--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 15:57:05 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip102B-PE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2328.71         -2343.40
2      -2328.93         -2339.85
--------------------------------------
TOTAL    -2328.81         -2342.74
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.641699    0.006386    0.494832    0.799398    0.633546   1009.88   1097.94    1.000
r(A<->C){all}   0.103335    0.000926    0.043510    0.160261    0.101553    848.57    859.66    1.000
r(A<->G){all}   0.264076    0.001728    0.181518    0.343528    0.262619   1041.16   1064.74    1.001
r(A<->T){all}   0.104110    0.000530    0.059174    0.147743    0.102555   1022.76   1134.23    1.000
r(C<->G){all}   0.051510    0.000473    0.012266    0.095010    0.049343    835.36    955.48    1.000
r(C<->T){all}   0.412077    0.002675    0.314609    0.515493    0.410246    746.78    842.40    1.001
r(G<->T){all}   0.064892    0.000343    0.030103    0.100454    0.063515   1070.69   1106.96    1.001
pi(A){all}      0.276349    0.000188    0.248805    0.302046    0.276139   1220.48   1296.69    1.000
pi(C){all}      0.184561    0.000144    0.160944    0.207078    0.184424   1262.29   1299.33    1.000
pi(G){all}      0.234543    0.000170    0.208137    0.259709    0.234317   1266.92   1290.29    1.000
pi(T){all}      0.304547    0.000205    0.276896    0.333102    0.304280   1229.31   1256.53    1.000
alpha{1,2}      0.056597    0.001220    0.000130    0.117303    0.055029   1209.89   1228.06    1.000
alpha{3}        2.878598    0.812491    1.410330    4.716571    2.744715   1339.34   1384.89    1.000
pinvar{all}     0.210870    0.005840    0.048351    0.348675    0.213041   1196.57   1263.88    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2174.517498
Model 2: PositiveSelection	-2174.517498
Model 0: one-ratio	-2185.115279
Model 3: discrete	-2174.055714
Model 7: beta	-2174.251159
Model 8: beta&w>1	-2174.251203


Model 0 vs 1	21.19556199999988

Model 2 vs 1	0.0

Model 8 vs 7	8.799999977782136E-5
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESRDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESRDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLTPEHQDYSQTIGLSLVLGFVFMMLVDI
SQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVFLA
IMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGIGQ
EQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDYRL
LEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=299 

C1              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C2              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C3              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C4              MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C5              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
C6              MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
                *:******:*****************************************

C1              ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
C2              ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
C3              ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
C4              ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
C5              ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
C6              ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV
                ** ***********:* .  :. *  **: ********************

C1              DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C2              DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C3              DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C4              DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C5              DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
C6              DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
                **.***:*.* :**************************************

C1              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
C2              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
C3              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
C4              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
C5              LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
C6              LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
                *************************:******.********:********

C1              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
C2              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
C3              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
C4              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
C5              GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
C6              GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
                *****:***********************************:::****:*

C1              CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH--
C2              CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
C3              CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
C4              HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo-
C5              HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo-
C6              RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo
                 ******  .*:*  *.**:::******.*:********:**:**:*  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  297 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  297 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9136]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [9136]--->[9092]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip102B-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.352 Mb, Max= 30.716 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo-
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo-
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo

FORMAT of file /tmp/tmp707794067068512794aln Not Supported[FATAL:T-COFFEE]
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH--
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKHo-
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKHo-
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLT--PEHQDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKHoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:299 S:99 BS:299
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.65 C1	 C2	 98.65
TOP	    1    0	 98.65 C2	 C1	 98.65
BOT	    0    2	 98.65 C1	 C3	 98.65
TOP	    2    0	 98.65 C3	 C1	 98.65
BOT	    0    3	 92.57 C1	 C4	 92.57
TOP	    3    0	 92.57 C4	 C1	 92.57
BOT	    0    4	 95.27 C1	 C5	 95.27
TOP	    4    0	 95.27 C5	 C1	 95.27
BOT	    0    5	 90.17 C1	 C6	 90.17
TOP	    5    0	 90.17 C6	 C1	 90.17
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 91.89 C2	 C4	 91.89
TOP	    3    1	 91.89 C4	 C2	 91.89
BOT	    1    4	 94.59 C2	 C5	 94.59
TOP	    4    1	 94.59 C5	 C2	 94.59
BOT	    1    5	 90.17 C2	 C6	 90.17
TOP	    5    1	 90.17 C6	 C2	 90.17
BOT	    2    3	 91.89 C3	 C4	 91.89
TOP	    3    2	 91.89 C4	 C3	 91.89
BOT	    2    4	 94.59 C3	 C5	 94.59
TOP	    4    2	 94.59 C5	 C3	 94.59
BOT	    2    5	 90.17 C3	 C6	 90.17
TOP	    5    2	 90.17 C6	 C3	 90.17
BOT	    3    4	 93.94 C4	 C5	 93.94
TOP	    4    3	 93.94 C5	 C4	 93.94
BOT	    3    5	 89.15 C4	 C6	 89.15
TOP	    5    3	 89.15 C6	 C4	 89.15
BOT	    4    5	 90.51 C5	 C6	 90.51
TOP	    5    4	 90.51 C6	 C5	 90.51
AVG	 0	 C1	  *	 95.06
AVG	 1	 C2	  *	 95.06
AVG	 2	 C3	  *	 95.06
AVG	 3	 C4	  *	 91.89
AVG	 4	 C5	  *	 93.78
AVG	 5	 C6	  *	 90.03
TOT	 TOT	  *	 93.48
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
C2              ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
C3              ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
C4              ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT
C5              ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT
C6              ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT
                ***.****.**.** **:*** * .*:**.***** **************

C1              GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG
C2              GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
C3              GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
C4              GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG
C5              GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG
C6              TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG
                 ***** ** ******** ************ *.********.*******

C1              AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C2              AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C3              AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C4              AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
C5              AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT
C6              AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT
                ****.**.*****************.**.** **:***********:***

C1              GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG
C2              GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT
C3              GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT
C4              GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG
C5              GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG
C6              GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA
                ***** .  *****:**:**.**.** *****.*********.* ** : 

C1              TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC
C2              TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
C3              TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
C4              TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC
C5              TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC
C6              TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC
                **  * *  .*.*.*:* .**:      **.*****.*.*********.*

C1              AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
C2              AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG
C3              AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
C4              AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA
C5              AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
C6              AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG
                *.***** ******** ******** **:** ** ** ********.**.

C1              GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC
C2              GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
C3              GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
C4              GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC
C5              GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC
C6              GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC
                ** ** * :*****.**.*  ****  **** *.* *****.********

C1              CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT
C2              CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
C3              CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
C4              CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT
C5              CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT
C6              CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT
                ***. ******* ******** ** ** ** ***********:** ** *

C1              TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
C2              TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
C3              TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
C4              TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT
C5              TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
C6              TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT
                ****.*****:***** ** ********.** ******************

C1              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT
C2              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT
C3              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT
C4              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT
C5              TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT
C6              TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT
                **.*****************.************** **. *.** **:**

C1              CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
C2              CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
C3              CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
C4              TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT
C5              CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT
C6              CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT
                  **** ** **.**.**:*****.**:********.********:*  *

C1              TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC
C2              TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
C3              TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
C4              TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC
C5              TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC
C6              TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA
                *.*****.*****.**:** ***:******** **** ********.**.

C1              GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC
C2              GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
C3              GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
C4              GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC
C5              GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC
C6              GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC
                **.***********.** ** ***** ** ** ***** ***** **:**

C1              TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT
C2              TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
C3              TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
C4              TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC
C5              TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC
C6              AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT
                :*****.** ** ** *****************:**.***** *****  

C1              TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT
C2              TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
C3              TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
C4              TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT
C5              TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT
C6              TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC
                *******.***** **.******** :*..*.*********** .**** 

C1              TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG
C2              TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
C3              TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
C4              CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG
C5              CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG
C6              CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA
                 .* *.*********** **    *:** *** .**** ::.:.****..

C1              CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG
C2              TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
C3              TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
C4              CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG
C5              CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG
C6              TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG
                 ***** .*:**. *: ************** *. *:***.******* *

C1              GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------
C2              GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
C3              GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
C4              GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------
C5              GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------
C6              GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------
                * **.***** ** **..*******: ********** ***      



>C1
ATGGCTGAGGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
GGGGTCTTATTTGGCAGGGAGCATACCGATGCTGATGAAATTAAGCGAGG
AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGAG
TGGCCAATCCCAAAAACGGACATCAGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
GACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCAT
TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGATTAGTGACATT
CTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGGATC
GGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGCCACTGGTATAGC
TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTGCATGTTT
TACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGATCAGCATGATTAT
TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATATAAATGGAAG
CAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAATTCTGATTTGCG
GCGCACTGCTACCCCTAATTATAACATTTGGACATAATCAC------
>C2
ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTGGGGTT
TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTTTTCATGATGTTGGTG
GATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTCACATT
CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
TAATAGTATACAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
>C3
ATGGCTGAAGAGACAATAATTCTCATTTTATTAGTGTTGGTTATGCTTGT
GGGGTCTTATTTGGCAGGGAGCATACCGATGTTGATGAAATTAAGCGAGG
AAAAGCTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTCGTTGTTATTATTCCGGAGGGCATTCGATCATTGTATGTTGGGTT
TGGCCAATCCCAAAAACGGACATCGGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCTCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
GATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTGATGGAGTTGCAT
TGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGATTAGTGACATT
CCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCAGACACCTAGTCT
TATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACGTATTTTGGAATC
GGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGCCACTGGTATAGC
TATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTT
TACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGATCAGCATGATTAT
TGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGATTTGAATGGAAG
TAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAATTCTGATTTGCG
GCGCACTGCTTCCCCTAATTATAACATTTGGACATAATCAC------
>C4
ATGACTGAGGAGACGATAATTTTAGTTTTATTAGTGTTGGTTATGCTTGT
GGGGTCGTATTTGGCAGGTAGCATACCGATGTTAATGAAATTAAGCGAGG
AAAAACTAAAATGTGTCACTGTGCTGGGAGCTGGATTGTTAGTGGGAACT
GCTCTAATCGTTATTATACCGGAGGGTATTCGCTCATTGTATGTTGGGAG
TGCGCCATTCCGAAATCTAACATCGGTTCCGGAGCAACCAGATTACTCAC
AGACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTTATGATGTTGGTA
GACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAAAAAAAACAATGC
CACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTGATGGAGTTGCGT
TGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGGGTTAGTGACTTT
TTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTTGTGT
TGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACGTATTTTGGAATC
GGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGCTACTGGTATAGC
TATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTTCATGTTC
TACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGATCAGCACAATTAT
CATTTGCTAGAGGAATCTCGT---GATGCTACGCATGATATAAATGGAGG
CAATAGTATACAAGCATTAAAATATAGTGAATTGGTTATTATGATTTGCG
GTGCACTGCTTCCGCTGATTATAACACTTGGACATAAGCAC------
>C5
ATGGCTGAGGAGACAATAATTCTCATATTATTAGTGTTGGTTATGCTTGT
GGGGTCGTATTTGGCAGGTAGCATACCGATGTTGATGAAATTAAGCGAGG
AAAAACTAAAATGTGTCACTGTGCTAGGAGCTGGATTGTTAGTGGGAACT
GCTCTAGTCGTTATTATACCAGAGGGTATTCGATCATTGTATGTCGGGAG
TGCACAATCCCAAAATCGAACATCGGCTCCGGAGCAACCAGATTACTCAC
AAACCATTGGACTTTCCCTTGTGCTTGGATTTGTCTTCATGATGTTGGTG
GACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAAAAAAAACAATGC
CACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTGATGGAGTTGCGT
TGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAGATAATTGTATTT
TTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGGGTTAGTGACTTT
CCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCAGACACCTAGTCT
TGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACTTATTTTGGAATC
GGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGCCACTGGTATTGC
TATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAACTGTCCATGTTC
TACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGATCAGCATGATTAT
CATCTGCTAGAGGAATCCCGC---GATGCTACGAATGACATATGTGGAGG
CAATAGTATACAATCATTAAAATATAGTGAATTGTTTATTATGATTTGCG
GTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAGCAC------
>C6
ATGGCTGAAGAAACCATTATTCTTATTTTGTTAGTTTTGGTTATGCTTGT
TGGGTCGTACTTGGCAGGGAGCATACCGATGCTAATGAAATTGAGCGAGG
AAAAGCTCAAATGTGTCACTGTGCTGGGCGCCGGTTTGTTAGTGGGTACT
GCTCTTGCCGTTATAATACCAGAAGGTATTCGATCATTGTATATGGGTAA
TGGGCGACCACAAGATCTGACT------CCAGAGCACCAAGATTACTCGC
AGACCATCGGACTTTCTCTTGTGCTGGGTTTCGTCTTCATGATGTTAGTG
GACATATCACAGCGGAAAAGCAATGTCGGAAGTGACAAAAAGAACAATGC
CACCTTAACTCTCGGATTGGTGGTCCATGCTGCAGCTGATGGTGTGGCTT
TGGGGGCAGCAGCCACGACCAGCCATCAGGACGTTGAGATAATTGTATTT
TTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGGGCTGGTAACTTT
CTTACTGCATGAGAAGGTTGACAGGCAACAAATTCGAAGACACCTAGCAT
TGTTTTCCCTGTCAGCACCTCTTTTGACTATTTTAACGTATTTTGGAATA
GGCCAGGAGCAGAAGGAAACGTTAAATTCTGTTAATGCCACTGGGATAGC
AATGCTATTTTCGGCCGGAACATTTTTGTACGTTGCCACTGTTCATGTCT
TACCAGAACTTACCCAGGGGGGATTATCACAGAGCGATCAGCATGATTAC
CGTTTACTAGAGGAATCTCGAGATGTTGTTACTAATGACAAAAGTGGAAA
TAATAGCCTACACGCTTTAAAATATAGTGAACTAATAATTATGATTTGTG
GTGCGCTGCTCCCGCTAGTTATAACATTTGGACATAAGCAC------
>C1
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSDQHDY
CLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHNH
>C2
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C3
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGFGQSQKRTSVPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
CLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHNH
>C4
MTEETIILVLLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALIVIIPEGIRSLYVGSAPFRNLTSVPEQPDYSQTIGLSLVLGFVFMMLV
DICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSDQHNY
HLLEESRoDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH
>C5
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALVVIIPEGIRSLYVGSAQSQNRTSAPEQPDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILTYFGI
GQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSDQHDY
HLLEESRoDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH
>C6
MAEETIILILLVLVMLVGSYLAGSIPMLMKLSEEKLKCVTVLGAGLLVGT
ALAVIIPEGIRSLYMGNGRPQDLTooPEHQDYSQTIGLSLVLGFVFMMLV
DISQRKSNVGSDKKNNATLTLGLVVHAAADGVALGAAATTSHQDVEIIVF
LAIMLHKAPAAFGLVTFLLHEKVDRQQIRRHLALFSLSAPLLTILTYFGI
GQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSQSDQHDY
RLLEESRDVVTNDKSGNNSLHALKYSELIIMICGALLPLVITFGHKH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 897 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481298636
      Setting output file names to "/opt/ADOPS/443/Zip102B-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1127309282
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1118008148
      Seed = 155159819
      Swapseed = 1481298636
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 32 unique site patterns
      Division 2 has 26 unique site patterns
      Division 3 has 80 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2972.238347 -- -24.965149
         Chain 2 -- -2976.821471 -- -24.965149
         Chain 3 -- -2842.626199 -- -24.965149
         Chain 4 -- -2972.238347 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2976.875121 -- -24.965149
         Chain 2 -- -2952.244694 -- -24.965149
         Chain 3 -- -2881.130189 -- -24.965149
         Chain 4 -- -2869.439476 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2972.238] (-2976.821) (-2842.626) (-2972.238) * [-2976.875] (-2952.245) (-2881.130) (-2869.439) 
        500 -- (-2420.758) (-2424.742) [-2406.915] (-2418.611) * (-2415.386) [-2417.072] (-2409.061) (-2410.398) -- 0:00:00
       1000 -- (-2411.088) (-2414.373) [-2393.106] (-2399.566) * (-2403.023) (-2400.525) (-2392.677) [-2387.952] -- 0:00:00
       1500 -- (-2391.131) (-2395.573) [-2385.305] (-2379.243) * (-2381.830) (-2392.304) (-2369.456) [-2340.934] -- 0:00:00
       2000 -- (-2372.632) (-2381.727) [-2353.287] (-2377.729) * (-2355.430) (-2363.376) (-2362.107) [-2334.830] -- 0:00:00
       2500 -- [-2362.328] (-2360.682) (-2335.828) (-2363.137) * (-2351.124) (-2361.176) (-2347.875) [-2334.549] -- 0:00:00
       3000 -- (-2352.243) (-2361.666) [-2334.930] (-2346.836) * (-2334.050) (-2343.984) (-2335.009) [-2337.866] -- 0:00:00
       3500 -- (-2351.097) (-2341.004) [-2334.142] (-2340.412) * (-2336.367) (-2338.544) [-2333.026] (-2330.110) -- 0:04:44
       4000 -- (-2349.857) [-2339.302] (-2332.164) (-2349.236) * (-2333.416) (-2329.962) [-2331.012] (-2333.394) -- 0:04:09
       4500 -- (-2351.014) (-2342.225) (-2337.633) [-2336.970] * [-2330.038] (-2337.218) (-2328.651) (-2341.875) -- 0:03:41
       5000 -- (-2341.908) (-2335.031) (-2331.342) [-2335.458] * (-2337.466) (-2331.937) (-2330.416) [-2331.283] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-2340.755] (-2333.478) (-2331.653) (-2335.800) * (-2338.052) (-2332.228) (-2338.521) [-2328.311] -- 0:03:00
       6000 -- [-2337.571] (-2335.648) (-2336.369) (-2339.123) * [-2332.279] (-2330.602) (-2333.978) (-2330.071) -- 0:02:45
       6500 -- (-2337.342) (-2331.967) (-2331.498) [-2336.523] * (-2340.733) (-2330.763) [-2337.926] (-2345.569) -- 0:02:32
       7000 -- (-2335.050) (-2336.984) (-2336.624) [-2334.010] * (-2331.454) (-2334.000) [-2341.052] (-2337.919) -- 0:04:43
       7500 -- (-2343.439) (-2338.518) [-2331.878] (-2335.112) * (-2338.701) (-2329.706) (-2332.355) [-2329.927] -- 0:04:24
       8000 -- (-2336.001) (-2330.769) [-2328.628] (-2332.148) * (-2335.918) (-2329.714) [-2336.967] (-2333.769) -- 0:04:08
       8500 -- (-2332.983) (-2332.486) (-2333.777) [-2332.675] * (-2336.657) (-2329.926) [-2333.529] (-2332.146) -- 0:03:53
       9000 -- [-2329.112] (-2329.409) (-2333.123) (-2332.037) * (-2334.796) (-2340.269) [-2328.879] (-2334.127) -- 0:03:40
       9500 -- (-2330.562) [-2338.451] (-2333.003) (-2332.071) * [-2336.627] (-2340.918) (-2334.823) (-2338.800) -- 0:03:28
      10000 -- (-2332.801) (-2329.216) [-2336.464] (-2327.801) * (-2337.505) (-2331.815) (-2337.197) [-2333.385] -- 0:03:18

      Average standard deviation of split frequencies: 0.014731

      10500 -- (-2341.587) (-2338.801) [-2331.039] (-2335.323) * (-2333.826) (-2336.281) [-2332.435] (-2329.176) -- 0:04:42
      11000 -- [-2329.917] (-2334.661) (-2348.434) (-2333.979) * (-2334.846) (-2330.957) [-2335.965] (-2332.067) -- 0:04:29
      11500 -- [-2329.107] (-2333.650) (-2331.664) (-2335.074) * [-2335.117] (-2335.103) (-2340.641) (-2333.766) -- 0:04:17
      12000 -- (-2331.633) (-2339.790) [-2333.252] (-2331.583) * [-2328.576] (-2329.070) (-2328.804) (-2331.426) -- 0:04:07
      12500 -- (-2342.631) (-2333.946) (-2338.108) [-2331.405] * (-2330.820) (-2329.675) [-2333.217] (-2332.534) -- 0:03:57
      13000 -- (-2332.553) (-2339.403) (-2335.437) [-2327.914] * (-2328.858) (-2330.801) [-2334.481] (-2336.458) -- 0:03:47
      13500 -- (-2333.207) (-2334.928) (-2329.469) [-2331.504] * (-2331.936) (-2331.787) (-2332.323) [-2329.482] -- 0:03:39
      14000 -- [-2328.375] (-2341.508) (-2331.354) (-2331.919) * [-2328.358] (-2334.418) (-2331.041) (-2329.648) -- 0:04:41
      14500 -- [-2330.899] (-2339.263) (-2336.604) (-2334.484) * (-2333.642) (-2338.592) [-2334.534] (-2329.601) -- 0:04:31
      15000 -- [-2330.577] (-2339.856) (-2331.616) (-2332.363) * (-2331.361) (-2330.962) [-2332.975] (-2327.991) -- 0:04:22

      Average standard deviation of split frequencies: 0.009821

      15500 -- (-2331.509) (-2330.762) [-2330.068] (-2335.689) * (-2335.088) (-2333.047) [-2333.012] (-2340.076) -- 0:04:14
      16000 -- (-2333.376) (-2332.019) [-2336.501] (-2335.944) * [-2340.576] (-2345.685) (-2331.672) (-2332.597) -- 0:04:06
      16500 -- [-2334.042] (-2343.391) (-2339.645) (-2329.376) * (-2345.018) [-2330.515] (-2343.756) (-2330.006) -- 0:03:58
      17000 -- [-2329.135] (-2336.900) (-2339.635) (-2332.825) * (-2334.320) (-2332.474) (-2336.697) [-2330.797] -- 0:03:51
      17500 -- (-2327.260) (-2333.240) (-2335.022) [-2330.398] * (-2330.934) [-2330.386] (-2336.641) (-2334.963) -- 0:04:40
      18000 -- [-2329.865] (-2332.191) (-2332.427) (-2334.008) * (-2342.617) (-2336.259) [-2338.413] (-2335.607) -- 0:04:32
      18500 -- [-2332.779] (-2331.846) (-2331.400) (-2333.808) * (-2338.485) (-2327.222) [-2335.151] (-2337.740) -- 0:04:25
      19000 -- (-2333.239) (-2334.257) (-2332.800) [-2338.087] * (-2330.245) (-2329.026) [-2329.658] (-2344.108) -- 0:04:18
      19500 -- (-2330.372) (-2331.415) [-2334.627] (-2328.413) * [-2330.723] (-2333.865) (-2328.039) (-2337.830) -- 0:04:11
      20000 -- [-2329.947] (-2328.622) (-2332.443) (-2337.769) * [-2331.408] (-2328.701) (-2338.297) (-2329.994) -- 0:04:05

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-2335.368) (-2328.283) (-2335.583) [-2328.609] * [-2330.172] (-2338.657) (-2346.321) (-2334.635) -- 0:03:58
      21000 -- (-2330.231) (-2337.312) (-2334.798) [-2331.901] * [-2328.773] (-2336.620) (-2333.759) (-2339.907) -- 0:04:39
      21500 -- (-2331.247) (-2338.410) (-2338.340) [-2335.209] * (-2335.573) (-2332.294) [-2335.695] (-2326.039) -- 0:04:33
      22000 -- (-2332.402) (-2335.971) (-2333.369) [-2340.397] * [-2332.665] (-2331.642) (-2337.445) (-2339.790) -- 0:04:26
      22500 -- [-2331.239] (-2335.854) (-2334.292) (-2333.935) * [-2332.869] (-2334.641) (-2334.034) (-2332.296) -- 0:04:20
      23000 -- (-2332.302) (-2328.060) (-2338.999) [-2329.367] * (-2333.180) [-2327.593] (-2329.203) (-2342.393) -- 0:04:14
      23500 -- (-2335.247) [-2337.009] (-2334.169) (-2325.690) * (-2331.046) (-2335.713) (-2337.601) [-2330.191] -- 0:04:09
      24000 -- (-2337.161) [-2335.517] (-2334.043) (-2332.948) * (-2328.961) [-2333.383] (-2333.244) (-2334.915) -- 0:04:04
      24500 -- (-2341.989) (-2331.891) [-2329.196] (-2326.846) * [-2336.653] (-2332.725) (-2341.185) (-2331.290) -- 0:04:38
      25000 -- (-2334.005) [-2328.252] (-2331.882) (-2335.824) * (-2336.369) [-2332.707] (-2332.604) (-2333.808) -- 0:04:33

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-2331.706) (-2329.575) (-2330.573) [-2335.390] * (-2336.316) (-2340.395) [-2327.833] (-2332.434) -- 0:04:27
      26000 -- (-2330.180) (-2332.260) [-2332.456] (-2336.235) * (-2331.839) (-2345.411) [-2332.273] (-2329.314) -- 0:04:22
      26500 -- (-2328.741) (-2332.261) (-2328.905) [-2332.834] * [-2334.419] (-2341.239) (-2332.991) (-2335.705) -- 0:04:17
      27000 -- (-2335.045) (-2331.974) (-2328.167) [-2332.813] * (-2328.482) [-2332.146] (-2329.072) (-2339.288) -- 0:04:12
      27500 -- [-2331.216] (-2334.813) (-2329.292) (-2338.996) * (-2337.514) (-2344.635) [-2331.011] (-2332.333) -- 0:04:07
      28000 -- (-2333.191) (-2330.085) (-2334.418) [-2324.255] * [-2327.505] (-2334.863) (-2335.308) (-2332.310) -- 0:04:37
      28500 -- [-2327.163] (-2331.047) (-2330.283) (-2328.010) * (-2330.858) [-2336.576] (-2333.950) (-2329.778) -- 0:04:32
      29000 -- (-2335.110) (-2335.135) [-2331.587] (-2329.637) * (-2332.714) (-2330.735) [-2333.193] (-2333.045) -- 0:04:27
      29500 -- (-2338.340) (-2341.283) [-2330.998] (-2330.232) * (-2332.620) [-2327.184] (-2326.333) (-2330.551) -- 0:04:23
      30000 -- (-2331.706) (-2333.909) [-2337.091] (-2335.862) * (-2335.830) (-2332.604) (-2324.636) [-2332.862] -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-2331.917) (-2330.359) [-2331.602] (-2325.878) * (-2330.961) [-2334.287] (-2329.300) (-2335.571) -- 0:04:14
      31000 -- (-2335.738) (-2333.408) (-2333.931) [-2334.733] * (-2339.398) (-2332.754) [-2336.220] (-2335.997) -- 0:04:10
      31500 -- (-2334.181) [-2336.579] (-2337.893) (-2336.566) * (-2328.426) (-2336.347) (-2331.569) [-2333.010] -- 0:04:36
      32000 -- (-2338.022) (-2334.553) [-2332.472] (-2336.320) * (-2328.463) (-2333.295) [-2330.841] (-2339.198) -- 0:04:32
      32500 -- (-2331.679) (-2329.216) [-2330.516] (-2333.997) * (-2340.745) (-2327.037) [-2329.627] (-2331.925) -- 0:04:27
      33000 -- [-2333.454] (-2331.609) (-2329.361) (-2336.892) * (-2332.381) (-2335.241) (-2334.397) [-2331.842] -- 0:04:23
      33500 -- (-2337.646) (-2335.317) (-2336.717) [-2338.148] * (-2330.734) (-2334.140) (-2334.781) [-2333.581] -- 0:04:19
      34000 -- (-2337.962) (-2333.851) [-2333.324] (-2333.106) * (-2335.946) [-2333.418] (-2330.341) (-2332.036) -- 0:04:15
      34500 -- (-2334.634) [-2332.270] (-2330.502) (-2335.014) * (-2335.085) (-2328.168) [-2328.769] (-2334.134) -- 0:04:11
      35000 -- (-2340.163) [-2334.018] (-2340.036) (-2338.840) * (-2331.541) (-2332.899) (-2339.655) [-2329.573] -- 0:04:35

      Average standard deviation of split frequencies: 0.004365

      35500 -- (-2337.602) (-2331.074) (-2335.825) [-2331.954] * (-2328.870) (-2333.035) (-2334.296) [-2329.236] -- 0:04:31
      36000 -- (-2335.786) (-2333.258) (-2337.230) [-2333.591] * (-2328.007) (-2333.896) (-2331.834) [-2331.946] -- 0:04:27
      36500 -- (-2333.689) [-2328.733] (-2333.062) (-2329.708) * (-2324.764) [-2329.448] (-2345.988) (-2330.855) -- 0:04:23
      37000 -- [-2335.751] (-2331.893) (-2333.714) (-2330.115) * (-2328.287) [-2331.617] (-2338.282) (-2335.263) -- 0:04:20
      37500 -- (-2332.546) [-2330.992] (-2332.726) (-2331.204) * (-2328.710) [-2329.269] (-2336.216) (-2335.445) -- 0:04:16
      38000 -- [-2331.897] (-2327.606) (-2331.103) (-2334.104) * (-2327.416) [-2329.317] (-2332.567) (-2330.976) -- 0:04:13
      38500 -- (-2330.362) [-2326.507] (-2333.629) (-2337.099) * (-2331.035) (-2333.572) [-2335.519] (-2327.082) -- 0:04:34
      39000 -- (-2331.216) [-2330.465] (-2335.427) (-2336.622) * [-2336.456] (-2329.899) (-2333.300) (-2331.906) -- 0:04:31
      39500 -- (-2336.940) [-2340.234] (-2340.708) (-2334.160) * (-2337.751) (-2330.175) (-2330.955) [-2337.940] -- 0:04:27
      40000 -- (-2329.258) (-2336.148) [-2330.910] (-2334.961) * (-2337.295) [-2333.466] (-2335.563) (-2335.709) -- 0:04:24

      Average standard deviation of split frequencies: 0.003864

      40500 -- (-2336.908) [-2331.204] (-2332.078) (-2328.778) * (-2338.726) (-2339.155) (-2333.707) [-2338.675] -- 0:04:20
      41000 -- (-2336.990) [-2335.596] (-2332.644) (-2330.597) * (-2334.169) (-2331.717) (-2331.331) [-2329.460] -- 0:04:17
      41500 -- [-2331.182] (-2332.507) (-2326.139) (-2331.577) * (-2335.949) (-2335.565) [-2333.664] (-2329.492) -- 0:04:14
      42000 -- (-2331.204) [-2332.415] (-2332.247) (-2341.898) * [-2331.874] (-2330.931) (-2329.504) (-2335.172) -- 0:04:33
      42500 -- (-2338.747) (-2333.208) (-2331.835) [-2325.475] * [-2337.570] (-2331.615) (-2336.869) (-2341.362) -- 0:04:30
      43000 -- (-2332.557) (-2331.508) [-2330.414] (-2330.919) * (-2330.000) (-2328.759) (-2334.905) [-2331.615] -- 0:04:27
      43500 -- (-2333.144) [-2329.067] (-2335.117) (-2337.685) * (-2330.187) (-2331.431) (-2332.266) [-2333.619] -- 0:04:23
      44000 -- (-2331.955) (-2331.764) (-2335.267) [-2328.757] * (-2330.149) (-2334.953) (-2330.639) [-2332.611] -- 0:04:20
      44500 -- (-2331.499) (-2330.629) (-2333.955) [-2328.833] * (-2329.165) (-2353.316) [-2326.718] (-2336.094) -- 0:04:17
      45000 -- [-2334.781] (-2328.852) (-2337.484) (-2332.205) * (-2330.053) (-2334.987) (-2330.606) [-2335.585] -- 0:04:14

      Average standard deviation of split frequencies: 0.003416

      45500 -- (-2332.390) [-2329.725] (-2340.303) (-2331.866) * [-2331.330] (-2336.976) (-2329.064) (-2330.004) -- 0:04:32
      46000 -- (-2329.080) (-2334.129) (-2333.295) [-2334.759] * [-2330.194] (-2331.290) (-2333.840) (-2338.404) -- 0:04:29
      46500 -- (-2330.723) (-2332.492) [-2335.937] (-2340.333) * (-2328.033) [-2332.819] (-2340.611) (-2342.360) -- 0:04:26
      47000 -- (-2330.477) (-2335.398) (-2338.435) [-2342.287] * [-2335.084] (-2344.608) (-2330.873) (-2341.280) -- 0:04:23
      47500 -- [-2335.991] (-2331.581) (-2327.794) (-2336.236) * (-2331.698) [-2335.887] (-2332.377) (-2340.923) -- 0:04:20
      48000 -- (-2333.226) (-2337.757) [-2334.535] (-2334.286) * [-2332.947] (-2332.129) (-2337.620) (-2341.766) -- 0:04:17
      48500 -- (-2328.674) (-2337.258) [-2333.915] (-2336.369) * [-2334.502] (-2341.105) (-2340.450) (-2331.412) -- 0:04:15
      49000 -- [-2333.696] (-2338.234) (-2337.686) (-2333.039) * [-2326.037] (-2329.811) (-2335.070) (-2330.985) -- 0:04:31
      49500 -- (-2334.687) (-2333.893) [-2335.960] (-2340.044) * [-2333.715] (-2335.363) (-2343.748) (-2328.424) -- 0:04:28
      50000 -- (-2329.522) (-2347.797) [-2335.948] (-2338.788) * [-2329.111] (-2342.230) (-2333.085) (-2331.019) -- 0:04:26

      Average standard deviation of split frequencies: 0.009304

      50500 -- [-2328.519] (-2332.040) (-2336.153) (-2331.304) * (-2332.654) (-2334.068) (-2334.327) [-2330.382] -- 0:04:23
      51000 -- [-2335.180] (-2334.557) (-2331.647) (-2333.989) * (-2331.849) (-2340.027) [-2336.312] (-2333.342) -- 0:04:20
      51500 -- (-2329.414) (-2332.851) (-2334.788) [-2331.346] * (-2329.675) (-2334.998) (-2341.220) [-2337.086] -- 0:04:17
      52000 -- [-2340.755] (-2334.627) (-2340.421) (-2337.569) * [-2332.870] (-2337.259) (-2330.853) (-2332.489) -- 0:04:15
      52500 -- [-2333.491] (-2331.356) (-2334.472) (-2335.724) * [-2331.615] (-2332.294) (-2332.329) (-2333.451) -- 0:04:30
      53000 -- (-2339.696) [-2333.262] (-2325.693) (-2329.904) * (-2343.144) (-2335.521) [-2335.355] (-2331.482) -- 0:04:28
      53500 -- [-2328.757] (-2341.094) (-2325.902) (-2341.457) * (-2327.869) (-2332.080) (-2338.439) [-2347.753] -- 0:04:25
      54000 -- (-2336.110) (-2335.872) [-2328.705] (-2330.043) * (-2339.366) (-2327.804) [-2332.150] (-2334.357) -- 0:04:22
      54500 -- (-2334.185) (-2335.493) [-2340.811] (-2340.663) * [-2334.934] (-2331.145) (-2334.161) (-2332.607) -- 0:04:20
      55000 -- (-2334.677) (-2330.427) (-2339.569) [-2329.627] * (-2341.461) [-2328.376] (-2336.424) (-2335.439) -- 0:04:17

      Average standard deviation of split frequencies: 0.008418

      55500 -- (-2333.013) (-2332.622) (-2333.831) [-2336.216] * (-2333.022) (-2329.233) (-2333.891) [-2334.446] -- 0:04:15
      56000 -- [-2333.323] (-2330.694) (-2342.551) (-2340.092) * (-2326.409) [-2328.978] (-2332.465) (-2334.534) -- 0:04:29
      56500 -- (-2334.374) [-2337.320] (-2338.517) (-2336.913) * [-2329.625] (-2329.097) (-2328.269) (-2332.855) -- 0:04:27
      57000 -- (-2335.515) (-2340.310) (-2336.554) [-2329.318] * [-2326.918] (-2333.182) (-2330.113) (-2328.963) -- 0:04:24
      57500 -- (-2327.924) [-2331.110] (-2338.302) (-2331.167) * (-2334.599) (-2332.300) [-2331.691] (-2335.348) -- 0:04:22
      58000 -- (-2329.500) (-2342.160) [-2329.325] (-2335.971) * [-2331.356] (-2329.581) (-2338.734) (-2334.589) -- 0:04:19
      58500 -- [-2325.313] (-2332.918) (-2344.186) (-2329.147) * [-2332.913] (-2326.254) (-2340.298) (-2334.472) -- 0:04:17
      59000 -- [-2326.469] (-2334.488) (-2336.536) (-2330.629) * (-2333.810) [-2331.796] (-2333.638) (-2337.894) -- 0:04:15
      59500 -- [-2329.653] (-2326.905) (-2331.630) (-2335.894) * [-2337.330] (-2326.130) (-2330.169) (-2331.410) -- 0:04:28
      60000 -- (-2330.953) (-2340.506) [-2333.001] (-2332.616) * (-2341.816) (-2327.398) [-2334.515] (-2343.904) -- 0:04:26

      Average standard deviation of split frequencies: 0.007770

      60500 -- (-2329.669) (-2332.739) [-2336.804] (-2331.678) * [-2333.134] (-2326.748) (-2338.089) (-2340.366) -- 0:04:23
      61000 -- (-2342.165) (-2333.945) [-2335.283] (-2333.443) * (-2329.602) [-2328.850] (-2333.339) (-2349.150) -- 0:04:21
      61500 -- (-2339.112) (-2337.916) [-2336.564] (-2333.619) * (-2336.945) [-2335.353] (-2339.173) (-2340.003) -- 0:04:19
      62000 -- (-2333.062) (-2331.067) [-2328.860] (-2341.273) * (-2330.514) (-2333.716) [-2343.006] (-2343.036) -- 0:04:17
      62500 -- (-2333.305) (-2331.620) [-2334.123] (-2330.959) * (-2329.559) (-2334.134) (-2347.366) [-2335.862] -- 0:04:15
      63000 -- (-2340.982) [-2328.630] (-2332.777) (-2335.774) * (-2332.565) (-2335.317) [-2332.984] (-2336.134) -- 0:04:27
      63500 -- (-2333.821) (-2333.513) [-2335.738] (-2336.710) * (-2332.962) [-2333.553] (-2340.416) (-2340.692) -- 0:04:25
      64000 -- (-2337.430) [-2330.798] (-2330.538) (-2336.422) * (-2333.370) [-2330.660] (-2341.612) (-2339.577) -- 0:04:23
      64500 -- (-2339.163) [-2334.936] (-2328.829) (-2331.904) * (-2344.732) (-2331.397) [-2332.397] (-2330.399) -- 0:04:21
      65000 -- [-2335.973] (-2337.124) (-2337.576) (-2339.395) * (-2341.861) (-2334.242) (-2338.675) [-2328.197] -- 0:04:18

      Average standard deviation of split frequencies: 0.009523

      65500 -- (-2337.428) (-2329.706) [-2331.233] (-2332.430) * (-2337.783) [-2334.900] (-2333.988) (-2329.849) -- 0:04:16
      66000 -- (-2342.600) (-2334.858) [-2324.961] (-2332.911) * (-2333.205) (-2340.942) [-2333.008] (-2334.259) -- 0:04:14
      66500 -- (-2331.165) (-2329.970) [-2328.950] (-2335.731) * [-2335.519] (-2337.086) (-2331.921) (-2335.546) -- 0:04:26
      67000 -- (-2332.613) (-2337.408) (-2331.061) [-2333.680] * (-2336.711) [-2329.552] (-2328.213) (-2339.662) -- 0:04:24
      67500 -- (-2330.919) (-2330.906) [-2337.661] (-2336.400) * (-2338.965) (-2334.605) (-2338.963) [-2337.822] -- 0:04:22
      68000 -- (-2329.778) (-2335.374) [-2334.150] (-2331.925) * (-2329.868) (-2331.740) [-2333.624] (-2339.595) -- 0:04:20
      68500 -- (-2333.163) (-2338.108) [-2330.140] (-2327.949) * (-2329.727) [-2336.082] (-2331.681) (-2337.255) -- 0:04:18
      69000 -- (-2341.496) (-2328.725) [-2332.511] (-2330.467) * [-2337.413] (-2340.174) (-2331.602) (-2336.686) -- 0:04:16
      69500 -- (-2338.142) (-2333.657) [-2329.546] (-2337.815) * (-2333.062) (-2342.212) (-2328.518) [-2329.103] -- 0:04:14
      70000 -- (-2339.072) [-2332.657] (-2338.913) (-2337.306) * (-2339.027) [-2330.570] (-2330.836) (-2331.065) -- 0:04:25

      Average standard deviation of split frequencies: 0.006671

      70500 -- (-2333.137) (-2334.914) (-2328.849) [-2328.833] * (-2337.469) (-2336.899) [-2331.517] (-2334.256) -- 0:04:23
      71000 -- (-2331.366) (-2328.922) [-2327.262] (-2328.887) * (-2338.403) (-2335.350) [-2333.408] (-2337.292) -- 0:04:21
      71500 -- (-2332.057) (-2335.012) (-2331.273) [-2332.892] * (-2340.955) (-2330.816) [-2336.339] (-2348.833) -- 0:04:19
      72000 -- (-2333.048) [-2333.843] (-2329.191) (-2335.529) * (-2338.595) (-2339.602) [-2331.257] (-2329.186) -- 0:04:17
      72500 -- (-2326.790) (-2336.549) [-2331.844] (-2332.468) * (-2342.949) (-2333.966) [-2336.805] (-2332.237) -- 0:04:15
      73000 -- [-2332.916] (-2338.403) (-2333.581) (-2335.734) * (-2335.326) (-2335.569) (-2335.716) [-2329.408] -- 0:04:13
      73500 -- (-2335.910) (-2335.361) [-2333.815] (-2336.132) * (-2349.697) (-2335.154) [-2328.417] (-2334.006) -- 0:04:24
      74000 -- (-2331.037) [-2333.698] (-2337.102) (-2330.548) * (-2334.394) [-2332.343] (-2332.067) (-2339.363) -- 0:04:22
      74500 -- (-2332.499) (-2335.631) [-2331.893] (-2332.995) * (-2346.918) [-2329.260] (-2335.359) (-2333.839) -- 0:04:20
      75000 -- [-2329.386] (-2339.972) (-2339.009) (-2331.434) * (-2342.949) (-2339.209) [-2335.052] (-2334.276) -- 0:04:19

      Average standard deviation of split frequencies: 0.006203

      75500 -- (-2330.834) (-2327.551) [-2335.782] (-2330.740) * (-2335.747) (-2336.313) [-2333.702] (-2333.495) -- 0:04:17
      76000 -- (-2338.938) [-2331.814] (-2331.404) (-2335.537) * (-2332.657) (-2340.754) (-2337.359) [-2334.721] -- 0:04:15
      76500 -- (-2336.922) (-2332.676) (-2340.410) [-2339.465] * (-2332.782) (-2336.904) [-2334.862] (-2338.441) -- 0:04:13
      77000 -- (-2336.512) (-2335.079) [-2332.564] (-2333.368) * (-2340.332) [-2329.219] (-2331.955) (-2327.535) -- 0:04:23
      77500 -- (-2334.261) (-2333.059) (-2329.829) [-2329.988] * (-2337.761) (-2331.047) (-2332.656) [-2333.687] -- 0:04:21
      78000 -- (-2336.486) (-2330.888) [-2332.966] (-2333.751) * (-2328.737) (-2330.319) (-2332.287) [-2327.610] -- 0:04:20
      78500 -- [-2337.341] (-2337.301) (-2330.557) (-2330.133) * (-2335.357) [-2329.576] (-2331.792) (-2337.269) -- 0:04:18
      79000 -- (-2329.839) (-2334.110) [-2336.229] (-2334.295) * (-2334.243) (-2327.346) (-2331.152) [-2331.545] -- 0:04:16
      79500 -- (-2332.844) [-2330.426] (-2341.091) (-2337.425) * (-2330.069) [-2336.082] (-2332.842) (-2333.819) -- 0:04:14
      80000 -- (-2333.237) [-2330.975] (-2336.751) (-2332.162) * (-2331.315) (-2331.896) (-2330.554) [-2339.229] -- 0:04:13

      Average standard deviation of split frequencies: 0.005844

      80500 -- (-2333.133) (-2333.181) (-2329.665) [-2336.757] * (-2332.354) [-2329.804] (-2328.616) (-2330.367) -- 0:04:22
      81000 -- (-2335.403) [-2333.713] (-2328.302) (-2337.198) * (-2333.825) [-2334.707] (-2333.322) (-2336.456) -- 0:04:20
      81500 -- (-2331.106) (-2331.212) (-2328.119) [-2335.480] * (-2333.651) (-2328.718) [-2332.315] (-2331.274) -- 0:04:19
      82000 -- (-2336.451) (-2337.419) (-2333.136) [-2334.335] * [-2332.673] (-2331.013) (-2340.238) (-2329.926) -- 0:04:17
      82500 -- [-2328.961] (-2329.281) (-2340.795) (-2333.424) * (-2336.852) [-2339.489] (-2339.663) (-2334.122) -- 0:04:15
      83000 -- (-2333.425) [-2327.925] (-2339.291) (-2332.592) * [-2332.241] (-2339.092) (-2330.597) (-2331.419) -- 0:04:14
      83500 -- [-2329.298] (-2337.563) (-2331.628) (-2324.881) * (-2333.073) (-2326.868) (-2329.197) [-2332.870] -- 0:04:12
      84000 -- (-2331.856) (-2328.036) (-2338.498) [-2331.400] * (-2329.165) [-2335.385] (-2335.464) (-2338.284) -- 0:04:21
      84500 -- (-2335.986) (-2334.354) (-2342.737) [-2333.392] * (-2340.695) [-2327.588] (-2329.113) (-2331.651) -- 0:04:20
      85000 -- [-2332.687] (-2333.325) (-2331.976) (-2331.960) * (-2340.598) (-2334.793) [-2332.940] (-2330.414) -- 0:04:18

      Average standard deviation of split frequencies: 0.003654

      85500 -- (-2331.347) (-2334.719) [-2330.862] (-2335.753) * (-2343.221) [-2333.327] (-2334.409) (-2340.607) -- 0:04:16
      86000 -- [-2332.347] (-2327.020) (-2340.435) (-2335.653) * [-2330.721] (-2337.352) (-2336.983) (-2334.052) -- 0:04:15
      86500 -- (-2336.574) [-2333.155] (-2340.750) (-2339.681) * [-2335.750] (-2339.124) (-2342.137) (-2334.026) -- 0:04:13
      87000 -- (-2327.412) (-2331.146) [-2334.910] (-2337.109) * [-2334.585] (-2332.768) (-2328.540) (-2333.655) -- 0:04:11
      87500 -- (-2339.979) (-2335.082) [-2337.140] (-2337.406) * (-2346.934) [-2330.411] (-2336.616) (-2333.223) -- 0:04:20
      88000 -- [-2330.911] (-2334.463) (-2354.983) (-2336.897) * (-2334.727) (-2334.847) [-2331.784] (-2331.297) -- 0:04:19
      88500 -- (-2336.562) [-2330.772] (-2351.636) (-2341.605) * (-2330.905) [-2335.585] (-2330.448) (-2333.639) -- 0:04:17
      89000 -- [-2331.998] (-2332.817) (-2335.930) (-2343.079) * [-2330.036] (-2329.321) (-2332.604) (-2333.755) -- 0:04:15
      89500 -- (-2328.425) (-2331.998) (-2335.568) [-2338.515] * (-2337.007) (-2328.924) [-2331.551] (-2337.145) -- 0:04:14
      90000 -- (-2333.210) [-2331.773] (-2339.947) (-2330.957) * (-2341.192) (-2336.893) (-2334.332) [-2331.648] -- 0:04:12

      Average standard deviation of split frequencies: 0.005199

      90500 -- (-2329.744) (-2335.137) [-2344.743] (-2326.174) * (-2341.330) (-2338.681) [-2329.779] (-2331.879) -- 0:04:11
      91000 -- (-2330.631) (-2352.449) [-2336.093] (-2328.339) * (-2328.252) (-2339.172) [-2331.308] (-2332.463) -- 0:04:19
      91500 -- (-2330.362) [-2332.141] (-2334.431) (-2331.045) * (-2331.851) (-2333.091) [-2330.495] (-2338.255) -- 0:04:18
      92000 -- (-2333.300) (-2332.517) (-2331.182) [-2334.905] * (-2329.987) (-2332.372) (-2330.361) [-2331.674] -- 0:04:16
      92500 -- (-2333.957) (-2341.072) (-2328.991) [-2336.640] * [-2326.645] (-2336.303) (-2335.929) (-2332.570) -- 0:04:15
      93000 -- (-2329.047) [-2329.003] (-2335.040) (-2340.774) * (-2333.225) (-2332.648) [-2336.407] (-2335.275) -- 0:04:13
      93500 -- (-2331.344) [-2333.212] (-2329.622) (-2342.622) * [-2335.084] (-2332.559) (-2336.243) (-2330.921) -- 0:04:12
      94000 -- [-2330.262] (-2328.258) (-2332.492) (-2342.334) * (-2334.199) (-2332.204) (-2331.572) [-2330.819] -- 0:04:10
      94500 -- (-2330.660) (-2338.834) (-2337.323) [-2328.234] * (-2336.379) (-2329.204) (-2334.369) [-2330.711] -- 0:04:18
      95000 -- (-2332.426) (-2330.262) (-2338.078) [-2327.299] * (-2328.097) (-2335.050) (-2336.328) [-2331.442] -- 0:04:17

      Average standard deviation of split frequencies: 0.004910

      95500 -- (-2340.552) (-2340.008) (-2334.058) [-2339.590] * (-2342.006) (-2332.575) (-2327.865) [-2331.647] -- 0:04:15
      96000 -- (-2330.562) (-2325.993) (-2335.301) [-2331.015] * (-2334.381) (-2333.284) [-2333.791] (-2334.772) -- 0:04:14
      96500 -- (-2328.437) [-2332.264] (-2328.882) (-2327.147) * (-2331.109) (-2327.680) (-2329.147) [-2332.130] -- 0:04:12
      97000 -- (-2336.051) (-2336.540) [-2329.070] (-2333.237) * [-2332.258] (-2332.163) (-2334.215) (-2334.460) -- 0:04:11
      97500 -- (-2339.741) (-2332.605) [-2337.810] (-2332.493) * [-2334.134] (-2343.395) (-2331.408) (-2330.844) -- 0:04:09
      98000 -- (-2334.662) [-2336.523] (-2332.243) (-2333.049) * (-2336.424) (-2332.225) [-2325.601] (-2331.385) -- 0:04:17
      98500 -- [-2331.994] (-2333.994) (-2331.344) (-2331.514) * (-2328.806) [-2335.471] (-2332.488) (-2333.782) -- 0:04:16
      99000 -- (-2333.856) (-2334.584) (-2329.715) [-2330.458] * (-2331.922) (-2335.530) (-2337.488) [-2331.925] -- 0:04:14
      99500 -- [-2331.864] (-2325.325) (-2331.125) (-2335.424) * (-2338.881) (-2340.771) (-2335.048) [-2333.672] -- 0:04:13
      100000 -- (-2335.482) (-2334.327) (-2329.584) [-2334.369] * [-2336.113] (-2334.576) (-2333.942) (-2340.746) -- 0:04:11

      Average standard deviation of split frequencies: 0.006244

      100500 -- (-2338.914) (-2336.891) (-2329.291) [-2333.778] * (-2335.029) [-2334.220] (-2335.408) (-2332.301) -- 0:04:10
      101000 -- (-2345.594) (-2332.156) [-2328.637] (-2334.065) * (-2331.522) (-2338.495) [-2331.641] (-2338.125) -- 0:04:09
      101500 -- [-2328.338] (-2333.662) (-2328.083) (-2334.966) * (-2332.832) (-2343.860) (-2334.148) [-2327.494] -- 0:04:16
      102000 -- (-2334.075) (-2333.703) (-2338.955) [-2334.175] * (-2332.454) (-2334.060) [-2333.169] (-2333.452) -- 0:04:15
      102500 -- (-2333.528) (-2327.205) (-2336.110) [-2329.989] * (-2343.262) [-2330.408] (-2332.189) (-2327.634) -- 0:04:13
      103000 -- [-2331.526] (-2333.732) (-2345.160) (-2332.869) * [-2331.641] (-2342.131) (-2331.244) (-2332.497) -- 0:04:12
      103500 -- (-2334.676) [-2328.639] (-2338.788) (-2334.418) * [-2337.154] (-2335.387) (-2330.790) (-2341.298) -- 0:04:11
      104000 -- (-2338.170) [-2327.276] (-2339.200) (-2329.601) * (-2329.553) (-2336.642) (-2338.562) [-2329.409] -- 0:04:09
      104500 -- (-2336.713) [-2333.042] (-2340.147) (-2333.263) * (-2335.443) (-2340.471) (-2347.816) [-2331.533] -- 0:04:08
      105000 -- [-2326.984] (-2331.748) (-2338.150) (-2337.032) * (-2335.319) [-2340.504] (-2333.091) (-2329.379) -- 0:04:15

      Average standard deviation of split frequencies: 0.004447

      105500 -- (-2334.300) (-2327.365) (-2340.864) [-2330.440] * (-2332.127) (-2341.485) (-2331.883) [-2330.462] -- 0:04:14
      106000 -- [-2332.261] (-2325.019) (-2335.940) (-2327.826) * [-2334.830] (-2331.067) (-2333.098) (-2332.106) -- 0:04:13
      106500 -- (-2334.681) [-2326.465] (-2333.807) (-2328.476) * (-2326.913) (-2333.136) [-2327.622] (-2337.901) -- 0:04:11
      107000 -- (-2332.700) [-2334.252] (-2332.075) (-2335.185) * [-2324.174] (-2339.906) (-2331.859) (-2334.708) -- 0:04:10
      107500 -- (-2335.494) (-2331.414) (-2338.438) [-2329.098] * [-2331.305] (-2330.886) (-2334.820) (-2337.942) -- 0:04:09
      108000 -- (-2339.277) (-2331.720) (-2333.242) [-2329.847] * (-2335.993) (-2330.010) (-2334.823) [-2329.426] -- 0:04:07
      108500 -- (-2330.899) [-2329.710] (-2333.184) (-2329.397) * (-2330.486) (-2331.294) [-2331.568] (-2333.382) -- 0:04:14
      109000 -- [-2334.111] (-2335.831) (-2335.242) (-2333.511) * (-2333.930) (-2337.410) [-2334.966] (-2334.845) -- 0:04:13
      109500 -- (-2329.581) (-2335.579) (-2333.334) [-2338.456] * [-2329.421] (-2332.524) (-2331.935) (-2330.601) -- 0:04:12
      110000 -- (-2335.015) [-2331.437] (-2330.065) (-2329.336) * (-2330.213) (-2342.878) [-2329.843] (-2334.255) -- 0:04:10

      Average standard deviation of split frequencies: 0.004260

      110500 -- (-2336.777) (-2334.546) (-2333.435) [-2325.940] * (-2336.464) [-2330.243] (-2328.398) (-2337.284) -- 0:04:09
      111000 -- (-2334.562) (-2334.469) [-2325.944] (-2332.109) * (-2335.164) [-2336.647] (-2334.219) (-2349.484) -- 0:04:08
      111500 -- [-2329.866] (-2327.237) (-2327.717) (-2337.717) * (-2332.107) (-2330.096) [-2337.996] (-2338.297) -- 0:04:07
      112000 -- (-2328.475) [-2331.618] (-2334.823) (-2338.063) * (-2332.783) [-2326.025] (-2328.052) (-2337.059) -- 0:04:13
      112500 -- (-2331.853) (-2336.407) [-2330.934] (-2325.231) * (-2327.606) [-2333.679] (-2333.680) (-2336.162) -- 0:04:12
      113000 -- (-2332.072) (-2336.119) [-2331.170] (-2338.314) * (-2326.550) [-2333.514] (-2337.857) (-2338.040) -- 0:04:11
      113500 -- (-2339.055) (-2334.098) [-2330.830] (-2330.923) * (-2336.238) (-2329.393) [-2333.665] (-2333.166) -- 0:04:09
      114000 -- (-2337.721) [-2329.805] (-2329.956) (-2337.509) * (-2339.072) [-2330.584] (-2332.699) (-2333.534) -- 0:04:08
      114500 -- (-2334.665) [-2328.753] (-2331.075) (-2330.951) * (-2343.145) [-2334.564] (-2336.737) (-2329.973) -- 0:04:07
      115000 -- (-2331.212) (-2331.098) [-2331.944] (-2339.618) * [-2331.760] (-2329.956) (-2337.300) (-2343.293) -- 0:04:06

      Average standard deviation of split frequencies: 0.004064

      115500 -- (-2335.398) (-2333.976) (-2328.544) [-2340.825] * (-2335.138) (-2333.541) [-2333.159] (-2335.052) -- 0:04:12
      116000 -- (-2343.168) (-2328.207) (-2330.758) [-2333.713] * (-2332.171) [-2335.244] (-2342.562) (-2330.455) -- 0:04:11
      116500 -- (-2334.800) [-2335.996] (-2335.012) (-2343.221) * [-2331.191] (-2328.291) (-2341.293) (-2331.761) -- 0:04:10
      117000 -- (-2337.044) [-2331.466] (-2339.841) (-2336.960) * (-2329.633) (-2328.268) (-2333.673) [-2330.814] -- 0:04:09
      117500 -- (-2332.250) (-2329.667) (-2328.995) [-2331.826] * (-2332.735) (-2334.357) (-2334.125) [-2329.514] -- 0:04:07
      118000 -- (-2333.254) (-2331.869) (-2328.122) [-2335.932] * [-2330.859] (-2334.591) (-2333.519) (-2334.042) -- 0:04:06
      118500 -- (-2334.209) [-2329.246] (-2331.316) (-2339.422) * [-2328.613] (-2336.487) (-2332.580) (-2334.581) -- 0:04:05
      119000 -- (-2331.632) [-2330.356] (-2336.790) (-2335.444) * (-2332.004) [-2334.542] (-2331.164) (-2331.365) -- 0:04:11
      119500 -- (-2333.695) (-2328.675) (-2336.907) [-2332.663] * [-2329.790] (-2331.840) (-2338.612) (-2333.058) -- 0:04:10
      120000 -- (-2333.955) [-2331.963] (-2330.366) (-2336.020) * (-2338.118) (-2333.815) [-2331.423] (-2331.439) -- 0:04:09

      Average standard deviation of split frequencies: 0.005209

      120500 -- [-2333.712] (-2337.174) (-2330.338) (-2343.791) * [-2328.348] (-2330.390) (-2339.791) (-2332.714) -- 0:04:08
      121000 -- (-2341.612) [-2330.496] (-2333.839) (-2344.889) * (-2332.655) [-2335.888] (-2336.174) (-2335.792) -- 0:04:06
      121500 -- (-2342.924) (-2333.087) [-2328.481] (-2336.423) * (-2331.783) (-2335.250) (-2335.749) [-2334.370] -- 0:04:05
      122000 -- (-2341.770) [-2337.386] (-2334.510) (-2344.495) * (-2335.063) (-2333.174) [-2334.806] (-2335.393) -- 0:04:04
      122500 -- (-2331.914) (-2331.088) [-2339.703] (-2333.510) * (-2328.816) [-2331.836] (-2329.837) (-2329.997) -- 0:04:10
      123000 -- [-2325.186] (-2336.428) (-2331.903) (-2340.472) * (-2325.804) (-2335.927) [-2335.648] (-2333.822) -- 0:04:09
      123500 -- (-2330.677) [-2328.952] (-2334.759) (-2339.228) * [-2327.834] (-2335.613) (-2335.611) (-2333.676) -- 0:04:08
      124000 -- (-2334.150) (-2334.253) [-2332.474] (-2340.200) * (-2335.439) (-2329.720) (-2330.438) [-2331.199] -- 0:04:07
      124500 -- (-2328.606) (-2343.636) (-2334.559) [-2341.329] * (-2331.712) (-2337.815) [-2331.518] (-2336.403) -- 0:04:06
      125000 -- (-2331.945) (-2331.715) [-2330.772] (-2339.300) * (-2335.707) [-2331.711] (-2333.763) (-2335.775) -- 0:04:04

      Average standard deviation of split frequencies: 0.003741

      125500 -- (-2334.340) [-2336.129] (-2333.435) (-2337.708) * (-2331.597) (-2334.723) (-2332.780) [-2333.248] -- 0:04:03
      126000 -- (-2332.644) (-2331.783) [-2329.568] (-2335.680) * [-2336.890] (-2331.762) (-2331.267) (-2331.714) -- 0:04:09
      126500 -- (-2335.522) (-2334.219) [-2331.706] (-2333.061) * [-2332.638] (-2341.746) (-2331.382) (-2329.427) -- 0:04:08
      127000 -- [-2329.044] (-2337.599) (-2331.607) (-2340.799) * (-2333.110) (-2334.407) (-2329.013) [-2328.179] -- 0:04:07
      127500 -- (-2335.625) (-2332.557) [-2332.184] (-2336.092) * (-2335.465) (-2334.657) [-2331.822] (-2331.706) -- 0:04:06
      128000 -- (-2338.314) (-2333.296) (-2327.296) [-2329.482] * (-2331.857) (-2332.604) [-2327.519] (-2335.321) -- 0:04:05
      128500 -- (-2335.029) (-2331.418) (-2333.683) [-2334.361] * (-2341.382) [-2330.671] (-2335.053) (-2339.973) -- 0:04:04
      129000 -- (-2329.666) (-2338.841) [-2337.249] (-2335.616) * (-2339.646) [-2332.507] (-2331.665) (-2333.617) -- 0:04:03
      129500 -- (-2332.389) (-2337.215) (-2338.996) [-2326.140] * (-2325.499) (-2326.604) (-2333.912) [-2334.875] -- 0:04:08
      130000 -- (-2327.308) (-2332.904) (-2339.137) [-2330.782] * (-2333.783) (-2333.770) [-2333.151] (-2335.273) -- 0:04:07

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-2332.599) [-2331.290] (-2340.835) (-2334.527) * (-2337.828) (-2340.912) (-2342.809) [-2333.019] -- 0:04:06
      131000 -- (-2332.810) (-2330.463) (-2333.398) [-2340.648] * [-2333.283] (-2334.388) (-2330.174) (-2331.117) -- 0:04:05
      131500 -- [-2330.349] (-2331.953) (-2337.678) (-2337.116) * (-2333.784) (-2334.789) (-2327.403) [-2331.288] -- 0:04:04
      132000 -- (-2331.450) (-2338.807) [-2334.622] (-2334.264) * (-2334.336) (-2333.324) (-2339.424) [-2330.463] -- 0:04:03
      132500 -- (-2332.897) [-2335.351] (-2335.353) (-2331.580) * (-2332.503) (-2330.845) (-2328.498) [-2332.262] -- 0:04:02
      133000 -- (-2333.435) (-2331.458) [-2334.728] (-2329.512) * (-2331.501) (-2329.127) [-2334.661] (-2335.075) -- 0:04:07
      133500 -- (-2333.709) (-2330.137) (-2328.930) [-2329.968] * (-2330.055) (-2336.935) (-2335.669) [-2339.747] -- 0:04:06
      134000 -- (-2333.707) (-2337.304) [-2325.044] (-2337.996) * (-2330.456) [-2334.188] (-2328.925) (-2334.239) -- 0:04:05
      134500 -- (-2333.508) (-2335.090) [-2327.055] (-2339.984) * (-2334.652) (-2331.309) (-2329.997) [-2328.853] -- 0:04:04
      135000 -- (-2336.069) (-2337.399) [-2330.955] (-2329.973) * (-2337.134) (-2339.355) (-2330.454) [-2335.199] -- 0:04:03

      Average standard deviation of split frequencies: 0.004622

      135500 -- (-2335.922) (-2337.592) (-2336.677) [-2341.185] * [-2340.026] (-2337.639) (-2331.340) (-2336.266) -- 0:04:02
      136000 -- (-2339.218) (-2339.642) (-2331.552) [-2328.593] * (-2338.316) (-2334.861) (-2327.294) [-2332.945] -- 0:04:01
      136500 -- (-2337.480) (-2337.237) (-2338.057) [-2328.632] * (-2337.299) (-2335.918) [-2330.524] (-2333.712) -- 0:04:06
      137000 -- [-2331.323] (-2339.052) (-2335.906) (-2337.059) * (-2336.191) [-2336.355] (-2333.551) (-2328.313) -- 0:04:05
      137500 -- (-2344.217) (-2335.527) [-2332.749] (-2340.634) * (-2329.804) (-2335.121) (-2335.151) [-2328.510] -- 0:04:04
      138000 -- [-2332.194] (-2338.509) (-2332.589) (-2329.776) * (-2339.647) (-2338.169) (-2333.587) [-2327.569] -- 0:04:03
      138500 -- [-2333.628] (-2329.658) (-2335.729) (-2339.213) * (-2337.873) (-2339.665) [-2330.178] (-2337.194) -- 0:04:02
      139000 -- [-2328.180] (-2331.350) (-2332.339) (-2335.075) * (-2337.189) (-2345.215) [-2328.496] (-2331.555) -- 0:04:01
      139500 -- [-2329.541] (-2335.767) (-2333.001) (-2337.359) * (-2333.717) (-2335.025) [-2329.990] (-2333.053) -- 0:04:06
      140000 -- (-2334.902) (-2338.672) [-2336.769] (-2338.239) * (-2333.577) (-2334.728) [-2330.115] (-2331.540) -- 0:04:05

      Average standard deviation of split frequencies: 0.004468

      140500 -- (-2330.641) (-2330.994) (-2331.316) [-2331.909] * (-2330.708) (-2337.738) [-2328.068] (-2334.480) -- 0:04:04
      141000 -- [-2330.335] (-2330.781) (-2332.628) (-2333.093) * (-2334.858) [-2333.443] (-2338.092) (-2331.602) -- 0:04:03
      141500 -- (-2335.499) [-2327.568] (-2330.997) (-2330.016) * [-2333.700] (-2338.743) (-2333.026) (-2330.922) -- 0:04:02
      142000 -- [-2329.661] (-2330.295) (-2328.796) (-2335.210) * (-2331.825) (-2330.427) [-2331.806] (-2331.549) -- 0:04:01
      142500 -- (-2334.154) [-2331.346] (-2331.004) (-2331.690) * (-2329.594) (-2334.758) (-2337.570) [-2329.351] -- 0:04:00
      143000 -- (-2334.643) (-2333.201) [-2339.153] (-2341.420) * (-2341.208) [-2330.257] (-2333.334) (-2338.308) -- 0:04:05
      143500 -- (-2339.246) (-2330.809) (-2333.511) [-2335.715] * (-2332.090) [-2332.914] (-2335.931) (-2328.290) -- 0:04:04
      144000 -- [-2335.796] (-2335.093) (-2334.284) (-2334.389) * (-2334.461) [-2331.162] (-2335.386) (-2334.684) -- 0:04:03
      144500 -- (-2326.759) (-2337.768) [-2334.929] (-2334.490) * (-2333.155) (-2329.318) (-2342.713) [-2332.583] -- 0:04:02
      145000 -- (-2331.889) (-2332.138) (-2336.026) [-2326.869] * (-2332.938) (-2330.129) (-2329.897) [-2335.539] -- 0:04:01

      Average standard deviation of split frequencies: 0.004305

      145500 -- (-2332.463) (-2337.440) (-2333.995) [-2331.617] * (-2340.079) (-2336.040) (-2332.067) [-2331.586] -- 0:04:00
      146000 -- (-2333.412) (-2334.759) (-2335.952) [-2330.951] * (-2331.278) [-2330.974] (-2328.488) (-2336.544) -- 0:03:59
      146500 -- (-2336.811) (-2334.418) [-2330.954] (-2338.660) * (-2334.467) (-2335.836) (-2327.121) [-2328.209] -- 0:04:04
      147000 -- (-2340.237) (-2332.642) (-2338.500) [-2330.963] * (-2334.559) (-2330.861) (-2327.851) [-2329.237] -- 0:04:03
      147500 -- (-2336.844) [-2331.440] (-2328.929) (-2333.787) * (-2332.687) (-2333.659) (-2337.534) [-2329.784] -- 0:04:02
      148000 -- (-2333.839) (-2334.272) [-2340.802] (-2336.031) * (-2329.618) (-2335.453) (-2336.100) [-2329.118] -- 0:04:01
      148500 -- (-2329.202) (-2330.023) [-2332.991] (-2335.604) * (-2331.739) (-2331.598) (-2333.122) [-2332.605] -- 0:04:00
      149000 -- (-2335.963) (-2329.646) (-2333.099) [-2333.694] * (-2327.442) (-2330.114) [-2330.474] (-2332.861) -- 0:03:59
      149500 -- [-2333.009] (-2333.624) (-2341.598) (-2338.213) * (-2329.009) [-2335.779] (-2329.248) (-2337.316) -- 0:03:58
      150000 -- (-2325.133) (-2335.285) (-2337.935) [-2336.770] * (-2330.488) [-2336.876] (-2335.537) (-2334.503) -- 0:04:03

      Average standard deviation of split frequencies: 0.004172

      150500 -- [-2333.117] (-2338.069) (-2343.251) (-2337.069) * (-2336.585) (-2336.028) [-2333.108] (-2334.589) -- 0:04:02
      151000 -- (-2333.541) [-2335.374] (-2340.677) (-2331.205) * (-2329.688) [-2335.503] (-2331.582) (-2337.564) -- 0:04:01
      151500 -- (-2332.886) (-2333.787) (-2334.655) [-2329.073] * [-2328.279] (-2327.139) (-2329.353) (-2330.447) -- 0:04:00
      152000 -- [-2330.099] (-2340.272) (-2331.229) (-2335.701) * (-2330.032) (-2332.751) (-2332.318) [-2336.969] -- 0:03:59
      152500 -- [-2329.488] (-2328.141) (-2330.814) (-2331.860) * (-2327.250) (-2332.633) [-2332.431] (-2330.698) -- 0:03:58
      153000 -- (-2332.280) (-2332.168) [-2340.484] (-2332.599) * (-2331.935) (-2337.250) [-2332.002] (-2332.875) -- 0:03:58
      153500 -- (-2333.105) [-2339.431] (-2340.073) (-2335.728) * (-2343.581) [-2329.970] (-2336.704) (-2329.584) -- 0:04:02
      154000 -- (-2332.897) [-2332.646] (-2335.593) (-2337.568) * (-2343.395) (-2334.873) (-2329.347) [-2336.439] -- 0:04:01
      154500 -- (-2331.398) (-2337.365) [-2331.925] (-2332.230) * (-2338.527) (-2342.271) [-2329.083] (-2341.113) -- 0:04:00
      155000 -- (-2336.056) (-2329.539) (-2329.212) [-2333.158] * (-2336.591) [-2332.436] (-2334.573) (-2330.074) -- 0:03:59

      Average standard deviation of split frequencies: 0.004029

      155500 -- (-2332.438) [-2330.235] (-2328.260) (-2336.186) * (-2339.600) (-2331.120) [-2334.039] (-2330.996) -- 0:03:58
      156000 -- (-2330.604) (-2330.033) [-2335.279] (-2335.283) * (-2335.106) [-2333.795] (-2334.030) (-2328.779) -- 0:03:58
      156500 -- (-2330.420) (-2337.709) (-2331.235) [-2342.636] * [-2332.798] (-2345.595) (-2347.409) (-2333.924) -- 0:03:57
      157000 -- (-2333.286) (-2328.242) [-2329.679] (-2333.167) * (-2326.266) [-2330.249] (-2334.788) (-2335.161) -- 0:04:01
      157500 -- (-2334.963) [-2332.985] (-2331.506) (-2336.318) * [-2327.757] (-2328.469) (-2336.148) (-2330.086) -- 0:04:00
      158000 -- (-2331.436) (-2336.499) (-2330.522) [-2330.085] * (-2336.399) (-2334.874) (-2334.304) [-2335.206] -- 0:03:59
      158500 -- [-2330.521] (-2331.222) (-2340.609) (-2330.975) * (-2334.156) [-2334.618] (-2329.245) (-2336.620) -- 0:03:58
      159000 -- (-2336.353) [-2334.690] (-2330.103) (-2333.556) * [-2331.611] (-2342.092) (-2330.447) (-2330.438) -- 0:03:58
      159500 -- (-2332.577) (-2334.388) (-2335.821) [-2331.738] * (-2337.904) (-2333.695) (-2333.109) [-2331.129] -- 0:03:57
      160000 -- [-2331.439] (-2332.645) (-2330.183) (-2334.023) * (-2340.516) [-2330.143] (-2335.293) (-2337.637) -- 0:03:56

      Average standard deviation of split frequencies: 0.002934

      160500 -- (-2332.835) (-2333.536) [-2328.808] (-2332.604) * (-2342.075) [-2334.486] (-2338.005) (-2334.014) -- 0:03:55
      161000 -- (-2330.948) (-2328.599) (-2335.341) [-2334.571] * (-2334.597) (-2335.017) (-2329.779) [-2330.134] -- 0:03:59
      161500 -- (-2336.964) (-2335.507) [-2330.613] (-2336.146) * [-2333.574] (-2335.304) (-2331.024) (-2332.444) -- 0:03:58
      162000 -- [-2332.096] (-2340.286) (-2333.383) (-2337.110) * (-2335.475) [-2329.852] (-2326.753) (-2329.784) -- 0:03:57
      162500 -- [-2332.853] (-2335.599) (-2336.005) (-2329.689) * [-2330.298] (-2329.235) (-2332.488) (-2331.599) -- 0:03:57
      163000 -- (-2335.397) [-2332.313] (-2339.498) (-2340.385) * [-2331.976] (-2336.162) (-2332.668) (-2331.070) -- 0:03:56
      163500 -- (-2333.765) (-2335.282) (-2336.264) [-2330.410] * (-2329.477) [-2334.824] (-2335.242) (-2331.455) -- 0:03:55
      164000 -- (-2331.710) (-2337.474) (-2333.487) [-2330.517] * (-2336.151) (-2337.684) (-2341.340) [-2326.228] -- 0:03:54
      164500 -- [-2330.823] (-2331.103) (-2335.145) (-2329.853) * (-2334.397) (-2334.164) (-2337.006) [-2326.639] -- 0:03:58
      165000 -- (-2330.714) [-2328.464] (-2328.223) (-2339.730) * (-2330.354) (-2338.080) (-2331.404) [-2331.508] -- 0:03:57

      Average standard deviation of split frequencies: 0.002840

      165500 -- (-2335.395) (-2339.373) [-2329.633] (-2332.883) * (-2334.223) (-2332.710) (-2331.630) [-2332.728] -- 0:03:56
      166000 -- (-2334.340) (-2334.569) [-2332.951] (-2328.609) * [-2330.963] (-2338.243) (-2330.426) (-2336.195) -- 0:03:56
      166500 -- (-2333.172) [-2328.225] (-2341.212) (-2327.911) * (-2333.958) (-2330.048) (-2339.014) [-2329.306] -- 0:03:55
      167000 -- (-2336.875) (-2330.005) (-2347.157) [-2328.241] * [-2332.451] (-2337.132) (-2333.369) (-2333.579) -- 0:03:54
      167500 -- (-2340.703) (-2331.638) (-2334.757) [-2330.516] * [-2333.313] (-2335.080) (-2328.898) (-2333.072) -- 0:03:53
      168000 -- (-2339.133) (-2331.348) [-2336.332] (-2332.140) * [-2339.360] (-2337.319) (-2328.939) (-2338.082) -- 0:03:57
      168500 -- (-2345.850) (-2333.420) [-2329.348] (-2334.030) * [-2333.489] (-2337.141) (-2332.320) (-2335.361) -- 0:03:56
      169000 -- (-2340.774) (-2333.396) [-2329.261] (-2337.329) * [-2336.595] (-2337.468) (-2335.933) (-2336.593) -- 0:03:56
      169500 -- [-2334.977] (-2329.986) (-2331.266) (-2327.866) * (-2334.937) (-2339.319) (-2336.122) [-2332.137] -- 0:03:55
      170000 -- (-2352.054) (-2331.595) (-2339.477) [-2331.218] * (-2343.395) [-2337.616] (-2338.609) (-2338.968) -- 0:03:54

      Average standard deviation of split frequencies: 0.003683

      170500 -- (-2334.493) [-2327.339] (-2341.350) (-2331.831) * (-2336.603) [-2339.919] (-2336.297) (-2331.676) -- 0:03:53
      171000 -- (-2328.574) (-2341.427) [-2330.319] (-2331.010) * (-2330.613) (-2337.694) (-2330.006) [-2330.444] -- 0:03:52
      171500 -- [-2335.626] (-2344.530) (-2333.424) (-2329.771) * [-2329.560] (-2333.095) (-2338.670) (-2329.957) -- 0:03:56
      172000 -- (-2330.910) (-2333.041) (-2337.188) [-2336.261] * (-2331.422) (-2334.492) [-2337.702] (-2337.117) -- 0:03:55
      172500 -- (-2336.232) [-2332.550] (-2336.733) (-2335.582) * (-2332.551) (-2331.245) [-2329.394] (-2333.437) -- 0:03:55
      173000 -- (-2333.608) [-2331.882] (-2338.017) (-2340.737) * [-2331.132] (-2328.006) (-2333.475) (-2336.085) -- 0:03:54
      173500 -- [-2331.800] (-2336.319) (-2328.317) (-2340.482) * (-2346.167) (-2331.338) (-2333.120) [-2336.585] -- 0:03:53
      174000 -- (-2339.889) [-2333.005] (-2327.206) (-2348.096) * (-2335.578) [-2331.404] (-2335.769) (-2333.964) -- 0:03:52
      174500 -- (-2336.487) [-2334.202] (-2329.136) (-2336.099) * [-2331.366] (-2327.776) (-2329.453) (-2336.745) -- 0:03:51
      175000 -- [-2335.350] (-2333.620) (-2331.996) (-2341.433) * (-2339.564) (-2332.899) (-2337.383) [-2332.935] -- 0:03:55

      Average standard deviation of split frequencies: 0.004464

      175500 -- (-2330.680) (-2327.505) [-2339.465] (-2347.967) * (-2331.659) [-2333.517] (-2330.902) (-2336.887) -- 0:03:54
      176000 -- (-2331.039) [-2333.642] (-2333.284) (-2333.681) * (-2333.602) (-2338.159) [-2327.638] (-2336.722) -- 0:03:54
      176500 -- (-2335.590) (-2332.570) [-2331.299] (-2339.712) * (-2331.206) (-2331.407) [-2331.883] (-2331.850) -- 0:03:53
      177000 -- [-2334.394] (-2333.645) (-2336.192) (-2335.474) * (-2333.923) [-2328.393] (-2330.658) (-2326.943) -- 0:03:52
      177500 -- (-2337.547) [-2331.701] (-2333.168) (-2333.968) * [-2331.321] (-2331.246) (-2333.310) (-2330.077) -- 0:03:51
      178000 -- (-2337.206) (-2338.148) (-2338.164) [-2331.943] * (-2334.065) (-2336.262) (-2328.684) [-2334.310] -- 0:03:50
      178500 -- [-2336.782] (-2335.602) (-2331.652) (-2331.809) * (-2329.854) (-2329.821) [-2334.766] (-2331.811) -- 0:03:54
      179000 -- (-2343.194) [-2331.020] (-2330.035) (-2336.354) * (-2337.244) (-2338.178) (-2330.749) [-2326.151] -- 0:03:53
      179500 -- (-2342.533) (-2330.919) (-2332.360) [-2331.562] * (-2330.883) (-2332.899) [-2334.093] (-2332.549) -- 0:03:53
      180000 -- (-2332.260) [-2330.760] (-2327.039) (-2330.215) * [-2335.115] (-2336.043) (-2338.410) (-2333.473) -- 0:03:52

      Average standard deviation of split frequencies: 0.003479

      180500 -- (-2332.932) (-2334.257) (-2330.544) [-2334.926] * (-2331.958) (-2338.298) (-2333.483) [-2332.761] -- 0:03:51
      181000 -- [-2336.080] (-2344.576) (-2340.250) (-2331.294) * (-2333.387) [-2327.536] (-2339.031) (-2328.568) -- 0:03:50
      181500 -- (-2336.988) (-2341.210) (-2330.207) [-2330.301] * (-2334.299) (-2329.209) [-2332.833] (-2328.139) -- 0:03:49
      182000 -- (-2339.145) (-2339.408) (-2334.492) [-2329.775] * [-2332.903] (-2329.673) (-2338.572) (-2332.303) -- 0:03:53
      182500 -- (-2338.271) (-2333.054) (-2332.384) [-2333.295] * [-2332.524] (-2336.718) (-2333.340) (-2333.215) -- 0:03:52
      183000 -- (-2329.873) (-2335.954) (-2331.991) [-2332.129] * [-2333.519] (-2330.050) (-2331.259) (-2329.171) -- 0:03:52
      183500 -- (-2329.443) (-2336.871) (-2330.948) [-2330.968] * (-2333.650) [-2326.282] (-2333.859) (-2335.966) -- 0:03:51
      184000 -- [-2327.920] (-2338.802) (-2330.181) (-2329.999) * (-2341.097) (-2329.541) (-2330.427) [-2330.278] -- 0:03:50
      184500 -- (-2331.904) (-2338.992) [-2333.317] (-2334.591) * [-2339.394] (-2331.387) (-2331.503) (-2336.381) -- 0:03:49
      185000 -- [-2329.474] (-2334.992) (-2336.272) (-2328.202) * (-2337.666) [-2329.879] (-2333.474) (-2335.493) -- 0:03:49

      Average standard deviation of split frequencies: 0.003379

      185500 -- [-2327.435] (-2329.224) (-2332.739) (-2337.181) * (-2333.914) (-2334.932) (-2334.089) [-2331.454] -- 0:03:52
      186000 -- (-2330.386) [-2333.079] (-2337.335) (-2329.721) * [-2330.601] (-2340.710) (-2333.242) (-2334.855) -- 0:03:51
      186500 -- (-2330.986) [-2329.369] (-2339.892) (-2331.519) * [-2338.510] (-2338.289) (-2330.046) (-2329.005) -- 0:03:51
      187000 -- (-2335.473) (-2336.176) [-2335.793] (-2332.144) * (-2340.883) [-2332.280] (-2336.971) (-2327.709) -- 0:03:50
      187500 -- (-2335.388) [-2330.875] (-2333.604) (-2330.357) * (-2337.149) (-2328.804) (-2334.178) [-2328.926] -- 0:03:49
      188000 -- [-2335.548] (-2339.214) (-2331.476) (-2334.824) * (-2342.806) (-2336.528) (-2327.976) [-2334.844] -- 0:03:48
      188500 -- (-2334.368) (-2333.144) (-2336.902) [-2338.049] * (-2342.679) [-2334.103] (-2330.984) (-2333.425) -- 0:03:48
      189000 -- (-2333.879) (-2333.316) (-2338.874) [-2328.142] * [-2329.273] (-2333.176) (-2335.003) (-2333.529) -- 0:03:51
      189500 -- (-2345.531) [-2329.115] (-2331.639) (-2332.784) * [-2328.371] (-2329.270) (-2334.206) (-2333.351) -- 0:03:50
      190000 -- (-2335.543) (-2336.945) [-2336.716] (-2337.669) * (-2340.639) (-2334.310) [-2330.956] (-2330.474) -- 0:03:50

      Average standard deviation of split frequencies: 0.002472

      190500 -- (-2343.038) [-2333.830] (-2328.875) (-2326.561) * (-2330.146) (-2329.598) [-2332.932] (-2332.214) -- 0:03:49
      191000 -- (-2333.275) [-2332.472] (-2333.102) (-2342.541) * (-2338.823) (-2329.530) [-2339.792] (-2332.896) -- 0:03:48
      191500 -- (-2333.098) (-2333.145) [-2327.249] (-2344.029) * (-2337.347) (-2334.535) [-2330.624] (-2335.527) -- 0:03:47
      192000 -- [-2335.789] (-2332.913) (-2330.292) (-2342.121) * (-2342.487) (-2341.267) [-2331.049] (-2338.429) -- 0:03:47
      192500 -- [-2329.726] (-2338.337) (-2330.229) (-2338.173) * (-2336.757) (-2327.950) [-2337.749] (-2335.717) -- 0:03:50
      193000 -- (-2335.389) [-2336.615] (-2339.341) (-2339.437) * (-2333.255) (-2331.455) (-2336.098) [-2333.528] -- 0:03:49
      193500 -- (-2335.411) (-2329.831) (-2329.639) [-2334.544] * (-2338.150) (-2336.715) (-2329.486) [-2325.711] -- 0:03:49
      194000 -- (-2336.669) (-2334.087) [-2329.418] (-2334.446) * (-2332.022) (-2334.871) [-2328.123] (-2330.502) -- 0:03:48
      194500 -- (-2336.164) [-2333.753] (-2330.955) (-2331.682) * (-2330.607) (-2334.184) (-2330.201) [-2328.578] -- 0:03:47
      195000 -- (-2336.691) (-2330.471) (-2335.243) [-2328.342] * (-2338.582) [-2333.020] (-2332.984) (-2337.557) -- 0:03:47

      Average standard deviation of split frequencies: 0.002405

      195500 -- [-2331.585] (-2334.849) (-2332.856) (-2339.247) * (-2340.529) [-2328.605] (-2334.779) (-2332.852) -- 0:03:46
      196000 -- (-2332.110) (-2333.943) [-2328.101] (-2334.967) * (-2341.321) [-2329.726] (-2327.312) (-2340.943) -- 0:03:49
      196500 -- (-2338.952) (-2337.710) (-2329.880) [-2334.669] * (-2332.367) (-2327.422) [-2329.083] (-2332.910) -- 0:03:48
      197000 -- (-2339.023) (-2329.817) [-2334.055] (-2335.908) * (-2332.870) (-2334.559) [-2330.491] (-2332.136) -- 0:03:48
      197500 -- [-2330.760] (-2335.232) (-2331.746) (-2340.336) * (-2336.819) [-2333.507] (-2330.100) (-2335.900) -- 0:03:47
      198000 -- (-2334.874) (-2342.886) [-2331.590] (-2331.813) * (-2331.639) (-2334.553) [-2329.633] (-2340.442) -- 0:03:46
      198500 -- (-2332.879) [-2339.718] (-2331.321) (-2331.751) * (-2342.017) (-2336.461) (-2335.136) [-2335.403] -- 0:03:46
      199000 -- (-2342.702) (-2329.613) [-2335.831] (-2339.426) * (-2344.810) (-2333.916) [-2327.695] (-2336.776) -- 0:03:45
      199500 -- (-2339.210) (-2341.458) [-2338.634] (-2332.982) * (-2336.090) (-2336.656) [-2325.517] (-2336.907) -- 0:03:48
      200000 -- [-2332.196] (-2333.413) (-2330.575) (-2335.463) * (-2338.947) (-2334.307) [-2332.299] (-2341.063) -- 0:03:48

      Average standard deviation of split frequencies: 0.001566

      200500 -- [-2337.921] (-2332.436) (-2339.584) (-2330.282) * [-2329.932] (-2328.709) (-2330.196) (-2341.767) -- 0:03:47
      201000 -- (-2334.304) (-2329.392) [-2334.243] (-2335.648) * (-2330.567) (-2332.421) [-2334.024] (-2339.977) -- 0:03:46
      201500 -- (-2329.029) (-2335.287) [-2336.147] (-2331.633) * (-2334.300) (-2329.871) (-2340.814) [-2330.708] -- 0:03:45
      202000 -- (-2337.435) (-2328.307) [-2336.574] (-2338.975) * [-2332.615] (-2332.341) (-2329.329) (-2332.827) -- 0:03:45
      202500 -- (-2330.924) (-2331.470) (-2333.945) [-2332.104] * (-2331.263) [-2329.109] (-2329.746) (-2337.240) -- 0:03:44
      203000 -- (-2344.965) [-2330.442] (-2340.817) (-2331.562) * [-2326.710] (-2339.154) (-2336.008) (-2336.054) -- 0:03:47
      203500 -- (-2339.900) [-2336.236] (-2332.096) (-2332.813) * (-2328.508) (-2333.239) [-2337.444] (-2334.334) -- 0:03:47
      204000 -- (-2334.404) (-2334.539) (-2338.349) [-2332.582] * (-2336.888) [-2327.692] (-2348.421) (-2332.994) -- 0:03:46
      204500 -- [-2341.759] (-2343.607) (-2338.854) (-2332.817) * (-2330.383) (-2330.014) [-2334.382] (-2333.708) -- 0:03:45
      205000 -- (-2341.653) (-2334.689) (-2332.419) [-2328.808] * [-2331.449] (-2332.059) (-2341.756) (-2333.965) -- 0:03:44

      Average standard deviation of split frequencies: 0.001526

      205500 -- [-2327.100] (-2333.500) (-2337.477) (-2334.268) * [-2328.205] (-2329.854) (-2333.739) (-2343.922) -- 0:03:44
      206000 -- (-2337.062) (-2328.582) (-2335.646) [-2330.060] * (-2332.179) (-2327.878) [-2330.975] (-2337.141) -- 0:03:43
      206500 -- (-2330.587) (-2332.153) (-2338.644) [-2329.345] * (-2331.737) [-2336.250] (-2331.251) (-2333.098) -- 0:03:46
      207000 -- (-2336.197) (-2334.488) [-2328.152] (-2334.778) * (-2334.091) (-2330.004) [-2337.769] (-2334.542) -- 0:03:46
      207500 -- [-2334.006] (-2333.417) (-2330.155) (-2334.173) * (-2336.782) (-2334.959) (-2343.589) [-2332.419] -- 0:03:45
      208000 -- (-2339.580) [-2329.356] (-2330.738) (-2333.028) * (-2335.596) (-2332.626) (-2338.787) [-2330.448] -- 0:03:44
      208500 -- (-2341.492) [-2334.560] (-2329.146) (-2334.624) * [-2334.263] (-2332.388) (-2331.940) (-2332.722) -- 0:03:43
      209000 -- (-2332.444) [-2332.537] (-2331.666) (-2339.457) * [-2337.589] (-2333.663) (-2329.517) (-2328.665) -- 0:03:43
      209500 -- (-2325.230) (-2339.882) [-2333.822] (-2330.503) * (-2333.781) (-2330.452) (-2327.535) [-2329.033] -- 0:03:42
      210000 -- (-2332.539) (-2336.569) (-2336.620) [-2328.073] * (-2329.294) (-2329.597) [-2330.569] (-2334.171) -- 0:03:45

      Average standard deviation of split frequencies: 0.001492

      210500 -- (-2338.678) (-2337.713) [-2327.423] (-2342.818) * (-2334.262) (-2336.277) [-2330.003] (-2334.924) -- 0:03:45
      211000 -- (-2334.650) (-2333.869) [-2329.057] (-2327.892) * (-2333.425) (-2330.618) [-2335.649] (-2331.830) -- 0:03:44
      211500 -- [-2331.989] (-2333.894) (-2331.647) (-2332.777) * (-2335.161) [-2331.720] (-2333.995) (-2333.541) -- 0:03:43
      212000 -- (-2336.347) [-2332.394] (-2334.920) (-2330.329) * (-2332.913) (-2334.421) (-2335.667) [-2333.856] -- 0:03:43
      212500 -- (-2345.345) [-2327.773] (-2333.120) (-2330.618) * (-2335.931) (-2341.757) (-2330.634) [-2328.525] -- 0:03:42
      213000 -- [-2333.166] (-2337.573) (-2334.161) (-2333.028) * (-2336.080) (-2335.239) [-2330.404] (-2333.535) -- 0:03:41
      213500 -- (-2333.520) (-2330.141) [-2331.487] (-2328.958) * (-2335.424) (-2328.233) [-2332.764] (-2333.035) -- 0:03:44
      214000 -- (-2343.369) (-2334.336) (-2334.034) [-2330.420] * (-2340.511) [-2333.337] (-2346.373) (-2334.122) -- 0:03:44
      214500 -- (-2335.966) (-2335.348) (-2331.932) [-2331.617] * (-2338.169) (-2327.637) [-2329.167] (-2329.150) -- 0:03:43
      215000 -- (-2335.769) (-2334.436) [-2333.682] (-2333.450) * (-2331.331) (-2332.843) (-2331.104) [-2332.644] -- 0:03:42

      Average standard deviation of split frequencies: 0.001455

      215500 -- (-2333.627) (-2332.784) [-2333.094] (-2339.169) * (-2335.094) (-2330.091) (-2330.671) [-2329.070] -- 0:03:42
      216000 -- (-2328.081) (-2335.130) (-2333.448) [-2333.895] * [-2331.416] (-2341.111) (-2330.851) (-2327.827) -- 0:03:41
      216500 -- (-2334.298) (-2324.282) [-2331.696] (-2338.765) * [-2330.506] (-2330.920) (-2333.354) (-2336.947) -- 0:03:40
      217000 -- [-2332.444] (-2332.336) (-2328.739) (-2334.112) * (-2331.228) [-2332.088] (-2332.724) (-2338.529) -- 0:03:43
      217500 -- (-2335.077) (-2334.505) [-2332.868] (-2334.980) * [-2332.267] (-2335.736) (-2332.601) (-2333.447) -- 0:03:43
      218000 -- [-2328.994] (-2338.568) (-2328.401) (-2339.625) * (-2330.640) (-2334.230) (-2332.080) [-2331.324] -- 0:03:42
      218500 -- (-2335.114) (-2336.687) [-2332.747] (-2332.509) * (-2333.833) (-2337.005) [-2334.832] (-2335.798) -- 0:03:41
      219000 -- (-2346.624) [-2332.929] (-2335.903) (-2335.067) * [-2332.924] (-2344.110) (-2330.774) (-2330.595) -- 0:03:41
      219500 -- [-2335.828] (-2333.754) (-2334.664) (-2342.233) * (-2332.416) (-2334.565) [-2333.533] (-2336.011) -- 0:03:40
      220000 -- (-2342.699) [-2336.427] (-2330.888) (-2339.440) * (-2340.070) (-2340.086) (-2332.730) [-2331.545] -- 0:03:39

      Average standard deviation of split frequencies: 0.000712

      220500 -- (-2338.282) [-2326.348] (-2333.542) (-2329.170) * (-2335.439) [-2338.560] (-2339.038) (-2333.199) -- 0:03:42
      221000 -- [-2336.366] (-2332.946) (-2330.337) (-2340.941) * (-2343.615) [-2331.311] (-2333.367) (-2332.087) -- 0:03:42
      221500 -- (-2337.198) (-2336.616) [-2329.831] (-2331.674) * (-2343.107) [-2330.106] (-2331.931) (-2334.988) -- 0:03:41
      222000 -- [-2331.947] (-2336.771) (-2330.500) (-2334.985) * (-2337.648) [-2329.970] (-2334.810) (-2335.699) -- 0:03:40
      222500 -- (-2330.735) (-2337.178) (-2335.980) [-2329.408] * (-2335.338) (-2334.359) (-2330.201) [-2329.944] -- 0:03:40
      223000 -- (-2335.624) (-2331.858) [-2334.263] (-2331.348) * [-2333.916] (-2331.747) (-2334.285) (-2335.948) -- 0:03:39
      223500 -- (-2328.376) [-2334.363] (-2334.737) (-2332.683) * (-2333.983) (-2330.401) [-2335.266] (-2328.877) -- 0:03:38
      224000 -- (-2338.350) [-2328.071] (-2337.834) (-2340.765) * [-2338.262] (-2335.378) (-2333.834) (-2331.858) -- 0:03:41
      224500 -- [-2331.504] (-2335.172) (-2342.001) (-2338.978) * [-2330.390] (-2333.726) (-2336.400) (-2329.847) -- 0:03:41
      225000 -- (-2334.341) [-2327.992] (-2337.402) (-2338.140) * (-2335.145) (-2334.078) (-2337.594) [-2326.730] -- 0:03:40

      Average standard deviation of split frequencies: 0.000695

      225500 -- (-2337.524) [-2327.912] (-2341.117) (-2331.312) * (-2327.020) (-2336.174) (-2332.785) [-2329.062] -- 0:03:39
      226000 -- (-2337.056) (-2333.606) (-2332.295) [-2330.088] * (-2326.617) [-2327.495] (-2330.690) (-2332.476) -- 0:03:39
      226500 -- (-2328.309) (-2341.513) [-2328.999] (-2333.138) * (-2327.733) (-2330.039) (-2333.983) [-2328.062] -- 0:03:38
      227000 -- [-2337.217] (-2336.875) (-2334.511) (-2330.197) * (-2332.832) (-2333.573) [-2328.997] (-2335.045) -- 0:03:37
      227500 -- (-2333.003) [-2331.721] (-2332.576) (-2330.359) * (-2336.960) [-2331.624] (-2332.509) (-2332.744) -- 0:03:40
      228000 -- (-2334.469) [-2327.859] (-2336.129) (-2339.289) * (-2337.553) (-2329.652) (-2341.473) [-2331.116] -- 0:03:40
      228500 -- (-2338.175) [-2333.563] (-2334.497) (-2334.132) * (-2338.904) (-2337.454) (-2334.972) [-2331.129] -- 0:03:39
      229000 -- [-2336.419] (-2332.869) (-2337.203) (-2334.536) * (-2337.100) [-2330.435] (-2332.236) (-2337.870) -- 0:03:38
      229500 -- (-2333.604) (-2333.795) (-2333.851) [-2332.166] * (-2332.849) [-2332.838] (-2337.730) (-2339.386) -- 0:03:38
      230000 -- [-2333.075] (-2335.020) (-2334.725) (-2329.874) * (-2332.825) [-2329.598] (-2334.758) (-2330.227) -- 0:03:37

      Average standard deviation of split frequencies: 0.001362

      230500 -- [-2329.867] (-2338.146) (-2336.399) (-2330.708) * (-2330.085) (-2328.811) (-2335.358) [-2331.785] -- 0:03:36
      231000 -- [-2332.324] (-2328.605) (-2337.273) (-2331.296) * [-2335.904] (-2330.285) (-2336.574) (-2341.284) -- 0:03:39
      231500 -- (-2335.686) (-2330.853) (-2337.052) [-2331.006] * (-2332.134) (-2336.096) [-2333.639] (-2336.679) -- 0:03:39
      232000 -- (-2333.747) (-2330.121) (-2329.858) [-2329.147] * (-2336.922) (-2335.189) (-2334.897) [-2332.240] -- 0:03:38
      232500 -- (-2335.603) [-2329.780] (-2332.023) (-2329.249) * (-2335.741) [-2334.334] (-2343.848) (-2334.360) -- 0:03:37
      233000 -- (-2333.277) [-2336.117] (-2330.788) (-2334.359) * [-2331.978] (-2329.838) (-2331.770) (-2331.093) -- 0:03:37
      233500 -- (-2331.648) (-2336.131) (-2337.471) [-2339.234] * (-2333.696) [-2337.416] (-2335.798) (-2327.547) -- 0:03:36
      234000 -- (-2332.751) (-2328.091) [-2336.297] (-2335.364) * (-2331.586) [-2337.592] (-2337.823) (-2333.758) -- 0:03:36
      234500 -- (-2329.219) [-2329.221] (-2340.728) (-2335.316) * (-2329.667) [-2329.468] (-2339.556) (-2331.368) -- 0:03:38
      235000 -- (-2337.163) [-2335.025] (-2333.352) (-2331.957) * (-2331.232) (-2338.573) [-2332.365] (-2329.512) -- 0:03:38

      Average standard deviation of split frequencies: 0.001332

      235500 -- (-2338.946) [-2330.357] (-2336.854) (-2335.068) * [-2331.473] (-2335.242) (-2337.023) (-2332.694) -- 0:03:37
      236000 -- [-2334.902] (-2330.812) (-2335.770) (-2333.021) * (-2329.492) [-2329.761] (-2337.339) (-2337.843) -- 0:03:36
      236500 -- (-2336.842) [-2333.359] (-2342.236) (-2327.235) * (-2327.607) (-2337.490) [-2330.933] (-2333.081) -- 0:03:36
      237000 -- (-2336.843) (-2333.861) [-2336.960] (-2334.881) * (-2330.374) (-2336.603) (-2333.793) [-2334.611] -- 0:03:35
      237500 -- (-2330.184) (-2331.468) (-2332.844) [-2332.940] * [-2331.902] (-2332.352) (-2334.202) (-2333.158) -- 0:03:35
      238000 -- (-2333.134) [-2328.384] (-2341.215) (-2336.927) * (-2335.113) (-2331.220) [-2333.492] (-2328.054) -- 0:03:37
      238500 -- [-2332.660] (-2331.821) (-2338.503) (-2332.348) * (-2336.958) (-2329.672) (-2336.425) [-2331.101] -- 0:03:37
      239000 -- [-2330.339] (-2331.198) (-2330.364) (-2333.263) * (-2333.909) (-2335.507) [-2330.492] (-2326.780) -- 0:03:36
      239500 -- [-2327.901] (-2333.880) (-2332.577) (-2328.814) * (-2341.782) (-2341.513) (-2330.078) [-2334.975] -- 0:03:35
      240000 -- (-2329.183) (-2329.545) (-2334.380) [-2328.742] * (-2334.162) [-2336.146] (-2333.541) (-2333.269) -- 0:03:35

      Average standard deviation of split frequencies: 0.001306

      240500 -- (-2340.921) [-2333.521] (-2328.378) (-2331.473) * [-2332.359] (-2330.673) (-2336.990) (-2328.743) -- 0:03:34
      241000 -- (-2338.021) (-2333.255) [-2333.095] (-2330.620) * (-2336.014) [-2333.791] (-2335.829) (-2337.554) -- 0:03:34
      241500 -- (-2335.399) (-2332.025) [-2328.587] (-2331.620) * (-2341.606) [-2336.376] (-2336.945) (-2336.593) -- 0:03:36
      242000 -- [-2331.160] (-2342.531) (-2328.947) (-2338.097) * (-2336.526) [-2330.666] (-2346.756) (-2336.868) -- 0:03:36
      242500 -- (-2332.347) (-2333.263) (-2339.303) [-2334.971] * (-2339.143) [-2331.217] (-2336.829) (-2338.145) -- 0:03:35
      243000 -- [-2326.639] (-2338.753) (-2328.411) (-2335.860) * (-2332.863) (-2341.733) (-2334.752) [-2335.390] -- 0:03:34
      243500 -- (-2330.261) (-2340.334) [-2329.865] (-2333.566) * (-2335.094) [-2329.396] (-2330.297) (-2334.144) -- 0:03:34
      244000 -- (-2338.451) (-2336.709) [-2330.587] (-2327.262) * (-2333.813) (-2330.736) (-2335.703) [-2339.432] -- 0:03:33
      244500 -- (-2334.192) (-2338.371) [-2331.687] (-2335.680) * (-2337.578) (-2334.719) [-2337.489] (-2332.066) -- 0:03:33
      245000 -- (-2337.881) (-2347.853) [-2331.206] (-2327.151) * (-2335.165) (-2331.479) (-2328.568) [-2330.827] -- 0:03:35

      Average standard deviation of split frequencies: 0.001278

      245500 -- (-2343.035) (-2327.818) (-2335.114) [-2329.198] * (-2338.733) [-2334.055] (-2327.070) (-2328.479) -- 0:03:35
      246000 -- (-2341.089) [-2326.662] (-2333.896) (-2331.823) * (-2337.667) (-2334.578) (-2335.185) [-2332.704] -- 0:03:34
      246500 -- (-2340.877) [-2329.290] (-2332.760) (-2328.621) * (-2332.840) (-2328.339) (-2330.145) [-2327.083] -- 0:03:33
      247000 -- (-2337.841) [-2334.127] (-2335.528) (-2335.650) * (-2335.403) (-2336.925) (-2339.090) [-2328.107] -- 0:03:33
      247500 -- (-2348.365) [-2336.215] (-2332.585) (-2328.796) * (-2336.825) [-2330.551] (-2329.851) (-2329.760) -- 0:03:32
      248000 -- (-2338.730) [-2333.385] (-2340.518) (-2333.153) * (-2340.519) (-2333.774) (-2331.443) [-2328.247] -- 0:03:32
      248500 -- (-2329.915) (-2333.517) [-2332.428] (-2335.324) * (-2331.062) (-2330.168) [-2331.280] (-2329.302) -- 0:03:34
      249000 -- [-2334.217] (-2335.206) (-2335.310) (-2330.648) * (-2336.993) (-2331.256) (-2328.916) [-2341.046] -- 0:03:34
      249500 -- (-2330.536) (-2333.090) [-2339.408] (-2343.826) * (-2330.682) [-2330.641] (-2331.825) (-2333.955) -- 0:03:33
      250000 -- (-2342.875) (-2337.744) [-2336.061] (-2330.219) * [-2335.150] (-2333.036) (-2337.286) (-2334.084) -- 0:03:33

      Average standard deviation of split frequencies: 0.000627

      250500 -- (-2335.293) (-2338.603) [-2336.474] (-2325.175) * (-2332.555) (-2333.690) (-2337.328) [-2333.241] -- 0:03:32
      251000 -- (-2330.284) (-2330.314) [-2332.778] (-2332.903) * [-2328.676] (-2334.002) (-2332.176) (-2334.196) -- 0:03:31
      251500 -- (-2326.349) (-2331.724) (-2328.823) [-2329.707] * (-2334.266) [-2331.053] (-2341.988) (-2339.713) -- 0:03:31
      252000 -- (-2327.338) (-2336.675) (-2345.233) [-2334.108] * (-2337.118) (-2333.109) [-2329.135] (-2338.578) -- 0:03:33
      252500 -- [-2333.021] (-2330.236) (-2338.605) (-2330.680) * [-2326.903] (-2333.221) (-2328.401) (-2338.390) -- 0:03:33
      253000 -- [-2336.622] (-2335.521) (-2334.863) (-2333.608) * (-2332.315) [-2329.332] (-2335.931) (-2331.295) -- 0:03:32
      253500 -- [-2327.796] (-2329.653) (-2332.350) (-2331.334) * (-2331.676) (-2339.644) (-2335.766) [-2341.037] -- 0:03:32
      254000 -- [-2329.098] (-2327.196) (-2331.214) (-2330.532) * [-2332.306] (-2333.750) (-2334.801) (-2334.447) -- 0:03:31
      254500 -- (-2337.061) (-2330.420) (-2333.409) [-2333.154] * (-2330.990) (-2336.134) [-2339.650] (-2343.405) -- 0:03:30
      255000 -- (-2332.648) (-2334.629) [-2333.069] (-2335.524) * [-2333.919] (-2334.459) (-2335.147) (-2338.676) -- 0:03:30

      Average standard deviation of split frequencies: 0.000614

      255500 -- (-2331.136) (-2337.372) (-2330.267) [-2336.436] * [-2339.113] (-2332.867) (-2327.824) (-2335.056) -- 0:03:32
      256000 -- [-2331.947] (-2334.894) (-2335.251) (-2346.204) * (-2331.422) (-2333.087) [-2331.886] (-2341.110) -- 0:03:32
      256500 -- [-2336.920] (-2342.513) (-2334.742) (-2336.415) * [-2338.502] (-2330.106) (-2328.521) (-2330.927) -- 0:03:31
      257000 -- [-2333.953] (-2329.317) (-2330.939) (-2340.210) * (-2337.947) (-2339.781) (-2333.518) [-2334.432] -- 0:03:31
      257500 -- (-2329.976) [-2335.694] (-2328.632) (-2331.860) * (-2336.724) (-2332.840) (-2335.694) [-2334.056] -- 0:03:30
      258000 -- (-2334.400) (-2332.872) [-2328.722] (-2341.124) * [-2334.165] (-2341.028) (-2337.484) (-2334.786) -- 0:03:29
      258500 -- [-2333.629] (-2340.871) (-2333.089) (-2335.594) * (-2339.132) [-2332.872] (-2328.794) (-2337.739) -- 0:03:29
      259000 -- [-2335.623] (-2340.464) (-2336.629) (-2339.671) * [-2340.507] (-2332.180) (-2339.294) (-2335.264) -- 0:03:31
      259500 -- [-2337.703] (-2333.189) (-2333.766) (-2333.573) * (-2336.562) (-2344.234) [-2333.388] (-2328.881) -- 0:03:31
      260000 -- [-2333.497] (-2336.876) (-2332.872) (-2330.213) * (-2340.587) (-2333.981) [-2332.416] (-2330.437) -- 0:03:30

      Average standard deviation of split frequencies: 0.000603

      260500 -- (-2330.685) (-2336.680) (-2332.614) [-2328.638] * (-2331.505) (-2336.790) (-2328.341) [-2337.494] -- 0:03:30
      261000 -- (-2331.391) (-2326.933) [-2329.283] (-2328.881) * (-2333.568) (-2334.669) [-2330.882] (-2337.291) -- 0:03:29
      261500 -- (-2334.558) (-2340.120) (-2341.321) [-2331.371] * (-2334.354) (-2334.170) [-2328.934] (-2342.055) -- 0:03:28
      262000 -- (-2331.041) (-2334.094) [-2331.881] (-2328.048) * (-2341.126) (-2332.405) [-2332.006] (-2339.271) -- 0:03:28
      262500 -- (-2328.461) (-2327.334) [-2338.561] (-2332.342) * [-2331.044] (-2330.904) (-2329.061) (-2338.902) -- 0:03:30
      263000 -- (-2328.715) (-2331.692) (-2329.484) [-2336.801] * (-2335.784) (-2335.496) [-2330.120] (-2332.754) -- 0:03:30
      263500 -- (-2333.940) (-2334.271) (-2327.044) [-2336.937] * (-2329.604) (-2333.486) [-2329.426] (-2333.206) -- 0:03:29
      264000 -- [-2337.120] (-2331.561) (-2332.564) (-2338.738) * [-2331.512] (-2331.268) (-2332.047) (-2333.919) -- 0:03:29
      264500 -- (-2335.278) [-2324.787] (-2339.036) (-2337.549) * (-2339.518) (-2332.786) [-2334.371] (-2331.163) -- 0:03:28
      265000 -- (-2337.531) [-2330.646] (-2337.046) (-2333.821) * (-2336.119) (-2335.781) (-2330.424) [-2327.903] -- 0:03:28

      Average standard deviation of split frequencies: 0.000591

      265500 -- (-2328.728) (-2326.257) (-2332.898) [-2327.819] * (-2331.085) (-2338.665) (-2333.817) [-2328.099] -- 0:03:27
      266000 -- [-2329.711] (-2332.490) (-2330.764) (-2337.485) * (-2331.345) [-2338.566] (-2328.282) (-2334.197) -- 0:03:29
      266500 -- (-2336.632) (-2333.677) (-2332.704) [-2331.336] * (-2334.750) (-2333.908) [-2333.834] (-2340.742) -- 0:03:29
      267000 -- (-2338.609) [-2335.236] (-2342.856) (-2333.046) * [-2335.596] (-2338.521) (-2349.725) (-2333.520) -- 0:03:28
      267500 -- [-2334.258] (-2335.219) (-2337.188) (-2331.482) * [-2333.616] (-2333.703) (-2337.151) (-2336.749) -- 0:03:28
      268000 -- (-2331.051) (-2335.162) (-2332.775) [-2341.081] * (-2333.635) [-2331.895] (-2335.300) (-2344.948) -- 0:03:27
      268500 -- [-2332.972] (-2336.421) (-2337.323) (-2337.456) * (-2335.482) [-2334.416] (-2331.820) (-2347.497) -- 0:03:27
      269000 -- (-2335.290) [-2331.833] (-2331.283) (-2340.620) * (-2334.401) [-2328.274] (-2335.447) (-2348.190) -- 0:03:26
      269500 -- [-2335.722] (-2329.791) (-2344.495) (-2340.904) * (-2333.008) [-2331.067] (-2339.293) (-2342.148) -- 0:03:28
      270000 -- (-2333.445) [-2330.963] (-2332.433) (-2336.978) * (-2328.431) (-2334.534) (-2341.379) [-2334.996] -- 0:03:28

      Average standard deviation of split frequencies: 0.000000

      270500 -- [-2332.780] (-2337.220) (-2331.194) (-2334.475) * (-2333.459) (-2336.083) [-2336.459] (-2343.935) -- 0:03:27
      271000 -- (-2331.996) (-2331.205) (-2333.271) [-2330.022] * [-2328.492] (-2332.365) (-2333.330) (-2332.788) -- 0:03:27
      271500 -- (-2330.349) (-2331.539) (-2338.271) [-2334.525] * (-2336.440) (-2331.728) [-2332.161] (-2332.639) -- 0:03:26
      272000 -- [-2334.442] (-2331.653) (-2331.134) (-2334.015) * (-2330.429) [-2338.784] (-2333.020) (-2328.851) -- 0:03:26
      272500 -- [-2334.129] (-2330.796) (-2330.185) (-2326.521) * (-2341.543) (-2339.312) [-2333.634] (-2335.478) -- 0:03:25
      273000 -- (-2333.416) (-2334.930) (-2330.626) [-2328.519] * [-2335.393] (-2332.349) (-2335.584) (-2330.858) -- 0:03:27
      273500 -- (-2331.090) (-2337.245) [-2333.211] (-2329.782) * [-2339.229] (-2339.934) (-2332.328) (-2333.308) -- 0:03:27
      274000 -- (-2332.408) (-2343.215) [-2333.046] (-2328.183) * (-2337.602) (-2328.754) (-2333.468) [-2327.131] -- 0:03:26
      274500 -- (-2338.380) [-2336.362] (-2335.551) (-2329.379) * [-2329.894] (-2334.626) (-2333.504) (-2331.356) -- 0:03:26
      275000 -- (-2333.468) (-2332.536) (-2328.725) [-2326.954] * (-2338.148) (-2327.660) (-2342.722) [-2327.501] -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-2328.463] (-2338.515) (-2331.170) (-2327.877) * (-2331.608) [-2329.728] (-2332.243) (-2331.011) -- 0:03:25
      276000 -- [-2331.239] (-2334.781) (-2335.337) (-2332.388) * (-2327.989) (-2338.930) (-2338.627) [-2332.988] -- 0:03:24
      276500 -- (-2335.436) (-2328.866) [-2335.793] (-2330.232) * (-2330.636) (-2332.439) (-2335.212) [-2332.058] -- 0:03:26
      277000 -- (-2340.360) [-2331.311] (-2330.752) (-2344.901) * [-2333.305] (-2332.701) (-2329.134) (-2333.474) -- 0:03:26
      277500 -- [-2330.556] (-2337.543) (-2334.884) (-2333.949) * (-2337.809) [-2331.518] (-2335.453) (-2334.171) -- 0:03:25
      278000 -- (-2339.785) (-2331.817) [-2333.982] (-2335.597) * (-2334.365) (-2330.735) [-2327.459] (-2330.032) -- 0:03:25
      278500 -- (-2338.188) (-2335.060) [-2330.250] (-2336.493) * (-2337.179) (-2330.064) (-2332.552) [-2328.708] -- 0:03:24
      279000 -- [-2331.741] (-2339.902) (-2328.828) (-2333.811) * (-2333.608) (-2327.803) (-2328.157) [-2328.641] -- 0:03:24
      279500 -- [-2332.388] (-2333.033) (-2330.529) (-2335.008) * (-2335.195) (-2334.806) [-2328.632] (-2329.174) -- 0:03:23
      280000 -- (-2329.012) (-2331.881) (-2334.889) [-2330.610] * (-2337.315) (-2333.561) [-2326.243] (-2339.605) -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      280500 -- [-2331.906] (-2337.292) (-2330.969) (-2332.098) * (-2334.720) (-2336.061) [-2331.341] (-2334.008) -- 0:03:25
      281000 -- (-2329.385) (-2338.644) [-2329.361] (-2337.200) * (-2334.979) [-2331.083] (-2329.848) (-2337.982) -- 0:03:24
      281500 -- [-2330.405] (-2332.964) (-2335.139) (-2335.246) * (-2328.203) [-2331.438] (-2334.882) (-2329.767) -- 0:03:24
      282000 -- (-2336.719) (-2339.858) [-2340.964] (-2338.063) * (-2333.599) (-2331.988) (-2338.862) [-2327.645] -- 0:03:23
      282500 -- (-2336.080) (-2330.708) (-2336.271) [-2330.827] * [-2327.643] (-2330.480) (-2336.736) (-2328.812) -- 0:03:23
      283000 -- (-2339.459) (-2334.153) (-2334.245) [-2335.268] * [-2331.146] (-2335.299) (-2333.428) (-2329.961) -- 0:03:22
      283500 -- (-2340.046) [-2328.770] (-2335.235) (-2333.337) * (-2339.926) [-2329.902] (-2335.382) (-2336.947) -- 0:03:24
      284000 -- (-2333.132) (-2334.095) (-2332.972) [-2333.193] * [-2329.436] (-2332.704) (-2335.167) (-2330.503) -- 0:03:24
      284500 -- (-2332.176) [-2337.170] (-2336.546) (-2340.846) * [-2328.476] (-2329.289) (-2334.085) (-2337.819) -- 0:03:23
      285000 -- (-2330.174) (-2331.554) [-2329.894] (-2336.148) * (-2331.891) (-2329.173) [-2337.638] (-2326.220) -- 0:03:23

      Average standard deviation of split frequencies: 0.000549

      285500 -- [-2328.680] (-2332.975) (-2330.055) (-2335.617) * [-2328.866] (-2327.099) (-2333.904) (-2329.299) -- 0:03:22
      286000 -- [-2331.042] (-2334.877) (-2331.413) (-2334.380) * (-2329.367) [-2331.436] (-2333.925) (-2331.405) -- 0:03:22
      286500 -- (-2331.969) [-2331.246] (-2329.861) (-2333.318) * (-2331.707) (-2329.436) (-2331.973) [-2330.257] -- 0:03:21
      287000 -- (-2337.024) [-2331.326] (-2337.395) (-2329.710) * (-2337.518) [-2329.260] (-2334.949) (-2325.353) -- 0:03:23
      287500 -- (-2336.540) [-2332.589] (-2332.642) (-2335.857) * (-2332.807) (-2332.923) (-2335.002) [-2327.392] -- 0:03:23
      288000 -- (-2338.682) (-2328.301) (-2330.833) [-2330.730] * (-2333.333) (-2331.328) [-2328.219] (-2333.855) -- 0:03:22
      288500 -- (-2334.376) [-2342.773] (-2328.476) (-2340.659) * (-2336.459) (-2336.319) (-2342.762) [-2332.690] -- 0:03:22
      289000 -- (-2330.581) (-2336.600) (-2329.388) [-2333.390] * [-2333.086] (-2334.261) (-2336.399) (-2337.341) -- 0:03:21
      289500 -- (-2333.397) (-2341.311) (-2338.774) [-2336.514] * (-2331.865) [-2329.457] (-2336.239) (-2334.423) -- 0:03:21
      290000 -- [-2331.065] (-2336.945) (-2328.569) (-2333.160) * (-2333.688) (-2337.195) (-2332.017) [-2328.155] -- 0:03:20

      Average standard deviation of split frequencies: 0.000541

      290500 -- [-2332.883] (-2336.575) (-2337.343) (-2333.639) * (-2338.800) (-2336.660) [-2332.421] (-2336.481) -- 0:03:22
      291000 -- (-2331.656) [-2340.461] (-2337.810) (-2334.247) * (-2332.819) (-2332.735) (-2335.217) [-2332.299] -- 0:03:22
      291500 -- (-2334.043) (-2336.126) [-2336.124] (-2337.417) * (-2335.513) [-2339.464] (-2331.108) (-2326.265) -- 0:03:21
      292000 -- [-2333.293] (-2337.135) (-2338.788) (-2333.860) * (-2339.155) (-2333.261) (-2336.290) [-2331.264] -- 0:03:21
      292500 -- (-2340.272) (-2334.125) [-2327.724] (-2330.353) * [-2328.271] (-2339.275) (-2329.547) (-2335.625) -- 0:03:20
      293000 -- [-2334.027] (-2336.095) (-2330.396) (-2336.569) * (-2328.797) (-2340.499) [-2333.403] (-2330.374) -- 0:03:20
      293500 -- (-2337.631) (-2336.671) (-2330.209) [-2328.678] * (-2328.176) (-2331.174) [-2332.077] (-2329.058) -- 0:03:19
      294000 -- (-2343.803) [-2335.992] (-2331.168) (-2330.393) * (-2331.093) (-2333.284) [-2334.887] (-2332.586) -- 0:03:21
      294500 -- (-2333.031) (-2334.827) (-2325.838) [-2334.402] * (-2331.188) (-2331.426) (-2331.188) [-2334.753] -- 0:03:21
      295000 -- (-2334.012) [-2335.162] (-2329.652) (-2332.066) * (-2336.296) (-2333.624) [-2331.421] (-2335.130) -- 0:03:20

      Average standard deviation of split frequencies: 0.000531

      295500 -- [-2339.191] (-2331.891) (-2336.961) (-2330.748) * (-2337.884) (-2329.105) [-2332.377] (-2339.438) -- 0:03:20
      296000 -- (-2335.625) [-2334.264] (-2340.310) (-2334.397) * (-2337.850) (-2330.103) (-2333.589) [-2334.148] -- 0:03:19
      296500 -- [-2335.293] (-2337.986) (-2333.062) (-2331.904) * (-2335.644) [-2325.815] (-2331.786) (-2333.234) -- 0:03:19
      297000 -- (-2333.541) (-2339.604) (-2331.160) [-2330.989] * [-2329.492] (-2330.187) (-2332.573) (-2331.100) -- 0:03:18
      297500 -- (-2334.903) (-2329.108) [-2335.938] (-2338.119) * (-2332.264) (-2333.687) (-2329.132) [-2331.068] -- 0:03:20
      298000 -- (-2336.899) (-2334.581) (-2335.588) [-2333.147] * (-2335.708) [-2327.381] (-2338.263) (-2330.818) -- 0:03:20
      298500 -- (-2334.274) [-2331.444] (-2336.060) (-2331.080) * (-2333.876) (-2334.749) (-2336.397) [-2333.757] -- 0:03:19
      299000 -- (-2340.620) [-2335.396] (-2325.483) (-2327.274) * (-2337.398) (-2334.968) (-2336.143) [-2336.869] -- 0:03:19
      299500 -- [-2334.199] (-2332.339) (-2332.868) (-2334.164) * (-2335.818) (-2340.946) [-2331.020] (-2338.399) -- 0:03:18
      300000 -- [-2334.637] (-2325.676) (-2339.143) (-2336.428) * (-2337.568) (-2339.579) (-2331.748) [-2341.294] -- 0:03:18

      Average standard deviation of split frequencies: 0.000523

      300500 -- [-2330.721] (-2330.611) (-2333.993) (-2334.859) * [-2331.655] (-2335.782) (-2330.660) (-2334.359) -- 0:03:17
      301000 -- (-2329.145) [-2327.732] (-2340.074) (-2338.944) * [-2328.231] (-2336.085) (-2337.731) (-2338.317) -- 0:03:19
      301500 -- (-2339.792) (-2325.947) [-2340.141] (-2337.556) * [-2332.471] (-2337.036) (-2340.881) (-2334.776) -- 0:03:19
      302000 -- (-2340.380) [-2328.484] (-2330.926) (-2339.432) * [-2333.092] (-2334.098) (-2336.569) (-2329.466) -- 0:03:18
      302500 -- [-2333.470] (-2335.645) (-2334.975) (-2335.564) * (-2334.592) (-2335.519) (-2348.618) [-2329.408] -- 0:03:18
      303000 -- (-2339.787) (-2333.686) [-2329.631] (-2335.923) * [-2329.204] (-2337.080) (-2331.798) (-2332.440) -- 0:03:17
      303500 -- (-2333.912) (-2329.995) (-2333.426) [-2332.889] * (-2336.417) (-2333.888) [-2334.626] (-2334.507) -- 0:03:17
      304000 -- (-2329.130) (-2331.909) [-2334.149] (-2332.466) * [-2333.370] (-2338.228) (-2329.675) (-2332.273) -- 0:03:16
      304500 -- [-2333.933] (-2333.139) (-2337.451) (-2334.554) * (-2332.645) (-2335.252) [-2334.687] (-2332.282) -- 0:03:16
      305000 -- (-2333.302) (-2331.426) [-2339.395] (-2331.348) * (-2331.697) (-2334.228) (-2334.536) [-2329.463] -- 0:03:18

      Average standard deviation of split frequencies: 0.001027

      305500 -- (-2336.123) (-2331.481) (-2341.479) [-2325.352] * (-2335.116) [-2335.136] (-2337.712) (-2327.296) -- 0:03:17
      306000 -- (-2344.661) (-2334.004) [-2339.000] (-2333.935) * (-2335.618) (-2328.671) (-2338.194) [-2334.428] -- 0:03:17
      306500 -- [-2332.491] (-2333.202) (-2331.032) (-2329.505) * (-2329.610) (-2341.656) (-2332.156) [-2330.141] -- 0:03:16
      307000 -- (-2331.677) [-2331.920] (-2335.436) (-2334.463) * (-2332.759) (-2341.607) (-2329.650) [-2334.387] -- 0:03:16
      307500 -- (-2333.364) [-2332.131] (-2333.419) (-2335.640) * (-2338.603) (-2340.152) [-2331.697] (-2332.886) -- 0:03:15
      308000 -- (-2334.014) (-2340.749) (-2328.900) [-2336.381] * (-2329.834) (-2332.221) (-2333.172) [-2329.739] -- 0:03:15
      308500 -- (-2331.474) (-2335.240) (-2332.227) [-2330.362] * [-2329.942] (-2339.466) (-2333.139) (-2327.939) -- 0:03:17
      309000 -- [-2336.054] (-2332.398) (-2339.034) (-2337.351) * [-2331.523] (-2346.068) (-2334.740) (-2342.256) -- 0:03:16
      309500 -- (-2339.088) (-2343.023) [-2328.745] (-2325.501) * (-2338.225) [-2334.680] (-2331.411) (-2333.550) -- 0:03:16
      310000 -- (-2335.294) (-2342.828) (-2333.352) [-2328.552] * (-2339.561) (-2334.941) (-2335.114) [-2333.922] -- 0:03:15

      Average standard deviation of split frequencies: 0.001012

      310500 -- (-2338.513) (-2332.259) (-2335.190) [-2329.908] * (-2337.101) (-2339.463) (-2336.494) [-2328.031] -- 0:03:15
      311000 -- (-2330.131) [-2334.489] (-2335.556) (-2329.001) * (-2335.729) [-2339.070] (-2332.393) (-2330.660) -- 0:03:14
      311500 -- [-2329.491] (-2337.307) (-2331.938) (-2337.224) * (-2329.865) (-2334.191) [-2329.675] (-2330.195) -- 0:03:14
      312000 -- [-2334.076] (-2335.994) (-2333.119) (-2333.965) * (-2340.685) (-2336.299) (-2329.167) [-2334.460] -- 0:03:16
      312500 -- (-2333.398) [-2330.567] (-2341.444) (-2332.918) * [-2332.424] (-2331.803) (-2331.525) (-2346.083) -- 0:03:15
      313000 -- [-2330.953] (-2328.325) (-2333.676) (-2333.613) * (-2334.646) (-2338.796) [-2330.306] (-2345.147) -- 0:03:15
      313500 -- [-2328.826] (-2332.842) (-2333.671) (-2336.158) * [-2337.744] (-2341.052) (-2336.040) (-2341.749) -- 0:03:14
      314000 -- (-2329.765) (-2335.158) [-2329.010] (-2330.722) * (-2332.122) (-2339.151) (-2334.358) [-2334.927] -- 0:03:14
      314500 -- (-2332.448) [-2332.477] (-2347.471) (-2330.484) * (-2332.053) (-2340.448) (-2334.534) [-2333.023] -- 0:03:13
      315000 -- (-2332.723) (-2335.059) [-2331.530] (-2331.449) * [-2333.641] (-2332.309) (-2331.805) (-2338.659) -- 0:03:13

      Average standard deviation of split frequencies: 0.000995

      315500 -- (-2329.879) [-2334.732] (-2328.291) (-2332.071) * (-2335.339) (-2331.572) [-2335.843] (-2328.267) -- 0:03:15
      316000 -- [-2330.494] (-2330.711) (-2332.221) (-2335.724) * [-2330.119] (-2336.984) (-2328.973) (-2330.054) -- 0:03:14
      316500 -- (-2334.947) (-2336.700) [-2330.316] (-2332.719) * (-2328.160) [-2332.950] (-2334.753) (-2340.241) -- 0:03:14
      317000 -- [-2335.179] (-2333.292) (-2337.464) (-2339.860) * (-2334.787) [-2334.659] (-2334.888) (-2332.681) -- 0:03:13
      317500 -- (-2338.601) (-2336.496) [-2328.759] (-2332.840) * (-2334.024) (-2336.093) (-2341.320) [-2336.749] -- 0:03:13
      318000 -- (-2338.250) [-2334.237] (-2328.902) (-2336.649) * (-2340.117) [-2332.257] (-2329.914) (-2328.831) -- 0:03:13
      318500 -- (-2336.231) [-2331.412] (-2327.579) (-2327.339) * [-2329.114] (-2332.165) (-2334.646) (-2333.134) -- 0:03:12
      319000 -- (-2342.742) (-2333.594) [-2329.667] (-2334.239) * (-2329.368) (-2336.388) (-2344.508) [-2332.887] -- 0:03:14
      319500 -- (-2339.972) [-2329.632] (-2333.303) (-2335.228) * (-2330.300) [-2334.736] (-2333.467) (-2336.558) -- 0:03:13
      320000 -- (-2329.385) [-2332.883] (-2331.940) (-2334.497) * (-2331.841) [-2326.003] (-2332.320) (-2340.720) -- 0:03:13

      Average standard deviation of split frequencies: 0.000980

      320500 -- (-2333.287) [-2335.229] (-2338.311) (-2332.949) * [-2329.350] (-2334.316) (-2334.359) (-2337.721) -- 0:03:12
      321000 -- (-2329.493) (-2331.436) [-2335.544] (-2332.491) * [-2332.075] (-2334.400) (-2336.674) (-2329.932) -- 0:03:12
      321500 -- (-2329.020) [-2330.472] (-2337.822) (-2333.832) * [-2329.715] (-2337.637) (-2330.149) (-2331.015) -- 0:03:12
      322000 -- (-2333.136) [-2333.429] (-2333.111) (-2328.211) * (-2333.096) [-2329.858] (-2330.161) (-2335.350) -- 0:03:11
      322500 -- [-2331.729] (-2334.440) (-2335.617) (-2328.264) * (-2334.253) (-2335.314) [-2335.010] (-2334.135) -- 0:03:13
      323000 -- (-2336.729) (-2330.997) [-2335.117] (-2332.315) * (-2334.331) (-2341.590) [-2329.964] (-2329.310) -- 0:03:12
      323500 -- (-2341.565) (-2335.775) [-2327.641] (-2339.069) * (-2338.157) (-2342.235) (-2334.506) [-2334.557] -- 0:03:12
      324000 -- (-2333.246) (-2333.057) [-2329.941] (-2340.757) * (-2339.827) [-2334.126] (-2333.945) (-2332.662) -- 0:03:11
      324500 -- (-2337.342) (-2330.837) [-2329.173] (-2332.047) * (-2340.102) [-2330.216] (-2332.164) (-2329.341) -- 0:03:11
      325000 -- (-2337.181) (-2330.656) (-2330.773) [-2327.452] * (-2336.149) (-2331.240) (-2332.167) [-2326.618] -- 0:03:11

      Average standard deviation of split frequencies: 0.000964

      325500 -- (-2335.348) (-2335.155) (-2336.182) [-2333.806] * [-2331.370] (-2330.194) (-2337.630) (-2333.335) -- 0:03:10
      326000 -- (-2333.760) [-2330.581] (-2343.410) (-2329.884) * (-2333.090) [-2328.393] (-2339.133) (-2330.351) -- 0:03:12
      326500 -- (-2333.696) (-2332.900) (-2329.289) [-2330.364] * [-2328.529] (-2331.561) (-2338.063) (-2338.171) -- 0:03:11
      327000 -- [-2330.431] (-2336.832) (-2331.314) (-2332.505) * (-2341.315) (-2334.716) (-2337.757) [-2332.937] -- 0:03:11
      327500 -- (-2335.960) (-2336.071) (-2333.129) [-2332.022] * [-2328.203] (-2338.207) (-2344.052) (-2334.378) -- 0:03:10
      328000 -- (-2334.137) (-2331.687) (-2330.275) [-2331.830] * (-2334.283) (-2336.133) (-2340.552) [-2331.708] -- 0:03:10
      328500 -- (-2332.748) (-2332.508) (-2336.091) [-2328.663] * (-2333.822) [-2335.985] (-2333.061) (-2329.051) -- 0:03:10
      329000 -- (-2334.613) [-2332.662] (-2333.551) (-2342.533) * (-2332.877) (-2338.198) [-2330.289] (-2340.233) -- 0:03:09
      329500 -- (-2338.988) (-2335.766) [-2329.773] (-2330.308) * (-2328.348) (-2337.123) [-2331.183] (-2331.377) -- 0:03:11
      330000 -- (-2342.101) [-2333.619] (-2331.700) (-2332.825) * (-2332.827) [-2334.436] (-2334.604) (-2326.490) -- 0:03:10

      Average standard deviation of split frequencies: 0.000950

      330500 -- (-2330.369) [-2328.850] (-2334.627) (-2338.162) * (-2331.382) (-2340.265) (-2333.315) [-2327.335] -- 0:03:10
      331000 -- (-2335.736) [-2331.595] (-2337.738) (-2342.578) * (-2332.009) [-2328.493] (-2331.763) (-2333.486) -- 0:03:09
      331500 -- [-2332.402] (-2336.547) (-2336.683) (-2337.176) * [-2333.287] (-2326.939) (-2331.781) (-2330.026) -- 0:03:09
      332000 -- (-2328.023) (-2333.982) [-2333.306] (-2338.691) * (-2335.181) (-2328.513) [-2329.410] (-2333.370) -- 0:03:09
      332500 -- (-2335.404) (-2328.499) (-2330.826) [-2326.543] * (-2336.823) [-2328.232] (-2333.328) (-2332.498) -- 0:03:08
      333000 -- [-2328.145] (-2328.950) (-2336.142) (-2330.146) * (-2335.064) [-2327.430] (-2338.948) (-2338.075) -- 0:03:10
      333500 -- (-2329.384) [-2329.035] (-2334.166) (-2333.975) * (-2332.302) (-2334.128) (-2331.294) [-2332.474] -- 0:03:09
      334000 -- (-2329.775) (-2327.252) (-2334.556) [-2335.323] * [-2336.912] (-2337.270) (-2327.652) (-2330.791) -- 0:03:09
      334500 -- (-2336.785) (-2334.826) [-2331.047] (-2334.686) * (-2331.455) (-2341.060) [-2331.668] (-2335.781) -- 0:03:09
      335000 -- (-2336.380) [-2332.597] (-2335.124) (-2335.426) * (-2333.766) (-2336.914) [-2329.635] (-2332.182) -- 0:03:08

      Average standard deviation of split frequencies: 0.001403

      335500 -- (-2330.309) (-2331.598) (-2333.877) [-2334.240] * (-2332.833) (-2338.618) (-2334.047) [-2333.588] -- 0:03:08
      336000 -- (-2331.698) (-2334.924) [-2329.572] (-2333.883) * (-2332.073) [-2334.056] (-2331.106) (-2336.931) -- 0:03:07
      336500 -- (-2330.096) (-2331.309) [-2334.981] (-2332.426) * (-2333.943) (-2333.806) [-2326.836] (-2335.809) -- 0:03:09
      337000 -- [-2332.120] (-2337.540) (-2336.453) (-2329.426) * (-2335.423) (-2336.996) [-2340.563] (-2337.727) -- 0:03:08
      337500 -- (-2329.146) (-2334.785) [-2328.643] (-2332.032) * (-2336.983) (-2335.822) (-2336.744) [-2333.058] -- 0:03:08
      338000 -- (-2331.602) [-2329.875] (-2334.988) (-2329.846) * (-2340.852) [-2333.196] (-2342.900) (-2330.135) -- 0:03:08
      338500 -- (-2344.808) [-2337.132] (-2333.579) (-2335.785) * [-2329.731] (-2343.516) (-2333.065) (-2332.225) -- 0:03:07
      339000 -- (-2333.946) (-2330.883) (-2336.087) [-2329.969] * (-2334.961) (-2343.883) [-2333.208] (-2331.361) -- 0:03:07
      339500 -- (-2331.000) [-2333.288] (-2342.055) (-2331.121) * [-2337.366] (-2341.998) (-2330.915) (-2330.683) -- 0:03:06
      340000 -- (-2331.104) (-2335.294) (-2329.297) [-2325.156] * (-2333.758) [-2334.188] (-2329.707) (-2326.388) -- 0:03:08

      Average standard deviation of split frequencies: 0.000923

      340500 -- [-2326.841] (-2331.753) (-2333.104) (-2332.743) * (-2338.588) (-2338.700) [-2332.329] (-2332.694) -- 0:03:07
      341000 -- (-2341.275) (-2334.746) [-2328.267] (-2331.935) * (-2334.052) [-2332.470] (-2338.057) (-2330.394) -- 0:03:07
      341500 -- (-2339.608) (-2332.676) (-2327.783) [-2342.296] * (-2339.558) [-2339.817] (-2329.916) (-2338.679) -- 0:03:07
      342000 -- (-2347.431) (-2336.585) (-2332.525) [-2327.178] * (-2330.044) (-2335.764) (-2329.174) [-2330.264] -- 0:03:06
      342500 -- (-2339.673) (-2332.992) (-2332.053) [-2333.042] * (-2335.577) [-2331.339] (-2332.803) (-2341.888) -- 0:03:06
      343000 -- (-2335.397) (-2336.390) (-2336.799) [-2327.405] * [-2328.874] (-2332.396) (-2333.741) (-2335.279) -- 0:03:05
      343500 -- (-2333.907) [-2330.436] (-2332.985) (-2330.935) * (-2332.354) (-2328.818) [-2331.319] (-2336.686) -- 0:03:07
      344000 -- (-2336.949) (-2329.260) (-2332.758) [-2330.361] * (-2331.026) (-2333.527) [-2331.187] (-2335.759) -- 0:03:06
      344500 -- (-2330.898) [-2328.575] (-2331.514) (-2336.570) * (-2329.731) (-2335.324) [-2327.879] (-2338.512) -- 0:03:06
      345000 -- [-2332.362] (-2332.797) (-2338.023) (-2334.602) * (-2329.815) (-2335.179) (-2341.112) [-2333.856] -- 0:03:06

      Average standard deviation of split frequencies: 0.000454

      345500 -- (-2330.294) (-2342.839) [-2333.288] (-2335.779) * [-2332.956] (-2333.391) (-2338.258) (-2334.884) -- 0:03:05
      346000 -- (-2332.922) [-2330.142] (-2336.599) (-2330.466) * [-2326.835] (-2333.200) (-2336.689) (-2328.692) -- 0:03:05
      346500 -- (-2331.627) [-2332.187] (-2334.987) (-2332.248) * (-2339.086) [-2331.364] (-2336.724) (-2337.316) -- 0:03:04
      347000 -- (-2336.915) (-2333.225) [-2330.199] (-2334.704) * (-2338.602) (-2336.889) (-2333.676) [-2332.532] -- 0:03:06
      347500 -- (-2333.433) (-2333.713) [-2328.084] (-2338.419) * (-2328.334) (-2330.460) [-2333.190] (-2333.786) -- 0:03:05
      348000 -- (-2334.093) (-2332.493) [-2334.938] (-2339.325) * (-2335.789) [-2330.890] (-2338.528) (-2331.350) -- 0:03:05
      348500 -- [-2335.983] (-2331.290) (-2334.693) (-2327.925) * (-2333.690) (-2332.293) (-2328.933) [-2331.745] -- 0:03:05
      349000 -- [-2336.805] (-2332.867) (-2338.469) (-2332.304) * (-2329.229) [-2337.490] (-2334.402) (-2336.806) -- 0:03:04
      349500 -- (-2332.713) (-2332.670) (-2332.337) [-2335.248] * (-2333.645) (-2334.370) (-2337.111) [-2326.030] -- 0:03:04
      350000 -- (-2331.750) [-2334.146] (-2334.916) (-2333.576) * (-2336.317) [-2330.946] (-2331.334) (-2336.255) -- 0:03:03

      Average standard deviation of split frequencies: 0.000448

      350500 -- [-2336.122] (-2334.166) (-2334.697) (-2338.183) * [-2337.323] (-2333.233) (-2335.612) (-2337.045) -- 0:03:05
      351000 -- (-2336.566) [-2327.842] (-2336.844) (-2329.413) * (-