--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 16:03:34 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip102B-PF/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2328.89         -2343.18
2      -2328.98         -2339.51
--------------------------------------
TOTAL    -2328.93         -2342.52
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.638287    0.005842    0.495139    0.788013    0.631348   1369.32   1401.92    1.000
r(A<->C){all}   0.104091    0.000918    0.046755    0.164655    0.101817    889.93    998.65    1.001
r(A<->G){all}   0.263061    0.001631    0.184446    0.339731    0.262263    721.68    942.39    1.001
r(A<->T){all}   0.105191    0.000547    0.060933    0.151164    0.103709    912.53   1105.87    1.001
r(C<->G){all}   0.051428    0.000489    0.012650    0.093778    0.048985    933.16    979.27    1.000
r(C<->T){all}   0.411496    0.002715    0.316031    0.514489    0.411491    898.91    961.32    1.001
r(G<->T){all}   0.064732    0.000339    0.030783    0.100917    0.063739   1142.71   1162.28    1.000
pi(A){all}      0.276166    0.000183    0.251236    0.303265    0.276065   1024.65   1103.55    1.000
pi(C){all}      0.184600    0.000139    0.162051    0.207237    0.184535   1056.44   1178.02    1.000
pi(G){all}      0.234878    0.000166    0.210972    0.261384    0.234523   1196.49   1284.73    1.000
pi(T){all}      0.304355    0.000192    0.276846    0.331488    0.303912   1094.16   1192.03    1.000
alpha{1,2}      0.056951    0.001179    0.000193    0.115211    0.055951   1036.26   1084.86    1.000
alpha{3}        2.869015    0.815578    1.348090    4.647137    2.734590   1303.79   1402.40    1.000
pinvar{all}     0.211430    0.005494    0.061652    0.356929    0.212182   1299.32   1309.27    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2174.517498
Model 2: PositiveSelection	-2174.517498
Model 0: one-ratio	-2185.115279
Model 3: discrete	-2174.055714
Model 7: beta	-2174.251159
Model 8: beta&w>1	-2174.251203


Model 0 vs 1	21.19556199999988

Model 2 vs 1	0.0

Model 8 vs 7	8.799999977782136E-5
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESRDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESRDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLTPEHQDYSQTIGLSLVLGFVFMMLVDI
SQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVFLA
IMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGIGQ
EQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDYRL
LEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=299 

C1              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C2              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C3              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C4              MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C5              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C6              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
                *:******:*****************************************

C1              ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
C2              ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
C3              ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
C4              ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
C5              ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
C6              ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV
                ** ***********:* .  :. *  **: ********************

C1              DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C2              DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C3              DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C4              DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C5              DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C6              DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
                **.***:*.* :**************************************

C1              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
C2              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
C3              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
C4              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
C5              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
C6              LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
                *************************:******.********:********

C1              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
C2              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
C3              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
C4              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
C5              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
C6              GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
                *****:***********************************:::****:*

C1              CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH--
C2              CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
C3              CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
C4              HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo-
C5              HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo-
C6              RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo
                 ******  .*:*  *.**:::******.*:********:**:**:*  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [9136]--->[9092]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip102B-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.352 Mb, Max= 30.716 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo-
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo-
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo

FORMAT of file /tmp/tmp1659257975454698542aln Not Supported[FATAL:T-COFFEE]
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo-
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo-
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:299 S:99 BS:299
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.65 C1	 C2	 98.65
TOP	    1    0	 98.65 C2	 C1	 98.65
BOT	    0    2	 98.65 C1	 C3	 98.65
TOP	    2    0	 98.65 C3	 C1	 98.65
BOT	    0    3	 92.57 C1	 C4	 92.57
TOP	    3    0	 92.57 C4	 C1	 92.57
BOT	    0    4	 95.27 C1	 C5	 95.27
TOP	    4    0	 95.27 C5	 C1	 95.27
BOT	    0    5	 90.17 C1	 C6	 90.17
TOP	    5    0	 90.17 C6	 C1	 90.17
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 91.89 C2	 C4	 91.89
TOP	    3    1	 91.89 C4	 C2	 91.89
BOT	    1    4	 94.59 C2	 C5	 94.59
TOP	    4    1	 94.59 C5	 C2	 94.59
BOT	    1    5	 90.17 C2	 C6	 90.17
TOP	    5    1	 90.17 C6	 C2	 90.17
BOT	    2    3	 91.89 C3	 C4	 91.89
TOP	    3    2	 91.89 C4	 C3	 91.89
BOT	    2    4	 94.59 C3	 C5	 94.59
TOP	    4    2	 94.59 C5	 C3	 94.59
BOT	    2    5	 90.17 C3	 C6	 90.17
TOP	    5    2	 90.17 C6	 C3	 90.17
BOT	    3    4	 93.94 C4	 C5	 93.94
TOP	    4    3	 93.94 C5	 C4	 93.94
BOT	    3    5	 89.15 C4	 C6	 89.15
TOP	    5    3	 89.15 C6	 C4	 89.15
BOT	    4    5	 90.51 C5	 C6	 90.51
TOP	    5    4	 90.51 C6	 C5	 90.51
AVG	 0	 C1	  *	 95.06
AVG	 1	 C2	  *	 95.06
AVG	 2	 C3	  *	 95.06
AVG	 3	 C4	  *	 91.89
AVG	 4	 C5	  *	 93.78
AVG	 5	 C6	  *	 90.03
TOT	 TOT	  *	 93.48
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
C2              ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
C3              ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
C4              ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT
C5              ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT
C6              ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT
                ***.****.**.** **:*** * .*:**.***** **************

C1              GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG
C2              GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
C3              GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
C4              GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG
C5              GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG
C6              TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG
                 ***** ** ******** ************ *.********.*******

C1              AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C2              AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C3              AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C4              AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C5              AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT
C6              AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT
                ****.**.*****************.**.** **:***********:***

C1              GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG
C2              GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT
C3              GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT
C4              GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG
C5              GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG
C6              GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA
                ***** .  *****:**:**.**.** *****.*********.* ** : 

C1              TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC
C2              TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
C3              TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
C4              TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC
C5              TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC
C6              TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC
                **  * *  .*.*.*:* .**:      **.*****.*.*********.*

C1              AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
C2              AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG
C3              AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
C4              AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA
C5              AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
C6              AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG
                *.***** ******** ******** **:** ** ** ********.**.

C1              GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC
C2              GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
C3              GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
C4              GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC
C5              GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC
C6              GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC
                ** ** * :*****.**.*  ****  **** *.* *****.********

C1              CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT
C2              CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
C3              CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
C4              CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT
C5              CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT
C6              CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT
                ***. ******* ******** ** ** ** ***********:** ** *

C1              TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
C2              TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
C3              TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
C4              TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT
C5              TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
C6              TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT
                ****.*****:***** ** ********.** ******************

C1              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT
C2              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT
C3              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT
C4              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT
C5              TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT
C6              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT
                **.*****************.************** **. *.** **:**

C1              CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
C2              CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
C3              CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
C4              TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT
C5              CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT
C6              CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT
                  **** ** **.**.**:*****.**:********.********:*  *

C1              TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC
C2              TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
C3              TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
C4              TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC
C5              TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC
C6              TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA
                *.*****.*****.**:** ***:******** **** ********.**.

C1              GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC
C2              GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
C3              GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
C4              GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC
C5              GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC
C6              GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC
                **.***********.** ** ***** ** ** ***** ***** **:**

C1              TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT
C2              TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
C3              TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
C4              TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC
C5              TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC
C6              AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT
                :*****.** ** ** *****************:**.***** *****  

C1              TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT
C2              TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
C3              TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
C4              TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT
C5              TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT
C6              TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC
                *******.***** **.******** :*..*.*********** .**** 

C1              TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG
C2              TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
C3              TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
C4              CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG
C5              CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG
C6              CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA
                 .* *.*********** **    *:** *** .**** ::.:.****..

C1              CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG
C2              TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
C3              TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
C4              CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG
C5              CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG
C6              TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG
                 ***** .*:**. *: ************** *. *:***.******* *

C1              GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------
C2              GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
C3              GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
C4              GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------
C5              GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------
C6              GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------
                * **.***** ** **..*******: ********** ***      



>C1
ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG
AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG
TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT
TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT
CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC
GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC
TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT
TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT
TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG
CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG
GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------
>C2
ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT
TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG
GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT
CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
>C3
ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT
TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT
CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
>C4
ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT
GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG
AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG
TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA
GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT
TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT
TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT
TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC
GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC
TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC
TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT
CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG
CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG
GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------
>C5
ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT
GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG
AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT
GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG
TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC
AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC
CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT
TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT
CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT
TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC
GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC
TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC
TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT
CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG
CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG
GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------
>C6
ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT
TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG
AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT
GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA
TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC
AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG
GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC
CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT
TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT
CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT
TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA
GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC
AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT
TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC
CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA
TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG
GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESRoDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESRoDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLTooPEHQDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 897 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481299027
      Setting output file names to "/opt/ADOPS/443/Zip102B-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 699250161
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1551362503
      Seed = 1827598615
      Swapseed = 1481299027
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 32 unique site patterns
      Division 2 has 26 unique site patterns
      Division 3 has 80 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2982.002368 -- -24.965149
         Chain 2 -- -2927.054941 -- -24.965149
         Chain 3 -- -2912.481568 -- -24.965149
         Chain 4 -- -2842.626199 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2975.008011 -- -24.965149
         Chain 2 -- -2926.345799 -- -24.965149
         Chain 3 -- -2915.773703 -- -24.965149
         Chain 4 -- -2894.906454 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2982.002] (-2927.055) (-2912.482) (-2842.626) * [-2975.008] (-2926.346) (-2915.774) (-2894.906) 
        500 -- [-2405.641] (-2407.384) (-2410.304) (-2410.378) * (-2413.735) (-2413.970) (-2427.044) [-2401.820] -- 0:33:19
       1000 -- [-2372.996] (-2403.069) (-2392.987) (-2400.535) * (-2394.283) (-2418.012) (-2386.740) [-2338.591] -- 0:16:39
       1500 -- [-2342.756] (-2378.722) (-2388.008) (-2388.227) * (-2376.970) (-2408.163) (-2380.071) [-2334.118] -- 0:11:05
       2000 -- [-2338.271] (-2374.023) (-2363.200) (-2361.360) * (-2357.442) (-2384.111) (-2371.744) [-2331.531] -- 0:08:19
       2500 -- (-2330.135) (-2355.281) [-2345.981] (-2344.249) * [-2340.483] (-2360.743) (-2342.631) (-2335.029) -- 0:06:39
       3000 -- (-2340.029) [-2331.519] (-2340.889) (-2335.333) * [-2333.961] (-2353.460) (-2332.014) (-2339.788) -- 0:05:32
       3500 -- [-2332.178] (-2334.481) (-2340.747) (-2341.270) * (-2328.699) (-2346.245) [-2336.308] (-2336.167) -- 0:04:44
       4000 -- (-2330.371) (-2334.538) [-2336.904] (-2331.754) * [-2334.542] (-2343.243) (-2338.111) (-2332.018) -- 0:08:18
       4500 -- (-2331.654) (-2336.723) (-2339.823) [-2328.451] * [-2330.570] (-2339.934) (-2337.064) (-2338.719) -- 0:07:22
       5000 -- (-2335.104) (-2336.634) (-2331.583) [-2330.075] * (-2336.382) (-2335.655) (-2341.947) [-2333.714] -- 0:06:38

      Average standard deviation of split frequencies: 0.039284

       5500 -- (-2335.106) (-2330.791) [-2339.275] (-2332.227) * [-2331.320] (-2335.553) (-2344.357) (-2330.316) -- 0:06:01
       6000 -- (-2334.318) (-2342.600) (-2336.249) [-2332.784] * (-2328.324) [-2337.694] (-2339.688) (-2331.939) -- 0:05:31
       6500 -- (-2337.332) [-2331.407] (-2335.923) (-2334.826) * [-2332.778] (-2335.073) (-2343.143) (-2329.434) -- 0:05:05
       7000 -- (-2340.283) [-2332.064] (-2332.124) (-2341.673) * (-2335.224) [-2336.935] (-2338.949) (-2332.803) -- 0:04:43
       7500 -- (-2332.980) (-2334.928) (-2336.687) [-2329.855] * (-2330.192) [-2331.540] (-2332.373) (-2332.236) -- 0:06:37
       8000 -- (-2336.438) [-2330.147] (-2336.831) (-2327.084) * (-2335.904) [-2334.197] (-2333.304) (-2333.979) -- 0:06:12
       8500 -- (-2334.104) (-2338.867) (-2338.555) [-2329.889] * (-2331.510) (-2333.192) [-2329.000] (-2333.274) -- 0:05:49
       9000 -- (-2332.432) (-2329.637) [-2333.700] (-2340.819) * [-2328.850] (-2333.269) (-2342.771) (-2330.502) -- 0:05:30
       9500 -- (-2333.406) [-2340.420] (-2331.953) (-2339.021) * (-2338.476) (-2341.555) (-2329.596) [-2328.753] -- 0:05:12
      10000 -- (-2328.446) (-2331.494) [-2332.326] (-2333.639) * (-2338.728) (-2341.158) [-2329.280] (-2337.482) -- 0:04:57

      Average standard deviation of split frequencies: 0.014731

      10500 -- [-2330.003] (-2330.154) (-2338.743) (-2327.957) * (-2339.926) (-2334.947) (-2335.709) [-2339.370] -- 0:04:42
      11000 -- (-2331.569) (-2335.758) (-2348.736) [-2332.301] * (-2334.969) (-2331.992) [-2335.960] (-2333.611) -- 0:05:59
      11500 -- (-2328.690) [-2334.744] (-2339.054) (-2336.122) * (-2332.925) (-2330.037) [-2327.003] (-2340.446) -- 0:05:43
      12000 -- (-2336.474) (-2334.219) (-2333.842) [-2333.593] * (-2329.472) [-2333.881] (-2333.887) (-2335.110) -- 0:05:29
      12500 -- (-2332.705) (-2339.645) (-2327.715) [-2332.901] * (-2334.023) (-2338.552) (-2334.226) [-2327.763] -- 0:05:16
      13000 -- (-2328.748) (-2338.709) [-2331.890] (-2328.991) * (-2328.503) (-2330.646) [-2330.694] (-2331.039) -- 0:05:03
      13500 -- (-2331.961) (-2341.056) [-2333.067] (-2333.933) * (-2331.944) (-2336.768) (-2337.641) [-2329.495] -- 0:04:52
      14000 -- (-2337.271) (-2335.647) [-2332.636] (-2329.702) * [-2333.749] (-2335.276) (-2336.013) (-2341.232) -- 0:04:41
      14500 -- [-2329.465] (-2341.427) (-2333.693) (-2340.019) * (-2337.867) (-2327.042) [-2331.565] (-2337.838) -- 0:05:39
      15000 -- (-2332.464) [-2335.368] (-2334.722) (-2333.846) * (-2343.034) [-2331.562] (-2337.646) (-2335.590) -- 0:05:28

      Average standard deviation of split frequencies: 0.009821

      15500 -- [-2331.767] (-2330.549) (-2332.836) (-2342.875) * (-2345.469) (-2335.904) (-2331.833) [-2332.895] -- 0:05:17
      16000 -- (-2336.736) [-2330.162] (-2334.163) (-2340.650) * (-2344.837) (-2339.397) [-2333.730] (-2339.856) -- 0:05:07
      16500 -- (-2331.856) (-2330.965) [-2337.096] (-2335.508) * (-2334.337) (-2345.933) [-2332.373] (-2336.668) -- 0:04:58
      17000 -- [-2333.036] (-2329.445) (-2334.001) (-2332.098) * [-2333.426] (-2351.141) (-2337.176) (-2337.060) -- 0:04:49
      17500 -- (-2328.854) (-2332.076) [-2337.687] (-2336.050) * (-2333.623) (-2337.938) (-2337.466) [-2331.997] -- 0:04:40
      18000 -- (-2331.258) [-2333.733] (-2337.735) (-2332.822) * [-2336.719] (-2333.336) (-2337.364) (-2333.576) -- 0:05:27
      18500 -- (-2329.371) (-2333.806) [-2328.018] (-2335.560) * [-2337.815] (-2339.766) (-2336.529) (-2332.456) -- 0:05:18
      19000 -- (-2331.422) (-2335.793) (-2337.382) [-2335.902] * (-2332.165) [-2334.431] (-2329.991) (-2336.104) -- 0:05:09
      19500 -- [-2326.206] (-2332.499) (-2333.153) (-2329.566) * (-2331.606) [-2327.765] (-2336.221) (-2340.926) -- 0:05:01
      20000 -- (-2326.355) (-2334.584) [-2332.633] (-2338.034) * [-2331.168] (-2336.022) (-2331.649) (-2333.444) -- 0:04:54

      Average standard deviation of split frequencies: 0.007603

      20500 -- [-2332.368] (-2333.801) (-2331.629) (-2333.533) * (-2334.337) (-2326.971) (-2339.513) [-2333.478] -- 0:04:46
      21000 -- (-2333.400) [-2330.538] (-2334.528) (-2329.005) * (-2326.802) (-2345.773) (-2333.951) [-2332.228] -- 0:04:39
      21500 -- (-2333.556) (-2331.103) (-2336.449) [-2340.524] * (-2332.071) [-2332.646] (-2331.604) (-2334.086) -- 0:05:18
      22000 -- (-2329.280) (-2335.098) [-2330.821] (-2342.230) * (-2338.943) (-2331.391) [-2331.489] (-2350.318) -- 0:05:11
      22500 -- (-2338.550) (-2337.988) [-2333.524] (-2332.181) * (-2332.948) [-2336.160] (-2331.318) (-2341.104) -- 0:05:04
      23000 -- (-2339.968) (-2338.815) [-2327.579] (-2332.913) * (-2339.618) (-2327.459) (-2327.630) [-2327.881] -- 0:04:57
      23500 -- (-2334.525) (-2337.527) [-2339.432] (-2331.463) * (-2338.358) (-2337.165) [-2330.855] (-2330.448) -- 0:04:50
      24000 -- [-2332.615] (-2336.482) (-2338.142) (-2339.991) * (-2327.964) (-2337.674) [-2334.260] (-2330.487) -- 0:04:44
      24500 -- (-2328.183) [-2333.303] (-2339.071) (-2339.475) * (-2333.550) [-2328.791] (-2332.493) (-2336.449) -- 0:04:38
      25000 -- (-2329.446) (-2335.795) (-2340.693) [-2331.620] * [-2333.349] (-2330.685) (-2332.254) (-2334.212) -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-2324.441] (-2337.344) (-2335.697) (-2333.930) * (-2332.272) (-2336.827) [-2330.288] (-2332.438) -- 0:05:05
      26000 -- (-2332.995) (-2342.191) (-2335.280) [-2328.793] * (-2336.921) [-2330.651] (-2331.349) (-2328.308) -- 0:04:59
      26500 -- (-2337.367) (-2331.554) [-2328.423] (-2328.275) * (-2333.650) [-2333.578] (-2330.000) (-2334.868) -- 0:04:53
      27000 -- (-2338.377) [-2329.723] (-2328.757) (-2332.783) * [-2332.438] (-2332.566) (-2337.404) (-2331.922) -- 0:04:48
      27500 -- (-2342.114) (-2336.802) [-2336.910] (-2341.064) * (-2331.456) (-2333.809) (-2333.438) [-2334.361] -- 0:04:42
      28000 -- (-2329.385) [-2330.368] (-2334.698) (-2340.463) * (-2329.924) [-2330.053] (-2338.900) (-2338.361) -- 0:04:37
      28500 -- (-2337.004) (-2333.346) [-2339.509] (-2332.612) * [-2329.041] (-2328.289) (-2332.093) (-2332.192) -- 0:05:06
      29000 -- (-2330.316) (-2333.545) (-2336.790) [-2333.689] * (-2327.462) (-2328.877) [-2329.899] (-2328.900) -- 0:05:01
      29500 -- (-2329.920) [-2328.919] (-2331.351) (-2329.155) * (-2336.035) [-2329.101] (-2329.331) (-2336.733) -- 0:04:56
      30000 -- [-2334.568] (-2330.596) (-2333.692) (-2332.242) * (-2328.696) [-2330.785] (-2328.716) (-2334.182) -- 0:04:51

      Average standard deviation of split frequencies: 0.005124

      30500 -- (-2338.736) (-2326.011) [-2331.935] (-2335.753) * (-2331.322) [-2328.698] (-2329.519) (-2335.940) -- 0:04:46
      31000 -- [-2335.425] (-2326.070) (-2334.386) (-2339.739) * (-2335.317) (-2332.915) [-2337.401] (-2333.913) -- 0:04:41
      31500 -- (-2334.741) (-2330.044) (-2337.792) [-2331.695] * (-2330.242) (-2331.424) [-2329.768] (-2344.401) -- 0:04:36
      32000 -- (-2327.793) (-2330.910) (-2339.109) [-2331.069] * (-2329.669) (-2333.604) [-2332.180] (-2332.587) -- 0:05:02
      32500 -- [-2327.909] (-2335.726) (-2337.589) (-2335.954) * (-2334.065) [-2333.146] (-2327.665) (-2333.328) -- 0:04:57
      33000 -- (-2343.424) (-2337.740) (-2330.768) [-2331.094] * (-2338.008) (-2341.049) [-2331.424] (-2336.729) -- 0:04:53
      33500 -- (-2335.073) (-2339.484) (-2334.878) [-2335.903] * (-2330.308) (-2337.054) (-2335.790) [-2332.293] -- 0:04:48
      34000 -- (-2329.677) (-2330.983) (-2332.640) [-2333.245] * (-2333.269) (-2333.772) (-2338.184) [-2335.994] -- 0:04:44
      34500 -- (-2342.308) (-2328.831) [-2327.456] (-2330.449) * (-2331.137) (-2340.055) [-2338.390] (-2333.032) -- 0:04:39
      35000 -- (-2333.449) [-2330.984] (-2329.302) (-2327.719) * (-2330.351) (-2340.523) [-2335.099] (-2329.362) -- 0:04:35

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-2330.542) (-2333.796) [-2331.655] (-2345.603) * (-2339.594) (-2330.475) (-2330.906) [-2326.858] -- 0:04:58
      36000 -- (-2328.433) [-2338.900] (-2331.642) (-2343.094) * (-2334.962) [-2330.522] (-2326.110) (-2329.958) -- 0:04:54
      36500 -- (-2335.669) (-2332.437) (-2331.784) [-2334.804] * (-2329.211) (-2334.081) (-2336.290) [-2332.481] -- 0:04:50
      37000 -- (-2334.231) (-2330.162) (-2333.400) [-2332.152] * [-2329.621] (-2332.857) (-2330.709) (-2332.661) -- 0:04:46
      37500 -- (-2333.052) (-2335.136) (-2329.476) [-2327.312] * (-2332.203) [-2331.230] (-2329.311) (-2336.072) -- 0:04:42
      38000 -- [-2331.217] (-2326.973) (-2331.710) (-2335.831) * (-2330.917) [-2330.328] (-2331.349) (-2342.179) -- 0:04:38
      38500 -- (-2338.116) (-2332.403) [-2328.783] (-2330.024) * (-2330.516) [-2333.075] (-2331.529) (-2335.729) -- 0:04:34
      39000 -- (-2329.980) (-2326.983) (-2333.380) [-2327.742] * [-2331.445] (-2329.860) (-2337.310) (-2337.115) -- 0:04:55
      39500 -- (-2327.994) (-2343.225) [-2332.235] (-2331.816) * [-2332.785] (-2332.754) (-2330.685) (-2336.748) -- 0:04:51
      40000 -- [-2334.585] (-2333.240) (-2329.316) (-2332.462) * (-2335.791) (-2333.830) [-2333.743] (-2332.871) -- 0:04:48

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-2341.937) (-2330.818) [-2328.932] (-2336.761) * (-2337.629) (-2337.222) [-2331.626] (-2339.665) -- 0:04:44
      41000 -- (-2336.836) (-2337.515) [-2332.069] (-2334.289) * (-2329.585) [-2333.475] (-2329.730) (-2333.288) -- 0:04:40
      41500 -- (-2329.356) (-2331.102) [-2336.451] (-2343.803) * (-2331.603) (-2338.924) (-2326.190) [-2335.185] -- 0:04:37
      42000 -- (-2334.924) (-2336.778) (-2333.635) [-2327.327] * (-2331.508) [-2333.595] (-2338.316) (-2341.425) -- 0:04:33
      42500 -- (-2348.732) (-2331.655) [-2328.656] (-2332.839) * (-2336.162) (-2335.884) (-2336.582) [-2328.749] -- 0:04:52
      43000 -- (-2332.745) [-2330.943] (-2332.962) (-2335.357) * (-2333.433) (-2339.547) (-2335.762) [-2333.127] -- 0:04:49
      43500 -- (-2330.669) (-2329.011) (-2334.824) [-2337.149] * (-2338.645) (-2334.598) (-2342.584) [-2330.774] -- 0:04:45
      44000 -- (-2339.005) [-2341.977] (-2332.206) (-2340.705) * [-2334.920] (-2344.469) (-2334.769) (-2331.810) -- 0:04:42
      44500 -- (-2336.729) (-2330.672) (-2332.171) [-2335.401] * (-2330.453) (-2342.674) (-2332.533) [-2333.904] -- 0:04:39
      45000 -- [-2331.644] (-2330.408) (-2330.668) (-2334.366) * (-2332.425) (-2335.579) (-2338.898) [-2333.212] -- 0:04:35

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-2337.534) (-2332.806) [-2331.993] (-2334.367) * (-2334.478) [-2333.970] (-2331.527) (-2335.088) -- 0:04:32
      46000 -- [-2334.447] (-2336.508) (-2332.344) (-2345.453) * [-2330.904] (-2329.608) (-2333.961) (-2330.710) -- 0:04:29
      46500 -- [-2329.611] (-2333.867) (-2328.777) (-2341.176) * [-2338.755] (-2330.668) (-2339.444) (-2329.390) -- 0:04:47
      47000 -- [-2333.342] (-2335.125) (-2330.603) (-2339.702) * (-2333.237) (-2337.784) (-2335.043) [-2332.639] -- 0:04:43
      47500 -- [-2329.494] (-2330.262) (-2335.754) (-2331.105) * (-2331.263) (-2335.698) (-2333.713) [-2338.879] -- 0:04:40
      48000 -- (-2330.780) (-2331.149) [-2333.666] (-2332.900) * [-2335.286] (-2333.380) (-2336.029) (-2334.102) -- 0:04:37
      48500 -- (-2338.781) (-2328.889) (-2336.019) [-2327.300] * (-2326.587) (-2332.027) (-2337.707) [-2332.746] -- 0:04:34
      49000 -- (-2328.900) (-2336.918) [-2331.473] (-2331.253) * (-2333.202) [-2334.005] (-2341.354) (-2325.648) -- 0:04:31
      49500 -- (-2331.482) [-2327.010] (-2332.678) (-2332.034) * (-2337.076) (-2334.711) [-2331.069] (-2329.908) -- 0:04:28
      50000 -- [-2338.705] (-2327.541) (-2333.605) (-2330.420) * (-2339.010) (-2338.775) (-2333.281) [-2335.036] -- 0:04:45

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-2338.100) (-2331.547) [-2329.161] (-2333.503) * [-2339.409] (-2336.022) (-2333.687) (-2335.804) -- 0:04:42
      51000 -- [-2331.536] (-2333.621) (-2333.221) (-2336.005) * (-2334.859) (-2335.636) (-2330.195) [-2336.256] -- 0:04:39
      51500 -- [-2333.883] (-2332.298) (-2336.896) (-2325.667) * [-2336.532] (-2340.260) (-2334.902) (-2334.924) -- 0:04:36
      52000 -- [-2331.252] (-2336.012) (-2340.009) (-2335.540) * (-2331.807) (-2337.203) [-2330.192] (-2343.835) -- 0:04:33
      52500 -- (-2330.068) (-2337.156) [-2335.831] (-2342.444) * (-2333.437) (-2342.068) (-2334.149) [-2331.732] -- 0:04:30
      53000 -- (-2339.697) (-2327.175) [-2335.474] (-2348.889) * (-2336.379) (-2331.509) (-2331.299) [-2333.910] -- 0:04:28
      53500 -- (-2340.737) (-2326.839) (-2334.776) [-2332.728] * (-2342.017) (-2336.298) [-2333.427] (-2330.462) -- 0:04:43
      54000 -- [-2332.556] (-2329.813) (-2333.225) (-2338.320) * (-2343.792) [-2329.695] (-2330.768) (-2329.637) -- 0:04:40
      54500 -- (-2334.406) (-2328.634) (-2331.108) [-2329.529] * [-2340.238] (-2328.741) (-2331.486) (-2335.472) -- 0:04:37
      55000 -- (-2338.993) [-2327.160] (-2333.774) (-2333.074) * (-2342.386) (-2339.022) (-2330.203) [-2333.535] -- 0:04:34

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2333.165) [-2335.163] (-2340.401) (-2331.576) * [-2335.101] (-2335.398) (-2331.037) (-2336.189) -- 0:04:32
      56000 -- (-2327.570) (-2338.748) [-2335.970] (-2327.219) * (-2334.978) (-2329.944) [-2333.589] (-2330.507) -- 0:04:29
      56500 -- (-2336.604) (-2335.095) (-2333.765) [-2330.739] * (-2337.121) [-2331.201] (-2340.737) (-2336.043) -- 0:04:27
      57000 -- [-2338.475] (-2335.815) (-2328.974) (-2331.655) * (-2334.693) [-2333.311] (-2331.574) (-2335.070) -- 0:04:41
      57500 -- (-2332.966) [-2330.627] (-2333.275) (-2330.099) * [-2335.676] (-2331.467) (-2334.551) (-2333.131) -- 0:04:38
      58000 -- (-2334.249) (-2326.758) [-2341.660] (-2336.992) * (-2337.335) (-2331.936) [-2337.982] (-2327.952) -- 0:04:36
      58500 -- (-2326.627) (-2333.854) (-2329.297) [-2328.637] * [-2329.729] (-2332.349) (-2337.149) (-2328.299) -- 0:04:33
      59000 -- [-2328.333] (-2336.531) (-2333.665) (-2331.522) * (-2329.125) (-2338.208) (-2328.841) [-2328.618] -- 0:04:31
      59500 -- (-2330.703) (-2328.198) (-2332.580) [-2332.355] * [-2330.224] (-2337.694) (-2337.285) (-2330.365) -- 0:04:28
      60000 -- (-2333.544) (-2333.519) (-2335.053) [-2328.918] * [-2330.293] (-2343.793) (-2334.252) (-2333.379) -- 0:04:26

      Average standard deviation of split frequencies: 0.002590

      60500 -- [-2332.328] (-2334.516) (-2328.318) (-2328.665) * (-2333.957) (-2338.835) [-2330.534] (-2331.376) -- 0:04:39
      61000 -- (-2329.386) (-2332.490) [-2328.953] (-2337.071) * (-2331.201) [-2328.645] (-2332.448) (-2333.158) -- 0:04:37
      61500 -- (-2332.276) [-2331.543] (-2332.400) (-2331.966) * (-2334.169) (-2334.980) [-2328.925] (-2331.121) -- 0:04:34
      62000 -- (-2335.266) (-2334.911) [-2330.550] (-2331.975) * [-2331.166] (-2333.097) (-2336.786) (-2333.583) -- 0:04:32
      62500 -- (-2334.080) (-2335.445) [-2333.038] (-2332.191) * [-2326.122] (-2338.217) (-2337.053) (-2332.995) -- 0:04:30
      63000 -- (-2331.973) [-2331.835] (-2332.317) (-2332.787) * [-2335.193] (-2341.938) (-2330.389) (-2330.853) -- 0:04:27
      63500 -- (-2332.710) (-2334.873) (-2338.370) [-2334.335] * [-2330.051] (-2336.609) (-2331.180) (-2335.861) -- 0:04:25
      64000 -- (-2338.301) [-2338.576] (-2330.189) (-2333.582) * (-2331.813) [-2331.421] (-2331.997) (-2333.904) -- 0:04:37
      64500 -- (-2333.234) (-2332.694) (-2328.357) [-2335.056] * (-2330.920) [-2328.974] (-2334.025) (-2339.526) -- 0:04:35
      65000 -- (-2334.605) [-2338.432] (-2335.513) (-2333.948) * [-2338.708] (-2334.104) (-2338.794) (-2330.496) -- 0:04:33

      Average standard deviation of split frequencies: 0.002381

      65500 -- (-2343.158) (-2334.088) (-2334.982) [-2333.731] * (-2338.891) [-2332.943] (-2334.163) (-2332.626) -- 0:04:31
      66000 -- (-2333.662) (-2339.742) (-2338.970) [-2330.803] * (-2333.654) [-2327.835] (-2341.340) (-2338.183) -- 0:04:28
      66500 -- (-2333.524) (-2333.260) (-2335.953) [-2338.910] * [-2333.942] (-2332.602) (-2331.193) (-2333.762) -- 0:04:26
      67000 -- (-2329.734) (-2329.803) (-2327.367) [-2331.417] * (-2340.881) (-2337.090) (-2328.938) [-2333.478] -- 0:04:24
      67500 -- (-2347.419) (-2339.130) [-2328.145] (-2334.396) * (-2338.608) (-2334.614) [-2330.185] (-2337.304) -- 0:04:36
      68000 -- (-2338.315) (-2335.060) [-2332.076] (-2334.052) * [-2332.180] (-2335.309) (-2330.677) (-2336.540) -- 0:04:34
      68500 -- [-2331.376] (-2333.902) (-2336.703) (-2333.662) * (-2330.183) (-2329.962) (-2331.690) [-2332.587] -- 0:04:31
      69000 -- (-2341.704) (-2341.631) [-2332.292] (-2331.892) * (-2331.906) (-2332.775) [-2329.761] (-2330.423) -- 0:04:29
      69500 -- (-2331.392) (-2331.722) (-2337.606) [-2329.867] * (-2330.331) (-2334.961) (-2334.307) [-2330.640] -- 0:04:27
      70000 -- (-2328.089) (-2334.869) (-2327.722) [-2334.644] * (-2339.069) [-2328.107] (-2328.588) (-2333.285) -- 0:04:25

      Average standard deviation of split frequencies: 0.002224

      70500 -- [-2329.479] (-2331.605) (-2336.332) (-2332.111) * (-2329.650) [-2328.418] (-2332.795) (-2337.191) -- 0:04:23
      71000 -- (-2333.703) (-2334.174) [-2335.613] (-2337.272) * (-2336.211) [-2326.077] (-2333.049) (-2335.204) -- 0:04:34
      71500 -- [-2333.179] (-2339.079) (-2331.409) (-2329.940) * [-2331.531] (-2333.257) (-2333.966) (-2331.540) -- 0:04:32
      72000 -- (-2342.213) (-2333.472) (-2335.684) [-2332.829] * (-2331.367) [-2329.643] (-2327.212) (-2334.879) -- 0:04:30
      72500 -- (-2336.674) (-2333.432) (-2334.860) [-2329.577] * (-2337.405) (-2327.239) (-2330.165) [-2328.148] -- 0:04:28
      73000 -- [-2337.892] (-2335.164) (-2334.526) (-2329.982) * (-2331.381) (-2341.810) [-2329.636] (-2330.823) -- 0:04:26
      73500 -- (-2334.373) [-2333.336] (-2329.873) (-2332.599) * [-2329.351] (-2327.122) (-2334.365) (-2334.590) -- 0:04:24
      74000 -- (-2343.049) (-2339.637) [-2329.475] (-2329.940) * [-2329.982] (-2328.391) (-2328.473) (-2336.292) -- 0:04:22
      74500 -- (-2338.539) [-2334.410] (-2329.325) (-2332.976) * (-2332.759) (-2334.956) (-2336.881) [-2333.254] -- 0:04:33
      75000 -- (-2335.309) [-2335.394] (-2330.536) (-2327.074) * [-2334.119] (-2339.036) (-2327.244) (-2333.268) -- 0:04:31

      Average standard deviation of split frequencies: 0.004135

      75500 -- (-2343.834) (-2339.002) (-2334.214) [-2331.977] * (-2342.234) (-2332.937) (-2340.280) [-2329.237] -- 0:04:29
      76000 -- (-2341.981) (-2337.345) [-2330.734] (-2326.887) * (-2336.226) (-2332.642) (-2346.496) [-2331.769] -- 0:04:27
      76500 -- (-2341.427) (-2330.437) [-2334.158] (-2332.750) * (-2340.019) (-2329.828) (-2339.498) [-2331.750] -- 0:04:25
      77000 -- (-2343.974) (-2336.398) (-2334.329) [-2330.851] * (-2337.944) (-2335.054) (-2331.927) [-2329.181] -- 0:04:23
      77500 -- (-2335.304) [-2332.904] (-2337.837) (-2331.475) * (-2329.072) (-2333.943) [-2332.878] (-2338.282) -- 0:04:21
      78000 -- [-2332.980] (-2332.526) (-2333.834) (-2329.610) * (-2336.073) (-2334.081) (-2330.221) [-2333.077] -- 0:04:31
      78500 -- (-2336.560) (-2329.891) (-2338.990) [-2335.598] * (-2338.812) (-2344.793) (-2332.685) [-2330.722] -- 0:04:29
      79000 -- (-2348.357) (-2330.547) [-2334.027] (-2337.728) * (-2334.687) (-2339.734) [-2330.963] (-2338.220) -- 0:04:28
      79500 -- (-2335.163) (-2336.639) [-2331.192] (-2337.560) * (-2332.143) (-2343.515) [-2330.132] (-2332.505) -- 0:04:26
      80000 -- (-2335.572) (-2337.373) [-2336.717] (-2332.313) * (-2331.246) (-2338.142) [-2332.907] (-2329.644) -- 0:04:24

      Average standard deviation of split frequencies: 0.005844

      80500 -- [-2330.267] (-2335.399) (-2331.099) (-2336.013) * [-2337.240] (-2340.969) (-2343.717) (-2341.960) -- 0:04:22
      81000 -- (-2332.623) (-2335.280) (-2331.645) [-2328.223] * (-2331.564) (-2337.160) (-2329.229) [-2331.088] -- 0:04:20
      81500 -- [-2327.314] (-2338.290) (-2329.740) (-2340.400) * [-2337.340] (-2337.065) (-2337.494) (-2331.210) -- 0:04:30
      82000 -- (-2330.473) (-2330.914) (-2332.310) [-2335.633] * (-2342.378) (-2336.572) (-2336.981) [-2332.347] -- 0:04:28
      82500 -- (-2332.902) (-2335.833) [-2330.601] (-2331.271) * (-2328.155) [-2331.377] (-2336.612) (-2330.545) -- 0:04:26
      83000 -- (-2332.750) [-2330.011] (-2329.991) (-2325.529) * [-2330.701] (-2331.972) (-2339.227) (-2332.941) -- 0:04:25
      83500 -- (-2334.317) [-2335.401] (-2331.747) (-2330.157) * (-2331.524) (-2332.492) (-2330.824) [-2332.328] -- 0:04:23
      84000 -- (-2337.847) (-2329.260) [-2333.008] (-2333.342) * (-2331.867) (-2327.938) [-2336.202] (-2335.527) -- 0:04:21
      84500 -- (-2344.225) (-2330.423) [-2333.010] (-2335.014) * (-2332.534) [-2337.258] (-2333.874) (-2333.033) -- 0:04:20
      85000 -- (-2337.494) (-2334.597) (-2338.075) [-2333.805] * (-2329.454) (-2333.574) [-2338.017] (-2332.085) -- 0:04:29

      Average standard deviation of split frequencies: 0.001827

      85500 -- [-2334.131] (-2331.746) (-2334.651) (-2331.246) * [-2337.493] (-2336.412) (-2337.916) (-2336.468) -- 0:04:27
      86000 -- (-2329.413) (-2329.353) [-2336.564] (-2336.117) * (-2330.811) [-2329.417] (-2336.580) (-2331.209) -- 0:04:25
      86500 -- (-2333.531) (-2333.196) (-2339.890) [-2334.784] * [-2337.881] (-2330.055) (-2334.271) (-2328.100) -- 0:04:24
      87000 -- (-2333.824) [-2329.618] (-2335.677) (-2333.155) * (-2333.302) [-2334.412] (-2334.824) (-2334.070) -- 0:04:22
      87500 -- (-2334.197) [-2331.446] (-2335.183) (-2334.808) * [-2333.698] (-2334.244) (-2332.069) (-2332.465) -- 0:04:20
      88000 -- (-2338.640) (-2331.413) [-2338.344] (-2341.203) * (-2337.019) (-2332.731) (-2337.058) [-2337.580] -- 0:04:19
      88500 -- (-2332.059) [-2339.550] (-2335.757) (-2337.946) * (-2336.568) [-2340.218] (-2333.474) (-2337.998) -- 0:04:27
      89000 -- (-2329.923) (-2337.959) [-2330.376] (-2331.067) * (-2334.064) [-2331.514] (-2331.602) (-2345.073) -- 0:04:26
      89500 -- [-2331.206] (-2330.798) (-2333.486) (-2326.811) * (-2334.134) (-2346.188) (-2338.278) [-2338.569] -- 0:04:24
      90000 -- (-2336.011) (-2331.931) (-2335.541) [-2333.222] * (-2333.328) (-2338.535) (-2331.437) [-2335.588] -- 0:04:22

      Average standard deviation of split frequencies: 0.001733

      90500 -- (-2338.192) (-2330.465) (-2333.793) [-2325.697] * [-2331.820] (-2335.279) (-2343.485) (-2333.514) -- 0:04:21
      91000 -- [-2330.933] (-2331.205) (-2329.825) (-2329.668) * [-2332.520] (-2329.375) (-2342.185) (-2336.886) -- 0:04:19
      91500 -- [-2329.559] (-2337.585) (-2331.667) (-2332.619) * [-2331.706] (-2328.732) (-2331.270) (-2339.305) -- 0:04:28
      92000 -- (-2335.408) (-2334.626) [-2333.194] (-2332.539) * [-2338.991] (-2333.575) (-2337.163) (-2338.201) -- 0:04:26
      92500 -- [-2335.693] (-2341.266) (-2333.259) (-2340.138) * (-2335.459) [-2330.382] (-2339.140) (-2340.586) -- 0:04:24
      93000 -- (-2330.200) [-2328.742] (-2351.294) (-2346.834) * (-2342.271) [-2328.450] (-2338.117) (-2335.725) -- 0:04:23
      93500 -- (-2331.963) (-2331.480) [-2328.565] (-2336.645) * (-2340.805) [-2337.343] (-2333.255) (-2338.501) -- 0:04:21
      94000 -- (-2339.675) (-2333.200) (-2331.927) [-2328.522] * (-2333.377) (-2328.573) (-2337.008) [-2344.278] -- 0:04:20
      94500 -- (-2331.618) (-2340.226) (-2337.506) [-2334.415] * (-2331.523) (-2336.421) (-2336.216) [-2338.211] -- 0:04:18
      95000 -- (-2338.863) (-2332.885) [-2332.935] (-2330.893) * (-2333.714) (-2330.048) [-2334.445] (-2341.149) -- 0:04:26

      Average standard deviation of split frequencies: 0.001637

      95500 -- [-2331.530] (-2331.516) (-2332.380) (-2337.522) * (-2337.053) (-2334.161) [-2332.582] (-2342.556) -- 0:04:25
      96000 -- (-2332.234) (-2331.504) [-2331.680] (-2341.273) * [-2334.800] (-2332.897) (-2337.303) (-2329.877) -- 0:04:23
      96500 -- (-2331.119) [-2334.162] (-2333.879) (-2339.666) * (-2338.993) (-2333.577) [-2330.332] (-2328.347) -- 0:04:22
      97000 -- (-2341.198) (-2330.005) [-2328.078] (-2334.024) * (-2330.669) (-2335.385) (-2332.442) [-2330.659] -- 0:04:20
      97500 -- (-2332.038) (-2332.895) [-2328.362] (-2333.008) * (-2335.981) (-2340.550) (-2330.744) [-2333.446] -- 0:04:19
      98000 -- (-2342.604) (-2332.045) (-2334.401) [-2332.684] * (-2328.521) (-2336.050) (-2339.960) [-2329.348] -- 0:04:17
      98500 -- (-2337.164) (-2341.988) (-2330.667) [-2333.418] * [-2335.521] (-2339.175) (-2330.329) (-2329.730) -- 0:04:25
      99000 -- (-2334.966) (-2336.920) [-2326.963] (-2330.072) * (-2337.064) [-2335.477] (-2327.806) (-2332.856) -- 0:04:23
      99500 -- (-2333.321) (-2340.041) [-2330.084] (-2327.557) * (-2337.174) (-2335.373) (-2338.897) [-2329.856] -- 0:04:22
      100000 -- [-2331.543] (-2335.001) (-2329.092) (-2330.435) * (-2339.425) (-2334.506) [-2334.975] (-2343.772) -- 0:04:21

      Average standard deviation of split frequencies: 0.001561

      100500 -- (-2333.596) (-2340.889) [-2335.333] (-2332.240) * (-2332.518) (-2334.203) (-2338.642) [-2329.141] -- 0:04:19
      101000 -- (-2335.341) [-2334.234] (-2335.270) (-2333.154) * [-2338.330] (-2337.796) (-2331.845) (-2329.926) -- 0:04:18
      101500 -- [-2335.857] (-2329.159) (-2335.282) (-2338.011) * (-2335.517) [-2333.892] (-2334.764) (-2335.476) -- 0:04:16
      102000 -- (-2333.741) (-2331.185) (-2334.773) [-2334.073] * (-2338.569) (-2336.292) [-2332.278] (-2339.588) -- 0:04:24
      102500 -- [-2331.291] (-2333.958) (-2331.783) (-2331.068) * (-2341.986) (-2335.135) [-2330.872] (-2339.961) -- 0:04:22
      103000 -- (-2332.678) [-2330.620] (-2335.083) (-2328.847) * (-2336.618) (-2328.999) [-2334.210] (-2332.260) -- 0:04:21
      103500 -- (-2333.880) [-2331.591] (-2346.386) (-2327.963) * (-2340.865) (-2333.275) [-2328.204] (-2333.453) -- 0:04:19
      104000 -- (-2340.130) (-2330.450) (-2342.038) [-2330.340] * (-2335.672) (-2337.788) [-2333.313] (-2330.693) -- 0:04:18
      104500 -- (-2329.155) [-2330.077] (-2339.276) (-2341.177) * (-2328.370) [-2331.061] (-2337.829) (-2331.013) -- 0:04:17
      105000 -- (-2329.869) [-2337.235] (-2339.305) (-2338.025) * (-2333.318) (-2331.490) (-2331.478) [-2337.789] -- 0:04:15

      Average standard deviation of split frequencies: 0.001482

      105500 -- (-2337.358) [-2333.830] (-2336.391) (-2335.453) * (-2332.108) [-2331.283] (-2330.717) (-2331.732) -- 0:04:22
      106000 -- (-2331.826) (-2333.544) (-2332.199) [-2332.746] * (-2336.766) [-2333.903] (-2331.768) (-2340.637) -- 0:04:21
      106500 -- (-2331.370) [-2330.749] (-2333.479) (-2335.516) * (-2332.797) (-2339.471) (-2333.484) [-2337.067] -- 0:04:20
      107000 -- (-2335.288) (-2331.625) (-2333.199) [-2333.010] * (-2330.218) (-2334.868) [-2327.539] (-2338.637) -- 0:04:18
      107500 -- (-2339.222) (-2332.939) (-2332.688) [-2333.644] * (-2329.464) (-2330.286) [-2331.319] (-2333.954) -- 0:04:17
      108000 -- (-2333.824) [-2332.595] (-2336.562) (-2333.312) * (-2333.550) [-2330.576] (-2341.308) (-2331.876) -- 0:04:16
      108500 -- [-2330.636] (-2326.035) (-2332.466) (-2341.888) * [-2330.036] (-2342.707) (-2332.403) (-2341.645) -- 0:04:14
      109000 -- (-2331.838) [-2331.118] (-2326.280) (-2337.369) * (-2332.233) (-2328.874) [-2328.959] (-2338.656) -- 0:04:21
      109500 -- (-2336.688) [-2330.153] (-2333.331) (-2331.606) * (-2333.653) (-2332.844) (-2339.626) [-2333.562] -- 0:04:20
      110000 -- (-2336.226) (-2334.065) [-2334.482] (-2331.267) * (-2327.983) (-2336.809) (-2331.732) [-2333.649] -- 0:04:18

      Average standard deviation of split frequencies: 0.001420

      110500 -- (-2338.931) (-2331.010) [-2331.733] (-2336.417) * (-2331.699) (-2332.812) (-2335.515) [-2340.477] -- 0:04:17
      111000 -- (-2335.695) (-2338.136) (-2331.795) [-2331.592] * (-2336.924) [-2333.246] (-2331.678) (-2330.687) -- 0:04:16
      111500 -- (-2344.082) (-2328.377) (-2331.000) [-2332.466] * (-2335.788) [-2337.297] (-2328.779) (-2329.239) -- 0:04:14
      112000 -- [-2331.069] (-2330.254) (-2338.195) (-2331.413) * (-2342.331) [-2334.501] (-2330.854) (-2333.423) -- 0:04:13
      112500 -- (-2331.794) [-2337.493] (-2333.058) (-2329.429) * (-2342.482) (-2335.876) (-2335.241) [-2332.769] -- 0:04:20
      113000 -- (-2334.734) [-2335.262] (-2337.720) (-2333.669) * (-2331.892) (-2333.129) (-2331.524) [-2332.914] -- 0:04:19
      113500 -- [-2338.616] (-2329.589) (-2330.328) (-2336.218) * (-2332.558) (-2333.743) [-2329.872] (-2332.796) -- 0:04:17
      114000 -- [-2339.670] (-2336.856) (-2332.313) (-2331.347) * [-2338.023] (-2328.581) (-2334.257) (-2332.640) -- 0:04:16
      114500 -- (-2336.978) (-2331.930) (-2333.425) [-2330.448] * (-2332.185) (-2335.426) [-2338.585] (-2333.656) -- 0:04:15
      115000 -- [-2334.515] (-2334.418) (-2338.663) (-2331.466) * (-2333.109) [-2332.287] (-2338.310) (-2333.377) -- 0:04:13

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-2338.156) [-2330.052] (-2330.553) (-2338.206) * (-2331.922) (-2336.533) [-2334.432] (-2332.428) -- 0:04:12
      116000 -- (-2332.240) (-2338.258) (-2337.998) [-2330.303] * [-2329.926] (-2331.416) (-2335.939) (-2333.167) -- 0:04:19
      116500 -- (-2340.767) (-2334.871) (-2329.212) [-2331.136] * (-2338.186) (-2332.699) (-2334.787) [-2336.825] -- 0:04:17
      117000 -- [-2332.367] (-2334.446) (-2335.412) (-2327.685) * [-2337.140] (-2334.804) (-2337.033) (-2330.779) -- 0:04:16
      117500 -- (-2330.306) (-2330.490) [-2334.802] (-2329.006) * (-2338.748) (-2331.817) [-2337.439] (-2332.567) -- 0:04:15
      118000 -- [-2330.481] (-2340.795) (-2343.407) (-2331.416) * (-2332.238) [-2335.008] (-2335.111) (-2331.546) -- 0:04:14
      118500 -- (-2336.284) (-2335.760) (-2331.790) [-2333.574] * [-2331.968] (-2331.810) (-2337.442) (-2337.731) -- 0:04:12
      119000 -- (-2338.434) (-2340.321) [-2332.606] (-2327.750) * (-2338.004) (-2327.545) (-2338.275) [-2338.877] -- 0:04:11
      119500 -- (-2336.829) (-2334.842) [-2332.101] (-2333.040) * (-2337.677) (-2332.468) (-2345.686) [-2332.793] -- 0:04:17
      120000 -- (-2334.866) [-2330.664] (-2330.162) (-2332.247) * (-2336.138) [-2339.204] (-2337.913) (-2335.638) -- 0:04:16

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-2336.001] (-2328.940) (-2331.621) (-2338.292) * (-2328.673) [-2332.344] (-2331.217) (-2336.719) -- 0:04:15
      121000 -- [-2335.731] (-2332.306) (-2335.110) (-2339.698) * (-2332.005) [-2331.538] (-2335.178) (-2333.533) -- 0:04:14
      121500 -- (-2334.310) (-2336.471) [-2331.875] (-2337.853) * (-2327.285) [-2336.492] (-2327.466) (-2334.701) -- 0:04:13
      122000 -- (-2333.269) (-2333.190) (-2335.212) [-2335.227] * (-2325.935) (-2341.288) [-2329.081] (-2341.319) -- 0:04:11
      122500 -- [-2333.772] (-2330.171) (-2337.095) (-2327.007) * (-2327.379) (-2339.826) [-2329.303] (-2328.981) -- 0:04:10
      123000 -- (-2330.342) [-2334.123] (-2343.757) (-2333.126) * (-2330.445) (-2338.244) (-2339.270) [-2335.793] -- 0:04:16
      123500 -- [-2330.395] (-2333.009) (-2336.706) (-2336.979) * [-2330.384] (-2338.724) (-2337.861) (-2336.363) -- 0:04:15
      124000 -- (-2336.795) [-2333.483] (-2341.611) (-2328.735) * (-2327.592) (-2342.415) (-2333.238) [-2336.725] -- 0:04:14
      124500 -- (-2332.879) [-2333.289] (-2331.902) (-2331.182) * [-2335.651] (-2335.555) (-2338.988) (-2335.378) -- 0:04:13
      125000 -- (-2333.300) [-2328.687] (-2331.872) (-2330.113) * [-2336.921] (-2338.918) (-2333.631) (-2333.831) -- 0:04:12

      Average standard deviation of split frequencies: 0.001247

      125500 -- (-2340.555) [-2331.296] (-2341.674) (-2328.541) * [-2329.579] (-2330.499) (-2333.203) (-2331.655) -- 0:04:10
      126000 -- [-2332.806] (-2334.047) (-2330.972) (-2333.870) * [-2334.536] (-2342.519) (-2332.037) (-2331.674) -- 0:04:09
      126500 -- [-2330.492] (-2335.465) (-2331.340) (-2331.180) * [-2325.676] (-2333.037) (-2334.062) (-2332.252) -- 0:04:15
      127000 -- [-2330.176] (-2332.754) (-2339.329) (-2332.483) * (-2342.940) [-2331.042] (-2338.664) (-2335.692) -- 0:04:14
      127500 -- (-2334.365) (-2338.984) (-2330.647) [-2331.340] * [-2333.819] (-2338.827) (-2336.763) (-2330.421) -- 0:04:13
      128000 -- (-2329.507) (-2329.733) [-2329.633] (-2338.846) * [-2333.926] (-2332.596) (-2343.927) (-2335.642) -- 0:04:12
      128500 -- (-2335.885) [-2332.459] (-2333.556) (-2331.381) * [-2331.340] (-2335.452) (-2345.730) (-2337.777) -- 0:04:10
      129000 -- (-2335.103) (-2344.607) [-2335.330] (-2330.283) * (-2341.133) [-2333.168] (-2341.075) (-2336.219) -- 0:04:09
      129500 -- [-2340.428] (-2335.196) (-2330.608) (-2331.211) * [-2333.164] (-2328.170) (-2337.516) (-2337.264) -- 0:04:08
      130000 -- [-2330.982] (-2339.484) (-2328.891) (-2332.551) * (-2331.330) (-2333.704) [-2335.535] (-2327.835) -- 0:04:14

      Average standard deviation of split frequencies: 0.002405

      130500 -- (-2331.029) (-2335.456) (-2331.905) [-2336.955] * (-2329.603) (-2330.879) [-2332.453] (-2330.785) -- 0:04:13
      131000 -- (-2328.775) (-2331.837) (-2333.950) [-2339.311] * [-2336.166] (-2332.353) (-2334.568) (-2335.526) -- 0:04:12
      131500 -- [-2325.430] (-2333.719) (-2328.375) (-2328.495) * [-2333.096] (-2329.518) (-2336.409) (-2334.391) -- 0:04:10
      132000 -- (-2328.624) (-2340.887) (-2337.314) [-2330.532] * (-2333.298) (-2331.847) [-2331.360] (-2336.336) -- 0:04:09
      132500 -- (-2332.303) (-2332.709) [-2328.033] (-2339.838) * (-2331.428) (-2337.769) [-2328.480] (-2339.113) -- 0:04:08
      133000 -- (-2336.989) (-2342.314) (-2332.582) [-2332.104] * (-2327.758) (-2334.713) (-2335.002) [-2334.878] -- 0:04:07
      133500 -- [-2327.995] (-2328.165) (-2336.483) (-2337.314) * [-2330.103] (-2330.681) (-2329.275) (-2338.110) -- 0:04:13
      134000 -- (-2334.289) (-2329.303) [-2334.331] (-2329.573) * [-2330.328] (-2331.300) (-2325.779) (-2330.106) -- 0:04:12
      134500 -- [-2331.652] (-2339.438) (-2336.097) (-2330.501) * (-2327.487) [-2333.447] (-2330.459) (-2334.035) -- 0:04:10
      135000 -- (-2338.206) (-2331.678) [-2329.594] (-2330.504) * [-2326.961] (-2333.095) (-2337.095) (-2328.652) -- 0:04:09

      Average standard deviation of split frequencies: 0.002311

      135500 -- (-2338.156) (-2333.025) [-2327.176] (-2331.881) * (-2332.837) [-2332.268] (-2329.828) (-2340.017) -- 0:04:08
      136000 -- (-2339.176) [-2329.147] (-2331.319) (-2329.120) * (-2335.707) (-2336.559) [-2332.395] (-2331.781) -- 0:04:07
      136500 -- (-2336.712) [-2332.231] (-2330.831) (-2328.600) * (-2330.462) (-2337.721) (-2332.401) [-2332.041] -- 0:04:06
      137000 -- (-2332.582) (-2331.116) (-2332.512) [-2331.058] * (-2328.681) (-2333.829) (-2334.681) [-2331.341] -- 0:04:11
      137500 -- (-2331.256) [-2326.488] (-2331.515) (-2333.835) * (-2327.983) (-2332.425) (-2336.119) [-2337.110] -- 0:04:10
      138000 -- (-2333.673) [-2330.512] (-2335.180) (-2335.405) * [-2333.744] (-2347.061) (-2334.738) (-2334.683) -- 0:04:09
      138500 -- (-2334.471) [-2334.510] (-2330.695) (-2335.555) * (-2344.222) (-2343.688) (-2338.517) [-2331.562] -- 0:04:08
      139000 -- [-2337.242] (-2330.962) (-2333.868) (-2345.447) * (-2332.778) (-2334.933) (-2338.631) [-2327.008] -- 0:04:07
      139500 -- [-2328.892] (-2336.371) (-2334.184) (-2337.852) * (-2337.020) (-2337.892) (-2332.020) [-2332.562] -- 0:04:06
      140000 -- [-2331.231] (-2328.085) (-2338.835) (-2334.838) * (-2332.832) (-2335.681) [-2323.733] (-2326.728) -- 0:04:05

      Average standard deviation of split frequencies: 0.002234

      140500 -- (-2339.172) (-2327.798) [-2334.187] (-2330.119) * (-2331.554) [-2326.721] (-2332.866) (-2330.355) -- 0:04:10
      141000 -- (-2339.016) [-2329.155] (-2331.289) (-2329.801) * [-2329.227] (-2337.513) (-2332.177) (-2335.118) -- 0:04:09
      141500 -- (-2331.139) [-2328.439] (-2335.385) (-2330.684) * (-2334.549) (-2335.448) [-2328.861] (-2333.235) -- 0:04:08
      142000 -- (-2332.780) [-2330.890] (-2332.496) (-2338.899) * (-2336.572) [-2337.506] (-2329.449) (-2332.913) -- 0:04:07
      142500 -- [-2327.314] (-2335.531) (-2338.902) (-2332.500) * (-2337.335) (-2336.364) [-2333.970] (-2333.197) -- 0:04:06
      143000 -- (-2332.644) (-2337.863) (-2331.249) [-2333.143] * (-2331.753) [-2333.016] (-2327.261) (-2331.455) -- 0:04:05
      143500 -- (-2333.339) (-2342.391) [-2329.106] (-2332.726) * [-2330.718] (-2330.906) (-2332.297) (-2332.179) -- 0:04:04
      144000 -- (-2330.499) [-2337.311] (-2331.234) (-2337.111) * (-2333.144) (-2333.715) [-2329.797] (-2328.650) -- 0:04:09
      144500 -- (-2332.812) [-2335.120] (-2336.890) (-2329.045) * (-2333.501) (-2333.120) [-2333.442] (-2337.491) -- 0:04:08
      145000 -- (-2327.265) (-2334.114) (-2332.328) [-2330.309] * (-2337.670) [-2332.054] (-2330.076) (-2340.070) -- 0:04:07

      Average standard deviation of split frequencies: 0.002153

      145500 -- (-2332.351) (-2333.716) [-2333.768] (-2342.910) * (-2335.394) (-2334.761) (-2333.451) [-2328.501] -- 0:04:06
      146000 -- (-2331.367) (-2345.062) (-2328.386) [-2336.675] * (-2332.067) [-2331.748] (-2332.662) (-2335.942) -- 0:04:05
      146500 -- (-2335.328) (-2332.843) [-2331.187] (-2336.723) * (-2338.232) [-2336.060] (-2331.847) (-2334.107) -- 0:04:04
      147000 -- (-2333.761) (-2334.861) [-2337.525] (-2338.911) * (-2340.126) (-2331.277) [-2338.696] (-2334.239) -- 0:04:03
      147500 -- (-2334.705) [-2327.501] (-2340.245) (-2336.635) * (-2340.415) [-2331.234] (-2332.997) (-2333.642) -- 0:04:08
      148000 -- [-2326.669] (-2327.116) (-2333.507) (-2333.767) * (-2337.828) [-2329.870] (-2333.483) (-2327.518) -- 0:04:07
      148500 -- (-2334.339) [-2329.657] (-2329.417) (-2328.287) * (-2333.148) (-2330.836) [-2333.663] (-2331.924) -- 0:04:06
      149000 -- (-2327.955) (-2332.238) (-2335.369) [-2331.821] * (-2331.834) [-2327.374] (-2330.097) (-2337.260) -- 0:04:05
      149500 -- (-2327.877) (-2331.686) [-2332.128] (-2331.239) * (-2340.009) (-2336.347) [-2332.295] (-2331.831) -- 0:04:04
      150000 -- (-2341.398) (-2331.549) [-2333.832] (-2333.355) * (-2327.454) [-2331.577] (-2329.838) (-2332.577) -- 0:04:03

      Average standard deviation of split frequencies: 0.002086

      150500 -- (-2340.170) [-2332.706] (-2338.752) (-2330.692) * [-2329.200] (-2332.720) (-2330.257) (-2334.792) -- 0:04:02
      151000 -- (-2326.905) (-2332.475) (-2331.738) [-2328.550] * [-2335.150] (-2334.701) (-2338.553) (-2326.573) -- 0:04:07
      151500 -- (-2337.504) (-2335.649) [-2329.997] (-2337.871) * (-2331.760) (-2338.205) (-2341.178) [-2331.336] -- 0:04:06
      152000 -- (-2337.589) (-2332.354) [-2328.255] (-2333.351) * (-2336.513) [-2330.220] (-2347.456) (-2330.366) -- 0:04:05
      152500 -- (-2327.660) [-2331.577] (-2332.657) (-2331.720) * (-2335.212) (-2329.896) [-2342.946] (-2337.232) -- 0:04:04
      153000 -- [-2332.332] (-2333.782) (-2333.470) (-2335.489) * (-2334.436) [-2330.012] (-2334.641) (-2341.902) -- 0:04:03
      153500 -- (-2334.132) [-2334.935] (-2332.405) (-2332.416) * (-2336.406) (-2328.342) (-2340.694) [-2334.377] -- 0:04:02
      154000 -- [-2333.299] (-2334.514) (-2331.951) (-2332.058) * [-2334.358] (-2335.007) (-2339.159) (-2329.186) -- 0:04:01
      154500 -- [-2336.396] (-2329.608) (-2331.960) (-2331.038) * (-2332.185) (-2334.316) (-2341.321) [-2329.328] -- 0:04:06
      155000 -- [-2330.813] (-2329.530) (-2334.510) (-2327.052) * (-2334.144) (-2325.403) [-2333.253] (-2338.186) -- 0:04:05

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-2329.614) (-2335.887) [-2330.958] (-2334.848) * (-2331.411) [-2328.738] (-2333.413) (-2339.162) -- 0:04:04
      156000 -- (-2329.857) (-2332.944) (-2331.690) [-2330.501] * [-2334.346] (-2333.221) (-2338.295) (-2332.241) -- 0:04:03
      156500 -- [-2334.850] (-2338.123) (-2333.297) (-2329.535) * (-2341.944) (-2336.988) [-2339.686] (-2339.944) -- 0:04:02
      157000 -- (-2333.171) (-2331.588) [-2342.582] (-2335.269) * (-2328.805) (-2333.567) [-2338.038] (-2340.178) -- 0:04:01
      157500 -- (-2337.850) (-2334.345) [-2335.008] (-2334.299) * (-2333.326) [-2328.368] (-2343.422) (-2331.754) -- 0:04:00
      158000 -- (-2334.737) (-2350.022) [-2327.698] (-2336.449) * (-2336.059) [-2331.976] (-2334.972) (-2330.091) -- 0:04:05
      158500 -- (-2328.927) (-2339.847) [-2332.413] (-2341.511) * (-2329.213) (-2331.195) (-2333.357) [-2329.252] -- 0:04:04
      159000 -- (-2334.624) (-2331.149) [-2333.643] (-2335.312) * (-2335.962) (-2334.113) (-2331.947) [-2334.621] -- 0:04:03
      159500 -- (-2331.707) (-2337.352) [-2332.160] (-2334.665) * [-2330.714] (-2336.553) (-2335.797) (-2338.668) -- 0:04:02
      160000 -- (-2340.031) [-2335.367] (-2333.192) (-2330.815) * (-2333.377) (-2336.792) [-2331.123] (-2331.524) -- 0:04:01

      Average standard deviation of split frequencies: 0.000978

      160500 -- (-2334.507) (-2332.668) [-2343.100] (-2332.355) * [-2333.146] (-2336.479) (-2335.784) (-2332.694) -- 0:04:00
      161000 -- (-2336.172) (-2343.299) [-2336.045] (-2335.857) * [-2336.945] (-2331.697) (-2331.108) (-2336.442) -- 0:03:59
      161500 -- (-2334.165) [-2336.346] (-2336.477) (-2327.508) * (-2334.622) (-2332.696) [-2332.394] (-2332.361) -- 0:04:04
      162000 -- [-2329.910] (-2331.046) (-2330.216) (-2328.512) * [-2328.092] (-2334.695) (-2333.036) (-2332.857) -- 0:04:03
      162500 -- [-2333.421] (-2337.420) (-2334.650) (-2333.160) * (-2334.999) (-2333.086) (-2335.859) [-2333.371] -- 0:04:02
      163000 -- [-2328.802] (-2344.530) (-2337.023) (-2330.417) * (-2335.310) (-2338.695) [-2334.764] (-2328.361) -- 0:04:01
      163500 -- (-2334.945) (-2338.226) [-2333.769] (-2328.867) * (-2333.065) [-2337.126] (-2334.565) (-2343.137) -- 0:04:00
      164000 -- (-2336.727) (-2336.270) (-2337.459) [-2329.666] * (-2333.192) (-2336.024) [-2335.939] (-2333.724) -- 0:03:59
      164500 -- (-2336.398) [-2331.660] (-2333.357) (-2332.041) * [-2331.171] (-2335.868) (-2334.999) (-2331.465) -- 0:03:58
      165000 -- (-2331.879) (-2331.601) (-2331.523) [-2331.266] * (-2330.488) (-2334.823) (-2343.434) [-2329.815] -- 0:04:02

      Average standard deviation of split frequencies: 0.000947

      165500 -- (-2330.127) (-2333.531) [-2332.228] (-2329.127) * [-2334.237] (-2333.309) (-2328.856) (-2343.556) -- 0:04:02
      166000 -- (-2336.942) (-2328.771) [-2330.984] (-2340.518) * (-2342.123) (-2337.140) [-2344.490] (-2340.343) -- 0:04:01
      166500 -- (-2332.512) (-2332.763) [-2330.489] (-2339.236) * (-2335.798) (-2336.133) [-2329.736] (-2333.291) -- 0:04:00
      167000 -- (-2329.583) [-2327.422] (-2337.429) (-2339.728) * [-2332.219] (-2338.370) (-2332.501) (-2331.298) -- 0:03:59
      167500 -- (-2328.906) (-2331.746) (-2339.689) [-2341.628] * (-2332.285) (-2339.009) (-2332.358) [-2333.497] -- 0:03:58
      168000 -- (-2335.421) [-2334.687] (-2341.681) (-2337.380) * (-2330.068) (-2330.719) [-2329.977] (-2329.031) -- 0:03:57
      168500 -- (-2328.095) (-2327.943) (-2330.804) [-2336.005] * (-2338.163) (-2334.542) (-2332.092) [-2334.395] -- 0:04:01
      169000 -- (-2338.650) (-2331.037) [-2333.853] (-2336.050) * (-2334.400) (-2332.819) [-2332.666] (-2338.207) -- 0:04:00
      169500 -- (-2334.766) (-2333.996) [-2326.165] (-2331.444) * (-2337.242) [-2333.856] (-2334.715) (-2332.389) -- 0:04:00
      170000 -- (-2331.187) (-2345.704) [-2327.388] (-2335.016) * (-2335.790) (-2337.800) [-2329.486] (-2337.698) -- 0:03:59

      Average standard deviation of split frequencies: 0.000000

      170500 -- [-2335.396] (-2336.988) (-2328.328) (-2336.622) * [-2339.131] (-2335.597) (-2332.245) (-2335.762) -- 0:03:58
      171000 -- [-2329.910] (-2333.845) (-2337.560) (-2336.132) * (-2333.589) [-2332.144] (-2337.009) (-2341.992) -- 0:03:57
      171500 -- [-2334.508] (-2329.194) (-2336.383) (-2345.068) * (-2338.329) (-2334.243) [-2332.352] (-2339.684) -- 0:03:56
      172000 -- (-2333.435) [-2331.319] (-2335.744) (-2335.817) * (-2332.716) [-2333.197] (-2334.429) (-2339.914) -- 0:04:00
      172500 -- (-2331.214) (-2335.866) [-2328.541] (-2333.384) * (-2335.141) [-2330.179] (-2332.844) (-2331.709) -- 0:03:59
      173000 -- (-2338.464) (-2333.391) (-2337.845) [-2336.303] * (-2334.407) (-2335.019) (-2335.642) [-2337.786] -- 0:03:59
      173500 -- (-2330.630) (-2329.001) [-2333.100] (-2333.993) * (-2333.751) (-2332.594) [-2338.727] (-2340.842) -- 0:03:58
      174000 -- (-2328.595) [-2332.092] (-2330.978) (-2341.622) * (-2331.742) (-2339.252) [-2328.138] (-2333.334) -- 0:03:57
      174500 -- (-2332.638) [-2338.228] (-2335.530) (-2340.560) * (-2336.983) [-2335.120] (-2334.035) (-2338.031) -- 0:03:56
      175000 -- (-2333.895) [-2328.896] (-2331.073) (-2337.080) * (-2332.617) (-2332.566) (-2334.129) [-2328.533] -- 0:03:55

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-2330.492) (-2335.261) (-2333.127) [-2333.332] * (-2330.841) (-2334.820) [-2336.091] (-2333.713) -- 0:03:59
      176000 -- (-2337.322) (-2332.588) (-2339.785) [-2327.591] * (-2335.017) (-2342.360) [-2332.407] (-2330.845) -- 0:03:58
      176500 -- (-2335.665) [-2330.655] (-2341.120) (-2336.355) * [-2332.064] (-2334.286) (-2334.235) (-2326.738) -- 0:03:57
      177000 -- (-2328.815) (-2334.442) (-2344.940) [-2328.974] * (-2327.820) [-2335.226] (-2335.550) (-2335.570) -- 0:03:57
      177500 -- (-2339.603) [-2331.149] (-2332.354) (-2326.197) * (-2327.127) [-2327.228] (-2337.097) (-2331.334) -- 0:03:56
      178000 -- (-2332.563) (-2332.277) (-2334.812) [-2334.242] * (-2333.042) [-2330.386] (-2341.536) (-2332.188) -- 0:03:55
      178500 -- [-2337.466] (-2335.876) (-2337.185) (-2337.655) * (-2335.541) (-2338.563) (-2340.634) [-2331.155] -- 0:03:54
      179000 -- (-2331.947) (-2332.965) [-2328.783] (-2336.006) * (-2336.051) [-2335.199] (-2331.465) (-2331.219) -- 0:03:58
      179500 -- (-2330.050) (-2332.538) (-2330.704) [-2333.043] * (-2336.893) [-2330.785] (-2332.615) (-2330.034) -- 0:03:57
      180000 -- (-2329.508) (-2332.356) [-2333.086] (-2329.759) * (-2334.382) (-2338.311) (-2333.984) [-2329.656] -- 0:03:56

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-2329.648) (-2326.557) (-2335.847) [-2331.093] * (-2331.201) [-2333.558] (-2330.025) (-2332.937) -- 0:03:56
      181000 -- (-2336.774) (-2328.694) [-2333.029] (-2336.179) * (-2330.470) (-2333.034) (-2334.118) [-2330.932] -- 0:03:55
      181500 -- (-2337.779) [-2331.641] (-2333.264) (-2339.937) * (-2334.019) (-2331.849) (-2335.892) [-2334.454] -- 0:03:54
      182000 -- [-2336.257] (-2328.097) (-2338.559) (-2330.645) * (-2340.854) (-2331.042) [-2331.529] (-2335.504) -- 0:03:53
      182500 -- (-2330.088) [-2331.210] (-2332.118) (-2338.016) * (-2336.263) (-2340.904) [-2337.088] (-2332.079) -- 0:03:57
      183000 -- (-2333.729) (-2338.525) [-2337.556] (-2338.880) * (-2334.654) (-2333.599) [-2329.313] (-2338.278) -- 0:03:56
      183500 -- (-2329.933) [-2329.133] (-2336.008) (-2338.948) * (-2335.746) [-2336.032] (-2334.184) (-2330.722) -- 0:03:55
      184000 -- [-2328.413] (-2330.324) (-2331.619) (-2336.236) * [-2331.071] (-2336.970) (-2332.897) (-2333.305) -- 0:03:55
      184500 -- [-2328.164] (-2342.191) (-2334.107) (-2334.234) * (-2334.776) (-2333.307) [-2330.871] (-2331.547) -- 0:03:54
      185000 -- [-2330.018] (-2333.603) (-2331.583) (-2331.611) * (-2335.214) [-2338.670] (-2334.848) (-2340.798) -- 0:03:53

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-2334.034) (-2327.726) (-2329.825) [-2335.054] * (-2340.861) (-2329.950) (-2333.757) [-2331.418] -- 0:03:52
      186000 -- (-2336.503) (-2333.525) (-2326.692) [-2330.611] * (-2333.470) (-2334.150) [-2328.061] (-2334.225) -- 0:03:56
      186500 -- (-2337.851) (-2332.557) [-2339.283] (-2338.968) * (-2332.198) (-2337.358) [-2337.198] (-2338.777) -- 0:03:55
      187000 -- [-2329.991] (-2337.856) (-2332.359) (-2329.556) * [-2334.001] (-2328.844) (-2331.592) (-2341.589) -- 0:03:54
      187500 -- [-2333.273] (-2333.794) (-2330.535) (-2335.871) * (-2329.860) [-2333.060] (-2338.013) (-2335.588) -- 0:03:54
      188000 -- [-2331.876] (-2345.551) (-2332.612) (-2330.391) * [-2335.069] (-2327.161) (-2331.526) (-2333.727) -- 0:03:53
      188500 -- (-2332.540) [-2332.297] (-2331.919) (-2334.427) * (-2340.385) (-2328.491) [-2329.199] (-2333.030) -- 0:03:52
      189000 -- [-2331.514] (-2329.446) (-2335.041) (-2335.252) * (-2330.623) (-2331.601) (-2339.742) [-2332.923] -- 0:03:51
      189500 -- (-2332.003) (-2339.821) (-2329.097) [-2335.769] * (-2334.387) (-2334.086) (-2332.262) [-2330.971] -- 0:03:55
      190000 -- (-2335.873) (-2333.183) [-2332.028] (-2330.623) * (-2330.240) (-2334.406) (-2336.038) [-2338.777] -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      190500 -- [-2334.157] (-2326.005) (-2342.289) (-2335.860) * (-2333.757) (-2334.659) [-2336.488] (-2329.181) -- 0:03:53
      191000 -- (-2333.673) (-2338.972) (-2331.733) [-2330.247] * (-2334.864) [-2329.625] (-2331.641) (-2334.062) -- 0:03:52
      191500 -- [-2329.385] (-2333.709) (-2331.642) (-2341.029) * (-2335.700) (-2327.840) (-2336.547) [-2333.178] -- 0:03:52
      192000 -- [-2332.404] (-2338.021) (-2338.302) (-2335.529) * (-2339.655) (-2334.960) (-2338.545) [-2332.124] -- 0:03:51
      192500 -- [-2328.306] (-2337.524) (-2330.431) (-2331.780) * (-2337.749) [-2332.218] (-2332.432) (-2332.638) -- 0:03:50
      193000 -- (-2330.509) (-2333.153) [-2331.858] (-2331.515) * (-2336.119) [-2333.549] (-2330.223) (-2332.893) -- 0:03:54
      193500 -- [-2332.619] (-2333.271) (-2326.564) (-2335.608) * (-2326.353) (-2337.601) (-2337.863) [-2333.971] -- 0:03:53
      194000 -- (-2330.282) (-2334.635) (-2329.040) [-2333.449] * (-2334.068) (-2338.478) (-2333.359) [-2329.550] -- 0:03:52
      194500 -- [-2333.859] (-2337.199) (-2330.056) (-2340.349) * [-2333.434] (-2338.516) (-2340.431) (-2332.753) -- 0:03:51
      195000 -- [-2332.533] (-2338.025) (-2340.906) (-2329.549) * (-2332.258) [-2331.406] (-2337.370) (-2327.124) -- 0:03:51

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-2341.715) (-2333.319) [-2333.322] (-2337.815) * (-2331.046) (-2334.629) (-2340.316) [-2329.439] -- 0:03:50
      196000 -- (-2336.716) [-2334.593] (-2333.215) (-2332.010) * (-2336.265) (-2331.403) [-2331.065] (-2331.633) -- 0:03:49
      196500 -- (-2332.647) (-2330.979) (-2337.152) [-2331.732] * [-2328.130] (-2334.093) (-2329.439) (-2336.900) -- 0:03:53
      197000 -- (-2335.778) [-2333.884] (-2336.223) (-2334.998) * (-2336.944) (-2337.533) [-2329.511] (-2338.731) -- 0:03:52
      197500 -- (-2329.923) (-2334.013) (-2334.503) [-2333.242] * [-2333.894] (-2346.139) (-2335.780) (-2330.721) -- 0:03:51
      198000 -- (-2331.349) [-2336.862] (-2334.019) (-2329.280) * [-2330.805] (-2338.230) (-2336.305) (-2330.246) -- 0:03:50
      198500 -- (-2338.192) (-2329.020) [-2331.437] (-2332.951) * (-2332.242) (-2334.618) [-2332.279] (-2334.775) -- 0:03:50
      199000 -- (-2333.131) [-2333.467] (-2334.458) (-2327.558) * (-2339.146) [-2335.045] (-2337.906) (-2330.276) -- 0:03:49
      199500 -- [-2332.823] (-2331.082) (-2334.356) (-2339.394) * (-2333.387) (-2336.825) [-2328.000] (-2332.955) -- 0:03:48
      200000 -- (-2335.032) (-2334.141) (-2330.356) [-2329.256] * (-2341.299) (-2334.593) (-2333.832) [-2330.535] -- 0:03:52

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-2330.536) (-2332.756) [-2328.680] (-2335.035) * (-2332.475) [-2333.528] (-2333.243) (-2328.618) -- 0:03:51
      201000 -- (-2325.505) [-2333.233] (-2338.849) (-2330.325) * [-2328.408] (-2332.533) (-2327.690) (-2333.861) -- 0:03:50
      201500 -- [-2329.734] (-2330.464) (-2332.524) (-2328.110) * (-2331.845) [-2335.477] (-2334.665) (-2338.002) -- 0:03:49
      202000 -- (-2342.354) (-2340.624) [-2331.308] (-2325.492) * (-2331.101) (-2333.765) [-2333.388] (-2334.265) -- 0:03:49
      202500 -- (-2339.014) [-2327.699] (-2330.146) (-2339.044) * (-2329.495) (-2332.618) [-2338.018] (-2338.605) -- 0:03:48
      203000 -- (-2340.579) (-2330.149) (-2327.895) [-2329.445] * (-2331.671) [-2327.694] (-2335.125) (-2334.653) -- 0:03:47
      203500 -- (-2336.558) [-2335.031] (-2333.544) (-2334.849) * (-2333.101) [-2331.103] (-2335.454) (-2339.555) -- 0:03:50
      204000 -- (-2337.634) [-2330.988] (-2337.006) (-2330.269) * (-2336.591) (-2337.209) [-2333.118] (-2338.100) -- 0:03:50
      204500 -- (-2332.785) [-2333.513] (-2338.304) (-2328.409) * (-2335.276) (-2339.876) (-2340.543) [-2337.547] -- 0:03:49
      205000 -- (-2335.504) (-2333.289) (-2332.197) [-2329.068] * (-2335.471) (-2333.869) [-2331.985] (-2332.893) -- 0:03:48

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-2336.167) [-2331.904] (-2341.719) (-2325.983) * (-2337.475) (-2334.112) (-2339.942) [-2344.878] -- 0:03:48
      206000 -- [-2336.399] (-2338.780) (-2329.718) (-2333.216) * (-2333.761) [-2334.091] (-2335.208) (-2338.230) -- 0:03:47
      206500 -- (-2341.397) (-2333.020) (-2339.243) [-2332.747] * [-2331.251] (-2333.141) (-2341.710) (-2335.151) -- 0:03:46
      207000 -- (-2336.446) [-2328.812] (-2333.787) (-2330.154) * (-2329.599) (-2337.251) (-2335.699) [-2333.539] -- 0:03:49
      207500 -- (-2336.331) (-2334.054) (-2327.647) [-2331.995] * (-2330.826) (-2334.376) (-2331.425) [-2330.556] -- 0:03:49
      208000 -- [-2334.480] (-2339.778) (-2334.586) (-2333.161) * (-2331.961) (-2340.089) [-2332.366] (-2332.452) -- 0:03:48
      208500 -- [-2329.324] (-2336.793) (-2333.227) (-2338.031) * (-2333.668) (-2347.328) [-2330.144] (-2338.250) -- 0:03:47
      209000 -- [-2331.758] (-2329.505) (-2328.419) (-2334.758) * (-2328.488) (-2337.422) [-2331.525] (-2334.978) -- 0:03:47
      209500 -- [-2333.017] (-2335.962) (-2328.004) (-2333.040) * (-2330.501) [-2333.365] (-2331.134) (-2335.712) -- 0:03:46
      210000 -- (-2331.167) (-2338.392) (-2329.959) [-2326.784] * (-2333.311) (-2335.165) [-2335.789] (-2330.679) -- 0:03:45

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-2329.228) [-2332.334] (-2333.888) (-2333.239) * (-2335.111) (-2332.867) [-2326.720] (-2333.455) -- 0:03:48
      211000 -- (-2332.506) (-2335.550) [-2325.533] (-2329.901) * (-2331.795) (-2335.325) [-2336.639] (-2330.591) -- 0:03:48
      211500 -- (-2335.927) [-2331.501] (-2333.592) (-2339.482) * (-2333.747) (-2335.359) [-2333.744] (-2330.599) -- 0:03:47
      212000 -- (-2336.660) (-2327.737) [-2334.689] (-2329.849) * (-2341.038) [-2328.763] (-2339.282) (-2334.757) -- 0:03:46
      212500 -- [-2333.748] (-2331.583) (-2332.693) (-2328.791) * (-2331.817) (-2331.626) [-2331.476] (-2331.649) -- 0:03:46
      213000 -- [-2333.053] (-2332.217) (-2329.349) (-2331.650) * [-2333.573] (-2333.122) (-2334.038) (-2330.315) -- 0:03:45
      213500 -- [-2335.108] (-2334.061) (-2337.424) (-2337.964) * [-2335.601] (-2335.884) (-2327.152) (-2333.898) -- 0:03:44
      214000 -- (-2334.648) [-2333.975] (-2334.496) (-2329.847) * (-2331.799) (-2333.600) (-2332.106) [-2334.221] -- 0:03:47
      214500 -- [-2331.673] (-2332.626) (-2337.463) (-2331.148) * (-2329.873) [-2330.945] (-2336.898) (-2335.926) -- 0:03:47
      215000 -- (-2332.892) (-2338.063) [-2334.697] (-2327.015) * [-2329.152] (-2333.476) (-2335.137) (-2331.052) -- 0:03:46

      Average standard deviation of split frequencies: 0.000727

      215500 -- (-2336.718) (-2329.092) (-2331.017) [-2333.100] * (-2329.931) (-2328.055) (-2331.971) [-2336.940] -- 0:03:45
      216000 -- (-2331.461) [-2329.540] (-2339.300) (-2329.807) * (-2329.951) [-2326.385] (-2330.365) (-2334.142) -- 0:03:45
      216500 -- (-2332.434) (-2335.916) [-2332.412] (-2341.443) * (-2327.338) [-2333.796] (-2331.993) (-2331.128) -- 0:03:44
      217000 -- (-2331.197) (-2332.543) (-2334.682) [-2334.579] * [-2334.040] (-2331.705) (-2336.291) (-2334.316) -- 0:03:43
      217500 -- [-2336.002] (-2328.608) (-2336.105) (-2347.163) * [-2338.605] (-2332.948) (-2335.259) (-2332.599) -- 0:03:46
      218000 -- [-2337.827] (-2326.938) (-2332.897) (-2334.590) * [-2335.638] (-2333.714) (-2333.397) (-2333.946) -- 0:03:45
      218500 -- (-2338.656) (-2335.281) [-2329.438] (-2326.758) * (-2328.540) (-2338.243) [-2333.519] (-2330.848) -- 0:03:45
      219000 -- (-2342.331) (-2338.118) [-2329.381] (-2333.947) * [-2329.514] (-2338.734) (-2332.466) (-2329.016) -- 0:03:44
      219500 -- (-2338.248) (-2331.403) (-2335.427) [-2336.644] * [-2329.733] (-2333.847) (-2350.856) (-2331.959) -- 0:03:44
      220000 -- (-2328.465) [-2336.922] (-2331.387) (-2335.715) * (-2335.552) (-2336.549) (-2340.399) [-2330.049] -- 0:03:43

      Average standard deviation of split frequencies: 0.000712

      220500 -- (-2328.000) [-2331.849] (-2329.716) (-2332.086) * (-2338.556) (-2334.366) [-2339.632] (-2330.070) -- 0:03:42
      221000 -- (-2332.561) [-2328.232] (-2334.941) (-2333.844) * (-2327.308) (-2337.415) (-2342.670) [-2328.402] -- 0:03:45
      221500 -- (-2336.039) [-2332.403] (-2339.764) (-2328.848) * [-2328.552] (-2342.796) (-2335.584) (-2329.449) -- 0:03:44
      222000 -- (-2333.763) (-2327.612) [-2338.958] (-2336.328) * [-2326.265] (-2344.331) (-2344.766) (-2330.538) -- 0:03:44
      222500 -- [-2332.483] (-2330.965) (-2332.325) (-2329.625) * [-2328.969] (-2342.764) (-2333.421) (-2333.876) -- 0:03:43
      223000 -- (-2330.347) [-2335.446] (-2336.207) (-2335.356) * (-2335.170) (-2337.960) (-2340.102) [-2332.872] -- 0:03:42
      223500 -- (-2341.098) [-2329.366] (-2330.064) (-2330.084) * (-2332.976) [-2333.645] (-2335.309) (-2327.747) -- 0:03:42
      224000 -- (-2343.593) [-2330.401] (-2335.958) (-2330.435) * (-2332.906) [-2331.840] (-2330.942) (-2339.362) -- 0:03:41
      224500 -- (-2339.099) [-2334.382] (-2336.021) (-2330.593) * [-2332.402] (-2334.650) (-2337.654) (-2334.745) -- 0:03:44
      225000 -- (-2337.137) [-2331.666] (-2342.662) (-2329.541) * (-2332.016) [-2331.272] (-2333.581) (-2331.277) -- 0:03:43

      Average standard deviation of split frequencies: 0.000695

      225500 -- (-2335.505) [-2329.876] (-2338.483) (-2332.532) * (-2335.837) [-2337.189] (-2331.501) (-2338.828) -- 0:03:43
      226000 -- (-2335.341) [-2330.951] (-2334.525) (-2332.638) * (-2325.411) [-2325.221] (-2332.488) (-2340.686) -- 0:03:42
      226500 -- (-2337.227) (-2329.952) (-2339.298) [-2331.894] * (-2342.673) (-2330.906) (-2341.036) [-2330.081] -- 0:03:41
      227000 -- (-2341.851) (-2332.405) [-2333.805] (-2334.747) * (-2332.090) (-2333.787) (-2336.304) [-2332.091] -- 0:03:41
      227500 -- (-2336.014) [-2333.163] (-2332.367) (-2333.117) * (-2329.039) [-2331.432] (-2329.872) (-2329.253) -- 0:03:40
      228000 -- (-2336.704) [-2338.290] (-2336.489) (-2349.196) * (-2332.075) (-2342.146) (-2334.612) [-2330.876] -- 0:03:43
      228500 -- (-2334.319) [-2343.137] (-2330.491) (-2338.622) * [-2333.452] (-2324.995) (-2329.374) (-2340.795) -- 0:03:42
      229000 -- (-2335.918) (-2331.701) [-2330.550] (-2332.904) * (-2333.354) (-2329.886) [-2336.368] (-2334.582) -- 0:03:42
      229500 -- (-2335.703) (-2335.263) [-2331.534] (-2343.902) * [-2333.266] (-2325.468) (-2337.343) (-2329.420) -- 0:03:41
      230000 -- (-2331.345) [-2336.695] (-2331.636) (-2341.292) * (-2330.054) [-2335.928] (-2328.912) (-2336.929) -- 0:03:40

      Average standard deviation of split frequencies: 0.000681

      230500 -- (-2339.616) [-2331.011] (-2331.006) (-2338.950) * (-2327.656) (-2341.537) [-2328.570] (-2331.513) -- 0:03:40
      231000 -- (-2336.833) [-2336.167] (-2333.367) (-2329.850) * [-2327.904] (-2335.152) (-2333.416) (-2330.107) -- 0:03:39
      231500 -- (-2333.502) [-2330.320] (-2328.352) (-2329.604) * (-2332.871) (-2333.040) (-2335.955) [-2327.926] -- 0:03:42
      232000 -- (-2337.553) [-2335.522] (-2335.721) (-2333.799) * [-2328.427] (-2340.010) (-2332.663) (-2329.110) -- 0:03:41
      232500 -- (-2325.906) (-2333.084) [-2326.964] (-2333.474) * [-2334.152] (-2334.717) (-2337.897) (-2331.669) -- 0:03:41
      233000 -- (-2332.745) [-2341.255] (-2333.535) (-2343.276) * (-2332.438) (-2332.233) [-2332.262] (-2330.598) -- 0:03:40
      233500 -- (-2331.021) (-2348.711) (-2330.889) [-2335.097] * (-2328.738) (-2333.066) [-2329.997] (-2331.227) -- 0:03:39
      234000 -- (-2334.576) (-2334.390) [-2329.721] (-2332.538) * [-2326.675] (-2331.569) (-2341.900) (-2331.370) -- 0:03:39
      234500 -- (-2330.843) (-2347.543) (-2331.191) [-2330.074] * [-2331.023] (-2333.413) (-2332.328) (-2332.483) -- 0:03:38
      235000 -- (-2337.076) [-2333.675] (-2327.940) (-2340.777) * (-2328.073) (-2332.065) [-2330.598] (-2331.925) -- 0:03:41

      Average standard deviation of split frequencies: 0.001332

      235500 -- [-2336.951] (-2338.072) (-2335.012) (-2335.031) * [-2330.814] (-2327.132) (-2333.870) (-2332.118) -- 0:03:40
      236000 -- [-2332.046] (-2333.940) (-2331.550) (-2328.977) * (-2335.390) [-2327.456] (-2333.774) (-2343.575) -- 0:03:40
      236500 -- (-2337.847) [-2336.451] (-2327.549) (-2336.947) * (-2335.504) (-2331.992) [-2335.811] (-2337.207) -- 0:03:39
      237000 -- (-2329.213) [-2332.723] (-2331.106) (-2329.264) * (-2339.418) (-2334.665) (-2334.202) [-2336.174] -- 0:03:38
      237500 -- (-2329.849) (-2329.121) [-2331.072] (-2337.017) * [-2330.463] (-2330.408) (-2340.185) (-2331.933) -- 0:03:38
      238000 -- [-2336.391] (-2334.193) (-2337.930) (-2332.883) * (-2335.180) [-2336.502] (-2331.010) (-2331.517) -- 0:03:37
      238500 -- (-2336.834) (-2329.591) (-2339.593) [-2328.742] * (-2336.491) [-2331.820] (-2336.273) (-2332.518) -- 0:03:40
      239000 -- (-2334.474) [-2329.778] (-2337.857) (-2333.284) * [-2327.313] (-2332.691) (-2332.225) (-2338.203) -- 0:03:39
      239500 -- (-2352.431) [-2335.882] (-2340.347) (-2328.249) * [-2334.772] (-2335.241) (-2330.121) (-2332.775) -- 0:03:39
      240000 -- (-2333.618) (-2333.831) (-2337.426) [-2327.892] * (-2338.077) [-2333.707] (-2334.925) (-2333.060) -- 0:03:38

      Average standard deviation of split frequencies: 0.001306

      240500 -- (-2332.983) (-2328.831) (-2334.881) [-2326.389] * (-2333.141) [-2331.165] (-2342.362) (-2333.068) -- 0:03:37
      241000 -- [-2334.394] (-2328.867) (-2342.074) (-2341.099) * (-2334.267) (-2331.742) [-2332.871] (-2336.877) -- 0:03:37
      241500 -- [-2328.334] (-2335.448) (-2331.605) (-2329.874) * (-2330.640) (-2331.247) [-2329.096] (-2328.403) -- 0:03:36
      242000 -- (-2332.949) [-2333.446] (-2335.847) (-2330.941) * [-2332.195] (-2334.839) (-2330.737) (-2336.483) -- 0:03:39
      242500 -- [-2333.110] (-2330.621) (-2330.829) (-2329.645) * (-2329.762) (-2330.474) (-2333.078) [-2329.807] -- 0:03:38
      243000 -- [-2330.921] (-2332.781) (-2331.233) (-2331.906) * (-2331.930) (-2330.829) (-2337.186) [-2334.973] -- 0:03:38
      243500 -- (-2331.216) (-2329.393) (-2328.087) [-2326.577] * (-2333.381) (-2335.832) (-2333.242) [-2328.919] -- 0:03:37
      244000 -- (-2338.095) [-2333.188] (-2329.144) (-2336.512) * (-2330.169) (-2331.413) (-2330.045) [-2328.799] -- 0:03:36
      244500 -- (-2344.444) [-2334.265] (-2329.409) (-2327.861) * (-2334.463) [-2331.110] (-2332.524) (-2326.716) -- 0:03:36
      245000 -- (-2338.944) [-2336.030] (-2335.083) (-2338.053) * (-2344.772) (-2332.476) (-2331.909) [-2333.052] -- 0:03:35

      Average standard deviation of split frequencies: 0.001278

      245500 -- (-2336.651) (-2333.343) [-2333.205] (-2333.472) * (-2333.046) (-2335.144) (-2331.679) [-2327.758] -- 0:03:38
      246000 -- (-2338.166) (-2331.263) (-2335.108) [-2344.055] * (-2335.840) [-2333.315] (-2333.575) (-2336.208) -- 0:03:37
      246500 -- (-2335.460) [-2332.686] (-2334.241) (-2335.668) * (-2331.114) (-2332.314) [-2333.856] (-2333.710) -- 0:03:37
      247000 -- (-2329.053) (-2336.869) [-2338.815] (-2327.287) * (-2329.210) (-2330.440) [-2327.635] (-2330.662) -- 0:03:36
      247500 -- (-2334.153) [-2334.896] (-2331.695) (-2330.560) * (-2335.193) (-2344.155) [-2337.625] (-2335.560) -- 0:03:35
      248000 -- (-2329.937) (-2333.938) [-2330.661] (-2334.358) * (-2338.289) (-2340.781) [-2327.967] (-2336.803) -- 0:03:35
      248500 -- (-2331.896) (-2335.857) [-2332.120] (-2328.274) * [-2329.391] (-2329.379) (-2328.510) (-2339.433) -- 0:03:34
      249000 -- (-2335.242) (-2329.447) (-2334.562) [-2333.959] * [-2334.731] (-2326.393) (-2337.388) (-2330.585) -- 0:03:37
      249500 -- (-2336.231) (-2332.754) (-2333.728) [-2332.886] * (-2329.754) (-2338.207) [-2331.493] (-2331.458) -- 0:03:36
      250000 -- (-2332.012) (-2336.069) [-2334.393] (-2338.005) * (-2335.141) (-2332.767) (-2336.903) [-2332.322] -- 0:03:36

      Average standard deviation of split frequencies: 0.001881

      250500 -- [-2330.040] (-2338.206) (-2337.702) (-2334.684) * [-2329.248] (-2342.372) (-2334.926) (-2331.705) -- 0:03:35
      251000 -- (-2335.798) [-2334.227] (-2337.343) (-2333.767) * [-2334.660] (-2344.722) (-2330.062) (-2337.010) -- 0:03:34
      251500 -- [-2332.368] (-2327.209) (-2339.678) (-2332.949) * (-2336.390) (-2346.756) [-2332.006] (-2330.354) -- 0:03:34
      252000 -- (-2334.432) (-2335.802) (-2331.253) [-2332.234] * (-2339.397) (-2342.175) (-2330.926) [-2327.501] -- 0:03:33
      252500 -- [-2334.797] (-2329.160) (-2334.361) (-2336.829) * (-2335.732) (-2334.638) [-2334.503] (-2341.540) -- 0:03:36
      253000 -- (-2334.856) (-2330.636) (-2334.095) [-2334.273] * [-2335.413] (-2335.871) (-2339.534) (-2331.526) -- 0:03:35
      253500 -- (-2333.997) [-2329.837] (-2344.804) (-2339.389) * (-2330.879) (-2334.754) (-2328.339) [-2337.177] -- 0:03:34
      254000 -- [-2336.831] (-2334.570) (-2342.072) (-2344.282) * (-2329.619) (-2336.184) [-2329.433] (-2334.638) -- 0:03:34
      254500 -- (-2335.795) [-2332.168] (-2336.183) (-2326.912) * [-2337.512] (-2327.460) (-2333.695) (-2336.743) -- 0:03:33
      255000 -- [-2326.540] (-2330.852) (-2340.542) (-2330.416) * (-2335.024) (-2336.214) [-2333.629] (-2336.893) -- 0:03:33

      Average standard deviation of split frequencies: 0.001841

      255500 -- (-2342.757) (-2332.659) (-2342.586) [-2333.703] * [-2336.998] (-2334.054) (-2329.556) (-2336.919) -- 0:03:32
      256000 -- (-2337.061) [-2333.530] (-2333.681) (-2333.698) * (-2334.324) (-2335.719) (-2337.621) [-2336.190] -- 0:03:35
      256500 -- (-2332.154) [-2332.532] (-2325.750) (-2325.311) * (-2334.084) (-2338.233) (-2328.832) [-2337.430] -- 0:03:34
      257000 -- (-2339.428) (-2337.078) (-2328.906) [-2332.885] * (-2335.147) (-2330.142) [-2332.027] (-2332.023) -- 0:03:33
      257500 -- (-2330.785) (-2334.009) (-2331.017) [-2332.129] * (-2328.071) (-2330.869) (-2339.677) [-2332.144] -- 0:03:33
      258000 -- (-2329.471) [-2331.642] (-2332.035) (-2341.627) * [-2335.348] (-2334.647) (-2340.790) (-2336.050) -- 0:03:32
      258500 -- [-2331.821] (-2330.370) (-2335.896) (-2332.197) * (-2337.699) (-2335.616) [-2331.451] (-2333.890) -- 0:03:32
      259000 -- (-2333.274) (-2331.998) (-2344.110) [-2333.247] * (-2332.608) (-2339.796) [-2333.722] (-2334.084) -- 0:03:31
      259500 -- [-2329.281] (-2336.088) (-2331.667) (-2335.678) * [-2333.308] (-2328.544) (-2332.264) (-2349.176) -- 0:03:34
      260000 -- (-2331.480) (-2333.065) [-2324.225] (-2326.273) * [-2335.874] (-2336.416) (-2331.234) (-2334.439) -- 0:03:33

      Average standard deviation of split frequencies: 0.001808

      260500 -- [-2329.096] (-2330.881) (-2331.440) (-2329.928) * (-2333.509) (-2348.216) (-2328.940) [-2329.768] -- 0:03:32
      261000 -- (-2334.028) (-2337.197) [-2332.757] (-2332.000) * (-2330.273) (-2338.916) [-2335.247] (-2333.687) -- 0:03:32
      261500 -- [-2332.053] (-2332.800) (-2330.175) (-2338.004) * (-2334.062) (-2334.502) [-2328.910] (-2338.114) -- 0:03:31
      262000 -- (-2337.388) (-2333.248) [-2332.189] (-2334.314) * (-2336.289) [-2331.447] (-2334.971) (-2334.012) -- 0:03:31
      262500 -- (-2338.937) (-2332.936) [-2335.013] (-2342.676) * [-2333.583] (-2329.924) (-2341.686) (-2340.731) -- 0:03:33
      263000 -- (-2340.272) (-2333.096) (-2330.980) [-2331.487] * [-2335.466] (-2346.844) (-2334.669) (-2335.222) -- 0:03:32
      263500 -- (-2339.425) (-2343.635) (-2333.953) [-2329.249] * (-2330.268) (-2338.368) (-2331.949) [-2330.213] -- 0:03:32
      264000 -- (-2335.532) [-2333.712] (-2335.901) (-2332.718) * (-2334.376) (-2337.215) (-2338.407) [-2325.797] -- 0:03:31
      264500 -- [-2334.715] (-2327.889) (-2332.512) (-2331.020) * [-2331.235] (-2329.341) (-2333.687) (-2329.405) -- 0:03:31
      265000 -- (-2343.593) [-2335.206] (-2332.822) (-2340.158) * (-2334.502) (-2333.815) [-2332.393] (-2332.685) -- 0:03:30

      Average standard deviation of split frequencies: 0.001181

      265500 -- (-2342.410) (-2335.685) (-2335.219) [-2335.867] * (-2334.517) (-2331.390) (-2334.333) [-2330.885] -- 0:03:30
      266000 -- (-2341.104) [-2332.117] (-2335.158) (-2330.366) * [-2337.135] (-2330.909) (-2334.067) (-2333.601) -- 0:03:32
      266500 -- (-2335.468) (-2333.855) [-2339.990] (-2326.627) * (-2333.072) (-2346.759) (-2333.851) [-2329.496] -- 0:03:31
      267000 -- (-2331.588) (-2330.845) [-2332.528] (-2334.354) * (-2340.005) [-2329.875] (-2329.065) (-2330.754) -- 0:03:31
      267500 -- (-2333.416) (-2332.655) (-2329.807) [-2330.270] * (-2328.445) (-2336.657) [-2328.509] (-2335.307) -- 0:03:30
      268000 -- (-2333.261) (-2335.294) (-2334.835) [-2330.203] * [-2337.215] (-2333.294) (-2333.184) (-2333.953) -- 0:03:30
      268500 -- (-2335.666) (-2334.705) [-2332.542] (-2332.516) * (-2342.713) (-2332.590) [-2328.945] (-2333.488) -- 0:03:29
      269000 -- (-2333.800) (-2334.101) [-2328.399] (-2334.432) * [-2332.606] (-2326.554) (-2331.195) (-2333.135) -- 0:03:29
      269500 -- (-2327.046) [-2336.088] (-2327.989) (-2327.061) * [-2331.024] (-2334.116) (-2327.577) (-2339.444) -- 0:03:31
      270000 -- (-2328.989) (-2336.276) (-2328.834) [-2328.283] * [-2328.980] (-2334.305) (-2337.448) (-2339.588) -- 0:03:30

      Average standard deviation of split frequencies: 0.000581

      270500 -- [-2328.184] (-2334.480) (-2328.134) (-2334.262) * (-2335.418) (-2331.403) [-2335.052] (-2339.210) -- 0:03:30
      271000 -- [-2338.251] (-2328.757) (-2332.189) (-2334.303) * (-2338.787) [-2333.125] (-2330.883) (-2331.994) -- 0:03:29
      271500 -- (-2331.999) [-2328.673] (-2333.284) (-2332.766) * (-2334.191) (-2328.867) [-2326.981] (-2329.433) -- 0:03:29
      272000 -- (-2333.201) [-2329.819] (-2330.591) (-2337.164) * (-2329.582) (-2331.039) [-2333.351] (-2331.283) -- 0:03:28
      272500 -- (-2337.675) (-2346.991) (-2335.418) [-2337.532] * (-2328.760) (-2335.302) [-2329.702] (-2338.506) -- 0:03:28
      273000 -- (-2334.014) (-2340.494) (-2333.784) [-2338.850] * (-2330.202) (-2335.505) [-2331.195] (-2334.352) -- 0:03:30
      273500 -- (-2336.207) (-2339.945) [-2330.736] (-2331.311) * [-2330.403] (-2330.609) (-2329.518) (-2329.788) -- 0:03:29
      274000 -- [-2335.045] (-2333.863) (-2333.739) (-2333.672) * (-2333.468) [-2333.128] (-2335.705) (-2330.366) -- 0:03:29
      274500 -- (-2340.499) (-2337.155) (-2331.264) [-2331.664] * (-2327.756) [-2333.142] (-2326.928) (-2332.361) -- 0:03:28
      275000 -- (-2339.162) (-2334.936) (-2332.724) [-2338.990] * (-2340.468) (-2333.705) (-2331.243) [-2339.705] -- 0:03:28

      Average standard deviation of split frequencies: 0.001139

      275500 -- (-2347.298) (-2334.783) [-2329.076] (-2335.209) * (-2331.395) (-2331.587) [-2329.847] (-2333.345) -- 0:03:27
      276000 -- (-2338.697) (-2331.448) [-2329.774] (-2335.319) * (-2336.075) (-2335.676) (-2332.965) [-2332.855] -- 0:03:27
      276500 -- (-2330.540) [-2334.283] (-2335.649) (-2337.042) * (-2338.334) [-2334.106] (-2341.203) (-2327.902) -- 0:03:29
      277000 -- (-2336.894) [-2337.156] (-2343.486) (-2329.458) * (-2345.774) (-2329.007) (-2339.043) [-2335.981] -- 0:03:28
      277500 -- (-2333.949) [-2341.390] (-2338.604) (-2332.083) * (-2334.523) (-2330.117) (-2330.837) [-2337.788] -- 0:03:28
      278000 -- [-2330.295] (-2327.428) (-2333.416) (-2331.851) * (-2337.036) (-2336.313) (-2334.522) [-2333.335] -- 0:03:27
      278500 -- (-2336.826) (-2330.687) (-2335.189) [-2331.333] * (-2332.720) [-2339.448] (-2331.486) (-2330.646) -- 0:03:27
      279000 -- (-2331.435) (-2335.973) [-2333.081] (-2332.895) * (-2336.486) (-2332.878) (-2335.018) [-2331.151] -- 0:03:26
      279500 -- (-2335.475) (-2333.037) [-2329.676] (-2335.384) * [-2329.640] (-2337.539) (-2333.457) (-2330.288) -- 0:03:26
      280000 -- (-2334.445) (-2336.720) [-2328.071] (-2335.378) * (-2346.658) (-2335.104) (-2340.365) [-2331.515] -- 0:03:28

      Average standard deviation of split frequencies: 0.001680

      280500 -- (-2329.259) (-2330.980) (-2332.381) [-2332.995] * (-2329.590) (-2334.432) (-2340.704) [-2331.450] -- 0:03:27
      281000 -- (-2334.023) (-2331.125) (-2328.113) [-2330.865] * (-2327.906) (-2334.713) (-2334.370) [-2333.189] -- 0:03:27
      281500 -- (-2327.237) (-2333.768) [-2330.120] (-2332.477) * [-2335.087] (-2334.623) (-2337.400) (-2330.704) -- 0:03:26
      282000 -- (-2332.949) (-2336.055) [-2335.042] (-2333.802) * [-2331.827] (-2334.692) (-2333.128) (-2336.470) -- 0:03:26
      282500 -- (-2332.339) [-2340.832] (-2333.912) (-2337.922) * (-2333.305) [-2331.129] (-2334.374) (-2337.889) -- 0:03:25
      283000 -- [-2334.141] (-2334.442) (-2336.899) (-2331.653) * (-2331.933) (-2330.073) (-2331.772) [-2337.243] -- 0:03:25
      283500 -- (-2330.370) [-2333.676] (-2337.492) (-2337.188) * (-2338.739) [-2330.735] (-2343.780) (-2334.701) -- 0:03:27
      284000 -- (-2339.177) [-2332.011] (-2333.253) (-2330.191) * (-2336.744) [-2337.080] (-2338.283) (-2333.242) -- 0:03:26
      284500 -- (-2337.990) (-2329.834) (-2342.383) [-2329.582] * (-2333.678) (-2332.405) (-2334.009) [-2332.041] -- 0:03:26
      285000 -- (-2334.112) (-2332.866) [-2329.012] (-2330.516) * (-2339.424) (-2348.925) (-2337.256) [-2335.662] -- 0:03:25

      Average standard deviation of split frequencies: 0.001648

      285500 -- [-2333.171] (-2335.996) (-2337.179) (-2331.034) * (-2341.637) [-2329.340] (-2331.986) (-2332.166) -- 0:03:25
      286000 -- (-2341.628) [-2337.802] (-2333.018) (-2329.310) * [-2329.340] (-2337.206) (-2330.747) (-2333.792) -- 0:03:24
      286500 -- (-2344.727) (-2332.655) [-2330.792] (-2329.545) * (-2335.839) [-2337.273] (-2334.293) (-2338.053) -- 0:03:24
      287000 -- (-2329.519) (-2333.947) [-2331.241] (-2329.459) * (-2334.204) (-2333.696) [-2333.444] (-2332.169) -- 0:03:26
      287500 -- (-2328.265) [-2332.331] (-2339.101) (-2340.849) * (-2341.870) (-2330.890) [-2333.930] (-2331.671) -- 0:03:25
      288000 -- (-2330.016) (-2338.146) (-2332.270) [-2331.189] * [-2331.325] (-2328.126) (-2340.670) (-2337.795) -- 0:03:25
      288500 -- (-2331.652) [-2333.091] (-2334.530) (-2333.525) * (-2331.243) (-2334.458) (-2341.449) [-2334.743] -- 0:03:24
      289000 -- [-2330.679] (-2337.382) (-2330.673) (-2343.388) * (-2329.089) [-2331.364] (-2335.216) (-2333.942) -- 0:03:24
      289500 -- [-2329.129] (-2334.157) (-2328.410) (-2329.416) * [-2334.333] (-2331.049) (-2335.310) (-2331.001) -- 0:03:23
      290000 -- (-2330.367) [-2333.338] (-2332.934) (-2334.118) * (-2336.248) [-2331.147] (-2333.796) (-2336.229) -- 0:03:23

      Average standard deviation of split frequencies: 0.002703

      290500 -- (-2336.088) (-2334.204) [-2339.319] (-2330.030) * (-2334.185) [-2330.803] (-2329.187) (-2327.267) -- 0:03:25
      291000 -- (-2330.144) [-2330.406] (-2337.004) (-2332.906) * [-2332.747] (-2326.208) (-2343.581) (-2336.065) -- 0:03:24
      291500 -- (-2334.826) (-2335.918) (-2333.802) [-2329.814] * (-2333.142) [-2327.117] (-2331.047) (-2333.008) -- 0:03:24
      292000 -- [-2335.548] (-2338.846) (-2331.487) (-2329.503) * [-2329.597] (-2337.243) (-2333.057) (-2341.680) -- 0:03:23
      292500 -- [-2333.796] (-2333.576) (-2336.411) (-2334.659) * (-2333.613) (-2332.657) [-2332.929] (-2336.166) -- 0:03:23
      293000 -- (-2328.621) (-2329.407) (-2331.701) [-2336.968] * (-2330.178) [-2328.162] (-2333.456) (-2335.880) -- 0:03:22
      293500 -- (-2334.044) (-2338.892) [-2330.356] (-2334.806) * [-2330.072] (-2332.324) (-2332.109) (-2332.252) -- 0:03:22
      294000 -- (-2335.529) (-2335.043) (-2341.826) [-2334.918] * (-2331.912) (-2333.076) [-2332.276] (-2331.499) -- 0:03:24
      294500 -- (-2328.142) [-2340.066] (-2332.613) (-2333.292) * [-2337.130] (-2340.569) (-2326.802) (-2340.943) -- 0:03:23
      295000 -- (-2337.227) [-2332.258] (-2332.062) (-2332.792) * (-2336.925) (-2331.832) (-2337.799) [-2337.457] -- 0:03:23

      Average standard deviation of split frequencies: 0.002654

      295500 -- (-2330.700) [-2334.704] (-2337.969) (-2334.039) * (-2330.179) [-2327.968] (-2339.471) (-2330.803) -- 0:03:22
      296000 -- [-2331.104] (-2334.897) (-2329.626) (-2336.147) * (-2339.018) [-2327.616] (-2329.608) (-2334.683) -- 0:03:22
      296500 -- (-2338.211) (-2327.432) (-2333.729) [-2331.880] * [-2330.044] (-2337.563) (-2327.143) (-2333.115) -- 0:03:21
      297000 -- (-2339.409) (-2344.271) (-2330.976) [-2330.204] * (-2338.996) (-2331.592) [-2328.193] (-2333.077) -- 0:03:21
      297500 -- (-2333.422) (-2331.808) [-2332.139] (-2334.919) * [-2332.659] (-2331.503) (-2331.387) (-2334.329) -- 0:03:23
      298000 -- (-2336.114) (-2335.947) (-2332.115) [-2330.111] * (-2336.862) (-2338.096) [-2332.301] (-2332.674) -- 0:03:22
      298500 -- (-2331.861) [-2329.440] (-2335.905) (-2333.003) * (-2334.751) [-2341.439] (-2334.420) (-2332.313) -- 0:03:22
      299000 -- (-2330.917) (-2337.930) [-2328.998] (-2337.834) * [-2334.489] (-2331.933) (-2339.425) (-2331.461) -- 0:03:21
      299500 -- (-2330.726) [-2339.621] (-2334.964) (-2333.884) * [-2331.880] (-2338.310) (-2337.448) (-2331.871) -- 0:03:21
      300000 -- (-2333.603) (-2335.426) [-2338.069] (-2337.465) * (-2342.070) [-2333.265] (-2330.185) (-2332.186) -- 0:03:20

      Average standard deviation of split frequencies: 0.001568

      300500 -- (-2329.973) [-2332.768] (-2331.004) (-2343.491) * (-2340.571) (-2330.695) (-2332.909) [-2328.525] -- 0:03:20
      301000 -- (-2334.027) (-2334.668) [-2330.263] (-2333.382) * (-2328.853) [-2331.731] (-2334.758) (-2329.193) -- 0:03:22
      301500 -- (-2338.696) [-2328.979] (-2332.087) (-2334.272) * (-2339.339) (-2333.064) [-2330.550] (-2332.192) -- 0:03:21
      302000 -- [-2330.234] (-2330.132) (-2336.271) (-2333.768) * (-2335.321) [-2332.085] (-2335.731) (-2329.663) -- 0:03:21
      302500 -- (-2328.485) (-2335.067) [-2333.965] (-2336.640) * [-2330.639] (-2333.346) (-2338.409) (-2334.662) -- 0:03:20
      303000 -- [-2340.893] (-2334.637) (-2338.601) (-2339.805) * (-2332.657) (-2336.913) [-2327.955] (-2335.921) -- 0:03:20
      303500 -- (-2338.282) [-2332.138] (-2335.378) (-2339.079) * (-2332.059) [-2332.138] (-2330.932) (-2339.407) -- 0:03:19
      304000 -- (-2333.747) [-2333.935] (-2331.811) (-2338.895) * (-2334.641) (-2334.142) [-2329.672] (-2332.960) -- 0:03:19
      304500 -- (-2328.944) [-2334.663] (-2331.609) (-2336.320) * (-2334.952) (-2336.543) [-2330.731] (-2333.578) -- 0:03:20
      305000 -- [-2335.911] (-2331.464) (-2331.457) (-2333.656) * (-2333.589) [-2337.861] (-2337.155) (-2338.896) -- 0:03:20

      Average standard deviation of split frequencies: 0.001541

      305500 -- (-2337.258) [-2328.223] (-2341.123) (-2336.867) * [-2334.239] (-2333.496) (-2331.785) (-2333.624) -- 0:03:20
      306000 -- (-2338.189) [-2334.009] (-2332.555) (-2337.235) * (-2334.519) [-2337.565] (-2332.929) (-2335.071) -- 0:03:19
      306500 -- (-2339.586) (-2332.284) (-2332.581) [-2334.035] * (-2336.921) (-2332.781) [-2330.385] (-2332.775) -- 0:03:19
      307000 -- (-2336.287) [-2326.661] (-2327.109) (-2333.483) * (-2335.234) (-2335.903) [-2331.156] (-2337.079) -- 0:03:18
      307500 -- (-2327.173) (-2330.430) [-2330.076] (-2345.559) * (-2340.445) [-2330.400] (-2330.494) (-2332.725) -- 0:03:18
      308000 -- (-2333.788) [-2343.106] (-2328.286) (-2332.261) * (-2340.750) [-2328.912] (-2336.637) (-2337.485) -- 0:03:19
      308500 -- [-2334.019] (-2339.995) (-2327.305) (-2342.812) * (-2332.329) (-2336.349) [-2334.072] (-2343.140) -- 0:03:19
      309000 -- (-2327.658) (-2336.543) [-2329.851] (-2330.878) * [-2327.543] (-2335.737) (-2334.906) (-2333.380) -- 0:03:19
      309500 -- [-2332.098] (-2328.373) (-2338.029) (-2327.035) * [-2329.885] (-2337.437) (-2338.567) (-2331.243) -- 0:03:18
      310000 -- (-2334.842) (-2336.242) [-2333.036] (-2334.216) * (-2334.903) (-2332.301) (-2342.354) [-2329.232] -- 0:03:18

      Average standard deviation of split frequencies: 0.001517

      310500 -- [-2331.116] (-2334.710) (-2337.926) (-2339.140) * (-2336.489) [-2331.347] (-2336.092) (-2335.772) -- 0:03:17
      311000 -- (-2332.059) (-2334.422) [-2334.045] (-2338.462) * (-2330.858) (-2332.796) [-2332.162] (-2335.476) -- 0:03:17
      311500 -- (-2343.120) (-2328.206) (-2337.965) [-2328.064] * [-2331.163] (-2345.950) (-2328.897) (-2333.800) -- 0:03:18
      312000 -- (-2335.217) (-2333.736) (-2339.258) [-2330.544] * (-2338.206) (-2326.665) (-2337.038) [-2331.977] -- 0:03:18
      312500 -- (-2337.773) (-2332.143) [-2337.485] (-2342.079) * (-2335.131) (-2332.286) [-2332.857] (-2338.420) -- 0:03:18
      313000 -- [-2335.770] (-2333.123) (-2331.401) (-2336.336) * (-2336.035) (-2330.288) (-2329.855) [-2340.895] -- 0:03:17
      313500 -- [-2335.961] (-2332.390) (-2333.178) (-2333.441) * (-2330.004) [-2333.331] (-2335.554) (-2326.616) -- 0:03:17
      314000 -- (-2330.242) (-2331.492) [-2333.146] (-2341.154) * (-2333.428) [-2326.579] (-2333.426) (-2331.299) -- 0:03:16
      314500 -- (-2331.376) (-2336.480) [-2332.590] (-2335.636) * (-2338.936) [-2326.019] (-2334.672) (-2334.379) -- 0:03:16
      315000 -- [-2328.912] (-2333.715) (-2333.727) (-2326.596) * (-2341.263) (-2335.747) (-2332.440) [-2337.597] -- 0:03:17

      Average standard deviation of split frequencies: 0.000995

      315500 -- (-2338.805) (-2336.411) [-2329.704] (-2334.296) * (-2332.016) [-2333.101] (-2330.472) (-2331.386) -- 0:03:17
      316000 -- (-2331.333) [-2330.974] (-2331.636) (-2326.818) * (-2332.754) (-2332.797) [-2330.536] (-2335.269) -- 0:03:16
      316500 -- (-2334.486) (-2327.963) [-2332.935] (-2332.706) * (-2331.579) [-2336.632] (-2333.479) (-2343.495) -- 0:03:16
      317000 -- (-2333.553) [-2330.512] (-2333.439) (-2335.618) * (-2330.048) (-2337.820) (-2338.024) [-2340.479] -- 0:03:16
      317500 -- (-2330.623) (-2342.978) [-2329.499] (-2333.193) * (-2325.959) [-2329.172] (-2332.006) (-2342.839) -- 0:03:15
      318000 -- [-2334.325] (-2331.556) (-2328.952) (-2334.557) * (-2333.890) (-2327.585) [-2330.915] (-2332.205) -- 0:03:15
      318500 -- (-2328.629) (-2334.569) (-2334.617) [-2330.365] * (-2336.905) (-2332.923) (-2334.488) [-2333.333] -- 0:03:16
      319000 -- (-2334.168) [-2336.749] (-2332.524) (-2334.375) * (-2330.693) (-2331.524) [-2329.099] (-2340.083) -- 0:03:16
      319500 -- (-2332.193) (-2328.578) (-2341.249) [-2327.199] * (-2329.060) [-2329.737] (-2335.031) (-2329.317) -- 0:03:15
      320000 -- (-2331.964) (-2338.189) (-2335.268) [-2333.465] * (-2328.956) (-2340.779) [-2331.275] (-2337.986) -- 0:03:15

      Average standard deviation of split frequencies: 0.001470

      320500 -- [-2330.224] (-2329.994) (-2339.311) (-2331.845) * (-2338.868) (-2326.361) [-2331.377] (-2330.430) -- 0:03:15
      321000 -- (-2338.849) (-2329.317) (-2339.033) [-2329.711] * (-2338.154) (-2329.882) (-2334.932) [-2329.537] -- 0:03:14
      321500 -- [-2334.341] (-2331.450) (-2333.349) (-2336.002) * [-2335.332] (-2337.641) (-2333.808) (-2333.886) -- 0:03:14
      322000 -- (-2331.211) (-2334.542) [-2335.276] (-2328.477) * (-2337.030) [-2340.396] (-2328.636) (-2332.024) -- 0:03:15
      322500 -- (-2335.089) (-2330.301) [-2333.520] (-2337.355) * (-2335.909) (-2336.085) (-2339.009) [-2333.159] -- 0:03:15
      323000 -- [-2327.700] (-2338.519) (-2334.884) (-2333.129) * (-2335.522) [-2333.202] (-2334.823) (-2332.824) -- 0:03:14
      323500 -- (-2336.155) [-2329.920] (-2342.200) (-2328.469) * (-2334.497) [-2329.329] (-2326.992) (-2331.911) -- 0:03:14
      324000 -- (-2330.652) (-2336.094) (-2329.744) [-2329.346] * (-2339.094) (-2333.900) [-2328.677] (-2342.296) -- 0:03:14
      324500 -- (-2331.999) (-2332.226) [-2328.540] (-2336.117) * [-2337.099] (-2335.677) (-2334.680) (-2331.597) -- 0:03:13
      325000 -- (-2332.055) [-2326.852] (-2331.256) (-2330.107) * (-2328.646) [-2333.391] (-2342.145) (-2328.830) -- 0:03:13

      Average standard deviation of split frequencies: 0.001446

      325500 -- (-2329.708) (-2328.561) (-2332.599) [-2334.269] * (-2334.128) (-2334.036) [-2336.450] (-2331.413) -- 0:03:14
      326000 -- (-2327.558) (-2334.042) [-2332.562] (-2335.908) * (-2334.323) (-2333.323) (-2330.585) [-2331.019] -- 0:03:14
      326500 -- (-2341.148) (-2334.778) (-2336.460) [-2331.691] * (-2330.589) (-2331.613) (-2325.472) [-2328.664] -- 0:03:13
      327000 -- [-2331.999] (-2333.899) (-2329.912) (-2340.263) * [-2331.495] (-2337.834) (-2334.994) (-2338.489) -- 0:03:13
      327500 -- (-2334.201) (-2335.712) [-2335.244] (-2337.466) * [-2336.284] (-2331.868) (-2332.124) (-2331.906) -- 0:03:13
      328000 -- [-2331.749] (-2341.142) (-2328.689) (-2332.939) * [-2334.592] (-2338.343) (-2331.504) (-2331.955) -- 0:03:12
      328500 -- (-2333.288) [-2339.143] (-2333.340) (-2334.266) * (-2335.783) (-2337.763) [-2339.548] (-2329.177) -- 0:03:12
      329000 -- (-2344.351) (-2334.404) (-2334.027) [-2330.786] * (-2338.937) (-2335.050) (-2331.755) [-2335.973] -- 0:03:13
      329500 -- [-2328.787] (-2332.362) (-2332.977) (-2332.948) * [-2340.398] (-2337.358) (-2330.058) (-2333.159) -- 0:03:13
      330000 -- (-2332.800) [-2331.371] (-2328.052) (-2331.113) * (-2334.109) [-2335.851] (-2331.194) (-2331.575) -- 0:03:12

      Average standard deviation of split frequencies: 0.000950

      330500 -- (-2332.524) [-2332.692] (-2335.585) (-2338.998) * [-2328.577] (-2336.087) (-2332.803) (-2335.893) -- 0:03:12
      331000 -- (-2330.826) (-2339.868) [-2331.167] (-2332.077) * [-2328.003] (-2336.629) (-2336.216) (-2336.159) -- 0:03:12
      331500 -- [-2328.178] (-2341.955) (-2334.636) (-2329.275) * (-2339.757) [-2327.925] (-2333.123) (-2334.591) -- 0:03:11
      332000 -- [-2331.690] (-2340.892) (-2332.119) (-2328.340) * [-2334.672] (-2336.628) (-2350.295) (-2336.079) -- 0:03:11
      332500 -- [-2335.759] (-2329.937) (-2330.164) (-2332.497) * (-2329.444) (-2330.543) (-2331.012) [-2335.248] -- 0:03:12
      333000 -- [-2330.031] (-2338.440) (-2329.209) (-2336.615) * (-2339.453) (-2326.023) [-2327.280] (-2339.034) -- 0:03:12
      333500 -- (-2341.203) [-2333.640] (-2329.045) (-2332.592) * (-2338.119) [-2332.910] (-2334.327) (-2332.528) -- 0:03:11
      334000 -- [-2329.704] (-2327.490) (-2335.099) (-2329.399) * (-2336.406) (-2333.792) [-2331.081] (-2334.663) -- 0:03:11
      334500 -- [-2340.770] (-2330.192) (-2330.805) (-2333.089) * (-2328.065) (-2335.483) (-2325.861) [-2331.723] -- 0:03:10
      335000 -- [-2338.176] (-2339.891) (-2339.147) (-2331.770) * (-2331.312) (-2333.867) [-2328.798] (-2334.092) -- 0:03:10

      Average standard deviation of split frequencies: 0.000468

      335500 -- (-2329.344) [-2334.077] (-2340.348) (-2341.028) * (-2324.798) (-2335.959) [-2329.887] (-2335.876) -- 0:03:10
      336000 -- (-2328.711) (-2332.769) [-2329.124] (-2335.646) * [-2330.535] (-2335.537) (-2341.562) (-2338.910) -- 0:03:11
      336500 -- (-2334.380) [-2332.762] (-2330.972) (-2332.289) * [-2333.097] (-2330.166) (-2334.902) (-2337.986) -- 0:03:11
      337000 -- (-2338.121) (-2339.582) [-2331.871] (-2332.379) * [-2336.360] (-2337.715) (-2336.226) (-2331.151) -- 0:03:10
      337500 -- (-2333.982) (-2343.641) (-2332.939) [-2328.661] * (-2338.807) (-2334.687) [-2326.465] (-2329.855) -- 0:03:10
      338000 -- (-2331.461) (-2334.289) [-2336.139] (-2335.486) * (-2333.049) (-2331.629) (-2331.514) [-2330.513] -- 0:03:09
      338500 -- (-2336.243) [-2332.071] (-2342.365) (-2336.015) * (-2340.079) (-2340.062) (-2329.540) [-2328.363] -- 0:03:09
      339000 -- (-2331.044) (-2339.015) [-2332.371] (-2338.369) * (-2338.914) (-2331.231) (-2330.595) [-2330.421] -- 0:03:09
      339500 -- (-2331.160) (-2336.142) [-2337.171] (-2338.531) * [-2335.463] (-2332.651) (-2339.604) (-2330.576) -- 0:03:10
      340000 -- (-2330.987) [-2335.897] (-2335.813) (-2342.353) * (-2328.942) (-2337.437) (-2332.602) [-2333.072] -- 0:03:10

      Average standard deviation of split frequencies: 0.000923

      340500 -- (-2338.008) (-2333.486) [-2331.628] (-2332.739) * (-2339.219) [-2333.736] (-2329.471) (-2329.930) -- 0:03:09
      341000 -- (-2334.021) (-2331.454) (-2332.983) [-2331.192] * [-2330.670] (-2332.987) (-2331.888) (-2337.535) -- 0:03:09
      341500 -- (-2329.372) (-2337.106) [-2333.385] (-2335.110) * (-2335.307) [-2332.000] (-2334.676) (-2329.512) -- 0:03:08
      342000 -- (-2340.386) (-2334.819) (-2331.369) [-2333.312] * (-2331.728) [-2331.942] (-2335.485) (-2339.742) -- 0:03:08
      342500 -- (-2336.988) (-2337.471) [-2332.377] (-2331.038) * [-2333.858] (-2335.631) (-2336.730) (-2330.574) -- 0:03:08
      343000 -- (-2328.982) (-2344.659) (-2328.288) [-2333.729] * (-2332.152) [-2331.201] (-2332.968) (-2334.418) -- 0:03:09
      343500 -- (-2336.107) (-2331.569) (-2330.500) [-2334.566] * [-2327.266] (-2331.777) (-2340.522) (-2328.783) -- 0:03:09
      344000 -- [-2331.617] (-2336.428) (-2335.830) (-2335.321) * (-2324.457) (-2330.812) (-2335.941) [-2327.989] -- 0:03:08
      344500 -- (-2337.299) [-2328.415] (-2329.870) (-2336.498) * [-2338.352] (-2332.529) (-2335.779) (-2342.680) -- 0:03:08
      345000 -- (-2332.999) [-2332.737] (-2334.995) (-2338.326) * (-2330.744) (-2334.181) [-2339.545] (-2334.625) -- 0:03:07

      Average standard deviation of split frequencies: 0.000454

      345500 -- (-2326.632) (-2336.256) [-2329.654] (-2332.429) * (-2336.259) [-2328.177] (-2337.482) (-2331.199) -- 0:03:07
      346000 -- (-2327.772) (-2334.074) (-2333.621) [-2331.082] * (-2328.314) (-2335.576) [-2331.645] (-2335.549) -- 0:03:07
      346500 -- [-2333.837] (-2333.898) (-2336.434) (-2339.973) * [-2330.803] (-2329.574) (-2328.436) (-2333.430) -- 0:03:08
      347000 -- [-2332.635] (-2337.592) (-2333.204) (-2340.696) * [-2330.155] (-2333.244) (-2336.531) (-2332.226) -- 0:03:08
      347500 -- (-2335.449) [-2335.740] (-2339.821) (-2332.446) * (-2332.944) (-2335.957) (-2338.152) [-2334.358] -- 0:03:07
      348000 -- (-2340.823) (-2336.612) (-2331.669) [-2337.129] * (-2334.142) [-2332.795] (-2336.330) (-2335.593) -- 0:03:07
      348500 -- (-2330.102) (-2337.084) (-2343.001) [-2329.560] * (-2331.711) [-2330.909] (-2333.051) (-2330.790) -- 0:03:06
      349000 -- (-2339.824) (-2333.889) [-2337.326] (-2328.499) * [-2334.491] (-2335.128) (-2338.217) (-2335.158) -- 0:03:06
      349500 -- (-2338.402) (-2340.259) (-2332.846) [-2332.664] * [-2329.331] (-2334.501) (-2333.868) (-2333.113) -- 0:03:06
      350000 -- [-2337.927] (-2338.510) (-2335.466) (-2330.891) * [-2330.912] (-2334.352) (-2330.784) (-2333.229) -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-2336.124) (-2335.224) [-2330.924] (-2331.808) * (-2334.467) (-2338.340) (-2329.235) [-2330.102] -- 0:03:07
      351000 -- (-2334.716) (-2343.122) [-2329.577] (-2344.321) * (-2337.864) (-2336.167) (-2329.520) [-2335.014] -- 0:03:06
      351500 -- (-2330.344) (-2334.359) [-2331.010] (-2341.390) * [-2332.979] (-2332.166) (-2334.818) (-2338.716) -- 0:03:06
      352000 -- (-2330.306) (-2334.210) (-2332.848) [-2332.555] * (-2337.371) [-2331.391] (-2329.475) (-2348.026) -- 0:03:05
      352500 -- (-2333.814)