0.411496 0.002715 0.316031 0.514489 0.411491 898.91 961.32 1.001 r(G<->T){all} 0.064732 0.000339 0.030783 0.100917 0.063739 1142.71 1162.28 1.000 pi(A){all} 0.276166 0.000183 0.251236 0.303265 0.276065 1024.65 1103.55 1.000 pi(C){all} 0.184600 0.000139 0.162051 0.207237 0.184535 1056.44 1178.02 1.000 pi(G){all} 0.234878 0.000166 0.210972 0.261384 0.234523 1196.49 1284.73 1.000 pi(T){all} 0.304355 0.000192 0.276846 0.331488 0.303912 1094.16 1192.03 1.000 alpha{1,2} 0.056951 0.001179 0.000193 0.115211 0.055951 1036.26 1084.86 1.000 alpha{3} 2.869015 0.815578 1.348090 4.647137 2.734590 1303.79 1402.40 1.000 pinvar{all} 0.211430 0.005494 0.061652 0.356929 0.212182 1299.32 1309.27 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 294 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 8 7 7 9 9 6 | Ser TCT 4 4 4 1 2 3 | Tyr TAT 5 5 5 5 5 3 | Cys TGT 2 2 2 2 2 2 TTC 3 4 4 1 2 4 | TCC 4 4 4 4 4 1 | TAC 2 2 2 2 2 4 | TGC 1 1 1 1 1 0 Leu TTA 11 12 12 12 7 12 | TCA 2 2 2 2 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 10 12 12 13 14 11 | TCG 1 1 1 3 2 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 8 9 9 10 9 8 | Pro CCT 0 0 0 0 0 1 | His CAT 7 7 7 7 8 7 | Arg CGT 0 0 0 1 0 1 CTC 2 2 2 0 1 3 | CCC 2 2 2 1 1 0 | CAC 3 3 3 5 3 4 | CGC 1 1 1 2 2 0 CTA 8 7 7 7 11 7 | CCA 3 3 3 4 4 5 | Gln CAA 7 7 7 5 7 4 | CGA 2 2 2 2 3 4 CTG 6 5 5 6 4 7 | CCG 3 3 3 4 3 2 | CAG 5 5 5 5 5 8 | CGG 2 2 2 0 0 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 13 12 14 10 12 9 | Thr ACT 7 8 8 10 11 9 | Asn AAT 9 9 9 8 8 8 | Ser AGT 5 4 4 4 3 3 ATC 2 2 1 3 2 1 | ACC 3 3 3 1 2 5 | AAC 1 1 1 2 1 1 | AGC 5 4 4 5 5 6 ATA 7 7 6 9 9 10 | ACA 6 6 6 5 4 2 | Lys AAA 8 7 7 8 8 6 | Arg AGA 2 2 2 2 2 1 Met ATG 9 9 9 9 9 10 | ACG 4 4 4 4 3 3 | AAG 4 5 5 4 4 6 | AGG 0 0 0 0 0 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 9 11 11 11 8 12 | Ala GCT 10 11 11 10 10 7 | Asp GAT 5 7 7 6 6 5 | Gly GGT 1 1 1 4 4 7 GTC 3 3 3 2 6 5 | GCC 4 3 3 3 4 7 | GAC 4 2 2 3 4 5 | GGC 3 3 3 2 2 2 GTA 4 5 5 5 3 2 | GCA 10 10 10 10 9 10 | Glu GAA 4 5 5 4 4 8 | GGA 15 16 16 14 14 8 GTG 11 8 8 7 8 6 | GCG 0 0 0 2 1 1 | GAG 9 8 8 9 9 6 | GGG 5 4 4 4 4 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Zip102B-PF position 1: T:0.18027 C:0.20068 A:0.28912 G:0.32993 position 2: T:0.38776 C:0.21429 A:0.24830 G:0.14966 position 3: T:0.31633 C:0.14626 A:0.30272 G:0.23469 Average T:0.29478 C:0.18707 A:0.28005 G:0.23810 #2: D_sechellia_Zip102B-PF position 1: T:0.19048 C:0.19728 A:0.28231 G:0.32993 position 2: T:0.39116 C:0.21769 A:0.24830 G:0.14286 position 3: T:0.32993 C:0.13605 A:0.30952 G:0.22449 Average T:0.30385 C:0.18367 A:0.28005 G:0.23243 #3: D_simulans_Zip102B-PF position 1: T:0.19048 C:0.19728 A:0.28231 G:0.32993 position 2: T:0.39116 C:0.21769 A:0.24830 G:0.14286 position 3: T:0.33673 C:0.13265 A:0.30612 G:0.22449 Average T:0.30612 C:0.18254 A:0.27891 G:0.23243 #4: D_yakuba_Zip102B-PF position 1: T:0.18707 C:0.20068 A:0.28571 G:0.32653 position 2: T:0.38776 C:0.21769 A:0.24830 G:0.14626 position 3: T:0.33333 C:0.12585 A:0.30272 G:0.23810 Average T:0.30272 C:0.18141 A:0.27891 G:0.23696 #5: D_erecta_Zip102B-PF position 1: T:0.18367 C:0.20748 A:0.28231 G:0.32653 position 2: T:0.38776 C:0.21769 A:0.25170 G:0.14286 position 3: T:0.32993 C:0.14286 A:0.30272 G:0.22449 Average T:0.30045 C:0.18934 A:0.27891 G:0.23129 #6: D_takahashii_Zip102B-PF position 1: T:0.18027 C:0.21088 A:0.27551 G:0.33333 position 2: T:0.38435 C:0.21429 A:0.25510 G:0.14626 position 3: T:0.30952 C:0.16327 A:0.28231 G:0.24490 Average T:0.29138 C:0.19615 A:0.27098 G:0.24150 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 46 | Ser S TCT 18 | Tyr Y TAT 28 | Cys C TGT 12 TTC 18 | TCC 21 | TAC 14 | TGC 5 Leu L TTA 66 | TCA 16 | *** * TAA 0 | *** * TGA 0 TTG 72 | TCG 11 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 53 | Pro P CCT 1 | His H CAT 43 | Arg R CGT 2 CTC 10 | CCC 8 | CAC 21 | CGC 7 CTA 47 | CCA 22 | Gln Q CAA 37 | CGA 15 CTG 33 | CCG 18 | CAG 33 | CGG 7 ------------------------------------------------------------------------------ Ile I ATT 70 | Thr T ACT 53 | Asn N AAT 51 | Ser S AGT 23 ATC 11 | ACC 17 | AAC 7 | AGC 29 ATA 48 | ACA 29 | Lys K AAA 44 | Arg R AGA 11 Met M ATG 55 | ACG 22 | AAG 28 | AGG 1 ------------------------------------------------------------------------------ Val V GTT 62 | Ala A GCT 59 | Asp D GAT 36 | Gly G GGT 18 GTC 22 | GCC 24 | GAC 20 | GGC 15 GTA 24 | GCA 59 | Glu E GAA 30 | GGA 83 GTG 48 | GCG 4 | GAG 49 | GGG 28 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.18537 C:0.20238 A:0.28288 G:0.32937 position 2: T:0.38832 C:0.21655 A:0.25000 G:0.14512 position 3: T:0.32596 C:0.14116 A:0.30102 G:0.23186 Average T:0.29989 C:0.18670 A:0.27797 G:0.23545 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Zip102B-PF D_sechellia_Zip102B-PF 0.0998 (0.0084 0.0838) D_simulans_Zip102B-PF 0.1062 (0.0084 0.0787)-1.0000 (0.0000 0.0230) D_yakuba_Zip102B-PF 0.1196 (0.0372 0.3107) 0.1305 (0.0428 0.3277) 0.1333 (0.0428 0.3207) D_erecta_Zip102B-PF 0.0795 (0.0238 0.2995) 0.0947 (0.0293 0.3093) 0.0947 (0.0293 0.3093) 0.1332 (0.0293 0.2199) D_takahashii_Zip102B-PF 0.0579 (0.0452 0.7802) 0.0664 (0.0490 0.7374) 0.0669 (0.0498 0.7434) 0.0696 (0.0576 0.8266) 0.0553 (0.0468 0.8457) Model 0: one-ratio TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 226 lnL(ntime: 9 np: 11): -2185.115279 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.028604 0.097056 0.066570 0.146312 0.097193 0.540150 0.045469 0.010186 0.007621 2.013962 0.085755 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.03916 (1: 0.028604, ((4: 0.146312, 5: 0.097193): 0.066570, 6: 0.540150): 0.097056, (2: 0.010186, 3: 0.007621): 0.045469); (D_melanogaster_Zip102B-PF: 0.028604, ((D_yakuba_Zip102B-PF: 0.146312, D_erecta_Zip102B-PF: 0.097193): 0.066570, D_takahashii_Zip102B-PF: 0.540150): 0.097056, (D_sechellia_Zip102B-PF: 0.010186, D_simulans_Zip102B-PF: 0.007621): 0.045469); Detailed output identifying parameters kappa (ts/tv) = 2.01396 omega (dN/dS) = 0.08575 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.029 642.3 239.7 0.0858 0.0024 0.0285 1.6 6.8 7..8 0.097 642.3 239.7 0.0858 0.0083 0.0968 5.3 23.2 8..9 0.067 642.3 239.7 0.0858 0.0057 0.0664 3.7 15.9 9..4 0.146 642.3 239.7 0.0858 0.0125 0.1459 8.0 35.0 9..5 0.097 642.3 239.7 0.0858 0.0083 0.0969 5.3 23.2 8..6 0.540 642.3 239.7 0.0858 0.0462 0.5387 29.7 129.1 7..10 0.045 642.3 239.7 0.0858 0.0039 0.0453 2.5 10.9 10..2 0.010 642.3 239.7 0.0858 0.0009 0.0102 0.6 2.4 10..3 0.008 642.3 239.7 0.0858 0.0007 0.0076 0.4 1.8 tree length for dN: 0.0889 tree length for dS: 1.0364 Time used: 0:03 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 226 lnL(ntime: 9 np: 12): -2174.517498 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.028907 0.101645 0.064871 0.149238 0.099048 0.564786 0.045701 0.010235 0.007615 2.067036 0.932455 0.042307 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.07205 (1: 0.028907, ((4: 0.149238, 5: 0.099048): 0.064871, 6: 0.564786): 0.101645, (2: 0.010235, 3: 0.007615): 0.045701); (D_melanogaster_Zip102B-PF: 0.028907, ((D_yakuba_Zip102B-PF: 0.149238, D_erecta_Zip102B-PF: 0.099048): 0.064871, D_takahashii_Zip102B-PF: 0.564786): 0.101645, (D_sechellia_Zip102B-PF: 0.010235, D_simulans_Zip102B-PF: 0.007615): 0.045701); Detailed output identifying parameters kappa (ts/tv) = 2.06704 dN/dS (w) for site classes (K=2) p: 0.93246 0.06754 w: 0.04231 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.029 641.8 240.2 0.1070 0.0029 0.0275 1.9 6.6 7..8 0.102 641.8 240.2 0.1070 0.0104 0.0967 6.6 23.2 8..9 0.065 641.8 240.2 0.1070 0.0066 0.0617 4.2 14.8 9..4 0.149 641.8 240.2 0.1070 0.0152 0.1420 9.8 34.1 9..5 0.099 641.8 240.2 0.1070 0.0101 0.0943 6.5 22.6 8..6 0.565 641.8 240.2 0.1070 0.0575 0.5375 36.9 129.1 7..10 0.046 641.8 240.2 0.1070 0.0047 0.0435 3.0 10.4 10..2 0.010 641.8 240.2 0.1070 0.0010 0.0097 0.7 2.3 10..3 0.008 641.8 240.2 0.1070 0.0008 0.0072 0.5 1.7 Time used: 0:08 Model 2: PositiveSelection (3 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 226 lnL(ntime: 9 np: 14): -2174.517498 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.028907 0.101645 0.064871 0.149238 0.099049 0.564786 0.045700 0.010235 0.007615 2.067036 0.932455 0.032587 0.042307 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.07205 (1: 0.028907, ((4: 0.149238, 5: 0.099049): 0.064871, 6: 0.564786): 0.101645, (2: 0.010235, 3: 0.007615): 0.045700); (D_melanogaster_Zip102B-PF: 0.028907, ((D_yakuba_Zip102B-PF: 0.149238, D_erecta_Zip102B-PF: 0.099049): 0.064871, D_takahashii_Zip102B-PF: 0.564786): 0.101645, (D_sechellia_Zip102B-PF: 0.010235, D_simulans_Zip102B-PF: 0.007615): 0.045700); Detailed output identifying parameters kappa (ts/tv) = 2.06704 dN/dS (w) for site classes (K=3) p: 0.93246 0.03259 0.03496 w: 0.04231 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.029 641.8 240.2 0.1070 0.0029 0.0275 1.9 6.6 7..8 0.102 641.8 240.2 0.1070 0.0104 0.0967 6.6 23.2 8..9 0.065 641.8 240.2 0.1070 0.0066 0.0617 4.2 14.8 9..4 0.149 641.8 240.2 0.1070 0.0152 0.1420 9.8 34.1 9..5 0.099 641.8 240.2 0.1070 0.0101 0.0943 6.5 22.6 8..6 0.565 641.8 240.2 0.1070 0.0575 0.5375 36.9 129.1 7..10 0.046 641.8 240.2 0.1070 0.0047 0.0435 3.0 10.4 10..2 0.010 641.8 240.2 0.1070 0.0010 0.0097 0.7 2.3 10..3 0.008 641.8 240.2 0.1070 0.0008 0.0072 0.5 1.7 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zip102B-PF) Pr(w>1) post mean +- SE for w 67 S 0.526 1.302 +- 0.418 70 S 0.533 1.264 +- 0.555 73 R 0.551 1.285 +- 0.542 262 N 0.535 1.314 +- 0.438 264 S 0.533 1.262 +- 0.555 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.893 0.090 0.012 0.003 0.001 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.998 sum of density on p0-p1 = 1.000000 Time used: 0:19 Model 3: discrete (3 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 226 lnL(ntime: 9 np: 15): -2174.055714 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.028550 0.100518 0.064990 0.148156 0.098550 0.560258 0.045833 0.010233 0.007593 2.050399 0.062162 0.822056 0.030379 0.030381 0.603864 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.06468 (1: 0.028550, ((4: 0.148156, 5: 0.098550): 0.064990, 6: 0.560258): 0.100518, (2: 0.010233, 3: 0.007593): 0.045833); (D_melanogaster_Zip102B-PF: 0.028550, ((D_yakuba_Zip102B-PF: 0.148156, D_erecta_Zip102B-PF: 0.098550): 0.064990, D_takahashii_Zip102B-PF: 0.560258): 0.100518, (D_sechellia_Zip102B-PF: 0.010233, D_simulans_Zip102B-PF: 0.007593): 0.045833); Detailed output identifying parameters kappa (ts/tv) = 2.05040 dN/dS (w) for site classes (K=3) p: 0.06216 0.82206 0.11578 w: 0.03038 0.03038 0.60386 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.029 641.9 240.1 0.0968 0.0027 0.0278 1.7 6.7 7..8 0.101 641.9 240.1 0.0968 0.0095 0.0978 6.1 23.5 8..9 0.065 641.9 240.1 0.0968 0.0061 0.0632 3.9 15.2 9..4 0.148 641.9 240.1 0.0968 0.0139 0.1441 9.0 34.6 9..5 0.099 641.9 240.1 0.0968 0.0093 0.0959 6.0 23.0 8..6 0.560 641.9 240.1 0.0968 0.0527 0.5450 33.9 130.9 7..10 0.046 641.9 240.1 0.0968 0.0043 0.0446 2.8 10.7 10..2 0.010 641.9 240.1 0.0968 0.0010 0.0100 0.6 2.4 10..3 0.008 641.9 240.1 0.0968 0.0007 0.0074 0.5 1.8 Naive Empirical Bayes (NEB) analysis Time used: 0:32 Model 7: beta (10 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 226 lnL(ntime: 9 np: 12): -2174.251159 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.028443 0.100058 0.065047 0.147680 0.098311 0.557982 0.045833 0.010227 0.007582 2.049014 0.154451 1.400764 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.06116 (1: 0.028443, ((4: 0.147680, 5: 0.098311): 0.065047, 6: 0.557982): 0.100058, (2: 0.010227, 3: 0.007582): 0.045833); (D_melanogaster_Zip102B-PF: 0.028443, ((D_yakuba_Zip102B-PF: 0.147680, D_erecta_Zip102B-PF: 0.098311): 0.065047, D_takahashii_Zip102B-PF: 0.557982): 0.100058, (D_sechellia_Zip102B-PF: 0.010227, D_simulans_Zip102B-PF: 0.007582): 0.045833); Detailed output identifying parameters kappa (ts/tv) = 2.04901 Parameters in M7 (beta): p = 0.15445 q = 1.40076 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00008 0.00070 0.00354 0.01304 0.03880 0.10017 0.23701 0.55601 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.028 641.9 240.1 0.0949 0.0026 0.0278 1.7 6.7 7..8 0.100 641.9 240.1 0.0949 0.0093 0.0977 6.0 23.5 8..9 0.065 641.9 240.1 0.0949 0.0060 0.0635 3.9 15.3 9..4 0.148 641.9 240.1 0.0949 0.0137 0.1442 8.8 34.6 9..5 0.098 641.9 240.1 0.0949 0.0091 0.0960 5.9 23.1 8..6 0.558 641.9 240.1 0.0949 0.0517 0.5450 33.2 130.8 7..10 0.046 641.9 240.1 0.0949 0.0042 0.0448 2.7 10.7 10..2 0.010 641.9 240.1 0.0949 0.0009 0.0100 0.6 2.4 10..3 0.008 641.9 240.1 0.0949 0.0007 0.0074 0.5 1.8 Time used: 0:57 Model 8: beta&w>1 (11 categories) TREE # 1: (1, ((4, 5), 6), (2, 3)); MP score: 226 lnL(ntime: 9 np: 14): -2174.251203 +0.000000 7..1 7..8 8..9 9..4 9..5 8..6 7..10 10..2 10..3 0.028443 0.100058 0.065047 0.147680 0.098311 0.557983 0.045833 0.010227 0.007581 2.049020 0.999990 0.154459 1.400944 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.06116 (1: 0.028443, ((4: 0.147680, 5: 0.098311): 0.065047, 6: 0.557983): 0.100058, (2: 0.010227, 3: 0.007581): 0.045833); (D_melanogaster_Zip102B-PF: 0.028443, ((D_yakuba_Zip102B-PF: 0.147680, D_erecta_Zip102B-PF: 0.098311): 0.065047, D_takahashii_Zip102B-PF: 0.557983): 0.100058, (D_sechellia_Zip102B-PF: 0.010227, D_simulans_Zip102B-PF: 0.007581): 0.045833); Detailed output identifying parameters kappa (ts/tv) = 2.04902 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.15446 q = 1.40094 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00008 0.00070 0.00354 0.01304 0.03880 0.10017 0.23699 0.55597 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.028 641.9 240.1 0.0949 0.0026 0.0278 1.7 6.7 7..8 0.100 641.9 240.1 0.0949 0.0093 0.0977 6.0 23.5 8..9 0.065 641.9 240.1 0.0949 0.0060 0.0635 3.9 15.3 9..4 0.148 641.9 240.1 0.0949 0.0137 0.1442 8.8 34.6 9..5 0.098 641.9 240.1 0.0949 0.0091 0.0960 5.9 23.1 8..6 0.558 641.9 240.1 0.0949 0.0517 0.5450 33.2 130.8 7..10 0.046 641.9 240.1 0.0949 0.0042 0.0448 2.7 10.7 10..2 0.010 641.9 240.1 0.0949 0.0009 0.0100 0.6 2.4 10..3 0.008 641.9 240.1 0.0949 0.0007 0.0074 0.5 1.8 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Zip102B-PF) Pr(w>1) post mean +- SE for w 53 V 0.534 1.021 +- 0.623 67 S 0.664 1.210 +- 0.536 69 Q 0.537 1.026 +- 0.617 70 S 0.632 1.149 +- 0.605 73 R 0.659 1.183 +- 0.593 241 T 0.559 1.054 +- 0.621 249 C 0.560 1.056 +- 0.615 262 N 0.672 1.220 +- 0.539 264 S 0.629 1.145 +- 0.607 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.002 0.014 0.057 0.148 0.294 0.485 ws: 0.945 0.050 0.004 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 1:40
Model 1: NearlyNeutral -2174.517498 Model 2: PositiveSelection -2174.517498 Model 0: one-ratio -2185.115279 Model 3: discrete -2174.055714 Model 7: beta -2174.251159 Model 8: beta&w>1 -2174.251203 Model 0 vs 1 21.19556199999988 Model 2 vs 1 0.0 Model 8 vs 7 8.799999977782136E-5