--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 09 15:50:33 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip102B-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1295.12 -1304.58
2 -1295.03 -1303.97
--------------------------------------
TOTAL -1295.07 -1304.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.297719 0.003618 0.199934 0.423979 0.290921 1026.77 1061.17 1.000
r(A<->C){all} 0.047299 0.000950 0.000143 0.102876 0.042430 428.51 647.53 1.000
r(A<->G){all} 0.200959 0.003074 0.097556 0.305210 0.196925 420.49 517.88 1.000
r(A<->T){all} 0.127565 0.001420 0.060654 0.201857 0.124383 881.45 951.96 1.000
r(C<->G){all} 0.086777 0.001632 0.020755 0.170239 0.081863 793.70 846.63 1.000
r(C<->T){all} 0.463522 0.006016 0.315705 0.617108 0.463273 573.90 634.31 1.000
r(G<->T){all} 0.073878 0.001112 0.013002 0.139985 0.070200 683.94 817.56 1.000
pi(A){all} 0.291690 0.000325 0.258985 0.328770 0.291633 1348.36 1402.75 1.000
pi(C){all} 0.189153 0.000218 0.160937 0.218724 0.188776 1366.36 1387.27 1.000
pi(G){all} 0.221292 0.000255 0.192169 0.254741 0.221193 1237.29 1369.15 1.000
pi(T){all} 0.297866 0.000313 0.261829 0.331793 0.297472 1215.58 1308.40 1.000
alpha{1,2} 0.062092 0.002363 0.000135 0.153387 0.052750 1402.60 1406.33 1.000
alpha{3} 1.792035 0.578672 0.590664 3.339903 1.656158 1198.90 1275.82 1.001
pinvar{all} 0.388731 0.014175 0.129530 0.593832 0.402546 1141.46 1257.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1223.323119
Model 2: PositiveSelection -1223.323119
Model 0: one-ratio -1223.692769
Model 3: discrete -1222.999647
Model 7: beta -1223.046413
Model 8: beta&w>1 -1223.046482
Model 0 vs 1 0.7393000000001848
Model 2 vs 1 0.0
Model 8 vs 7 1.3799999987895717E-4
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESRDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH
o
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESRDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=202
C1 MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C2 MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C3 MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C4 MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C5 MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
******.***:*.* ***********************************
C1 IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C2 IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C3 IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C4 IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
C5 IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
*********************************************:****
C1 YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
C2 YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
C3 YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
C4 YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
C5 YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
*********************************************::***
C1 QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
C2 QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
C3 QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
C4 QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
C5 QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
**:* ****** **:*: *.****:******.*:***********:**:
C1 H-
C2 H-
C3 H-
C4 Ho
C5 Ho
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4098]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4098]--->[4092]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.272 Mb, Max= 30.515 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
Ho
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
Ho
FORMAT of file /tmp/tmp4253595435401105075aln Not Supported[FATAL:T-COFFEE]
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
Ho
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
Ho
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:202 S:99 BS:202
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 98.51 C1 C2 98.51
TOP 1 0 98.51 C2 C1 98.51
BOT 0 2 98.51 C1 C3 98.51
TOP 2 0 98.51 C3 C1 98.51
BOT 0 3 93.50 C1 C4 93.50
TOP 3 0 93.50 C4 C1 93.50
BOT 0 4 94.50 C1 C5 94.50
TOP 4 0 94.50 C5 C1 94.50
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 93.00 C2 C4 93.00
TOP 3 1 93.00 C4 C2 93.00
BOT 1 4 94.00 C2 C5 94.00
TOP 4 1 94.00 C5 C2 94.00
BOT 2 3 93.00 C3 C4 93.00
TOP 3 2 93.00 C4 C3 93.00
BOT 2 4 94.00 C3 C5 94.00
TOP 4 2 94.00 C5 C3 94.00
BOT 3 4 95.02 C4 C5 95.02
TOP 4 3 95.02 C5 C4 95.02
AVG 0 C1 * 96.25
AVG 1 C2 * 96.38
AVG 2 C3 * 96.38
AVG 3 C4 * 93.63
AVG 4 C5 * 94.38
TOT TOT * 95.40
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA
C2 ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
C3 ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
C4 ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA
C5 ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA
***********.** ** * ******.**** **** ***** ******
C1 AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG
C2 AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
C3 AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
C4 AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG
C5 AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG
************************:***********.** ** *******
C1 ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
C2 ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
C3 ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
C4 ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG
C5 ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
**********.*****************.************** ******
C1 ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
C2 ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
C3 ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
C4 ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
C5 ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG
**************.*****************.************** **
C1 ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C2 ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C3 ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C4 GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA
C5 GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA
.***** **:** **** ***********:*******************
C1 GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C2 GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C3 GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C4 GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG
C5 GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT
*******:** **.*****.********:******:******** ****
C1 TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC
C2 TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
C3 TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
C4 TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC
C5 TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC
********.*****.***********.** ** ***** ** **.*****
C1 CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C2 CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C3 CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C4 TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA
C5 CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA
********:********.** ****************************
C1 CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT
C2 CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
C3 CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
C4 CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT
C5 CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT
**** ****** ************* **.******** :****.******
C1 CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C2 CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C3 CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C4 CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA
C5 CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA
***** .***** .* ************* ** *:*******.****
C1 TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA
C2 TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA
C3 TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA
C4 TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA
C5 CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA
:*.:.****.* ********:*** ** ***************** *:*
C1 TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT
C2 TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
C3 TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
C4 TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG
C5 TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG
**.********** ********:** **.********: **********
C1 CAC---
C2 CAC---
C3 CAC---
C4 CAC---
C5 CAC---
***
>C1
ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT
CAC---
>C2
ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
CAC---
>C3
ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
CAC---
>C4
ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG
ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA
GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG
TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC
TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT
CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA
TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA
TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG
CAC---
>C5
ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA
AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG
ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG
GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA
GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT
TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC
CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT
CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA
CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA
TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG
CAC---
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESRoDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
H
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESRoDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
H
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 606 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481298401
Setting output file names to "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 852051000
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1250857571
Seed = 1309533329
Swapseed = 1481298401
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 20 unique site patterns
Division 2 has 13 unique site patterns
Division 3 has 44 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1629.573097 -- -25.624409
Chain 2 -- -1591.347569 -- -25.624409
Chain 3 -- -1622.947813 -- -25.624409
Chain 4 -- -1631.814130 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1622.947813 -- -25.624409
Chain 2 -- -1549.546348 -- -25.624409
Chain 3 -- -1637.124480 -- -25.624409
Chain 4 -- -1631.175648 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1629.573] (-1591.348) (-1622.948) (-1631.814) * [-1622.948] (-1549.546) (-1637.124) (-1631.176)
500 -- (-1319.151) (-1318.427) (-1309.701) [-1312.387] * (-1327.694) [-1320.777] (-1322.939) (-1321.567) -- 0:00:00
1000 -- (-1314.780) (-1316.884) (-1312.051) [-1308.140] * (-1328.910) [-1316.793] (-1312.884) (-1317.993) -- 0:00:00
1500 -- (-1311.331) (-1312.621) (-1309.375) [-1305.583] * [-1312.351] (-1307.879) (-1318.740) (-1315.836) -- 0:00:00
2000 -- (-1313.553) (-1311.180) (-1312.609) [-1303.209] * (-1309.801) [-1312.076] (-1314.766) (-1322.612) -- 0:00:00
2500 -- (-1310.536) (-1307.865) (-1306.560) [-1302.404] * (-1303.396) [-1301.534] (-1309.363) (-1315.916) -- 0:00:00
3000 -- (-1313.609) [-1296.814] (-1310.733) (-1304.715) * (-1304.955) (-1300.129) [-1309.593] (-1307.405) -- 0:05:32
3500 -- (-1311.081) (-1304.576) (-1311.060) [-1301.113] * (-1296.488) (-1298.338) [-1306.827] (-1307.230) -- 0:04:44
4000 -- (-1306.429) (-1298.532) (-1299.716) [-1300.810] * (-1298.025) [-1297.418] (-1305.035) (-1303.446) -- 0:04:09
4500 -- (-1295.027) (-1300.157) (-1304.420) [-1296.646] * [-1294.421] (-1297.225) (-1303.053) (-1302.861) -- 0:03:41
5000 -- [-1296.365] (-1297.037) (-1304.878) (-1298.323) * (-1298.115) [-1295.173] (-1299.647) (-1301.584) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-1300.609) (-1296.329) [-1296.298] (-1298.135) * (-1298.053) (-1298.576) [-1304.361] (-1296.296) -- 0:03:00
6000 -- (-1296.817) (-1301.513) (-1300.686) [-1294.020] * [-1294.880] (-1296.980) (-1302.086) (-1294.154) -- 0:02:45
6500 -- (-1294.075) [-1297.996] (-1301.800) (-1308.041) * (-1304.028) (-1301.503) (-1297.546) [-1297.462] -- 0:02:32
7000 -- [-1295.289] (-1296.636) (-1310.244) (-1299.205) * (-1304.653) (-1298.937) (-1297.018) [-1294.606] -- 0:02:21
7500 -- (-1300.445) [-1302.580] (-1298.186) (-1296.178) * (-1313.566) [-1301.720] (-1298.725) (-1298.414) -- 0:02:12
8000 -- [-1298.682] (-1296.285) (-1299.645) (-1297.438) * (-1309.264) (-1301.573) (-1294.971) [-1297.996] -- 0:02:04
8500 -- (-1296.971) [-1296.805] (-1298.899) (-1298.657) * (-1309.676) (-1295.944) [-1293.263] (-1294.455) -- 0:03:53
9000 -- (-1295.222) (-1296.176) [-1298.930] (-1303.037) * (-1304.969) (-1298.429) (-1297.157) [-1295.341] -- 0:03:40
9500 -- (-1295.911) (-1302.454) (-1300.428) [-1301.569] * (-1314.084) (-1295.939) [-1294.787] (-1297.851) -- 0:03:28
10000 -- (-1297.529) [-1297.251] (-1301.560) (-1296.936) * (-1303.574) [-1301.924] (-1300.468) (-1295.488) -- 0:03:18
Average standard deviation of split frequencies: 0.000000
10500 -- (-1305.379) [-1292.324] (-1294.571) (-1298.983) * (-1303.160) (-1299.829) [-1296.615] (-1295.381) -- 0:03:08
11000 -- (-1299.108) [-1293.573] (-1297.762) (-1299.672) * (-1310.499) (-1299.618) (-1295.137) [-1295.922] -- 0:02:59
11500 -- (-1302.156) [-1299.669] (-1300.349) (-1297.190) * (-1308.982) (-1300.469) [-1295.615] (-1300.505) -- 0:02:51
12000 -- (-1302.003) (-1299.065) [-1299.700] (-1293.437) * [-1313.132] (-1300.523) (-1296.059) (-1296.128) -- 0:02:44
12500 -- (-1303.200) (-1295.811) (-1299.580) [-1295.811] * (-1302.139) (-1299.289) [-1294.186] (-1301.334) -- 0:02:38
13000 -- (-1304.425) (-1294.643) [-1299.824] (-1300.976) * [-1301.477] (-1297.611) (-1299.814) (-1300.006) -- 0:02:31
13500 -- (-1297.721) (-1300.688) (-1299.545) [-1296.375] * (-1307.384) [-1294.682] (-1298.131) (-1295.536) -- 0:02:26
14000 -- (-1299.399) (-1306.227) [-1293.577] (-1298.786) * (-1301.428) [-1295.279] (-1299.155) (-1298.426) -- 0:02:20
14500 -- (-1298.798) (-1297.214) (-1297.614) [-1299.527] * (-1307.103) (-1305.149) [-1299.445] (-1299.811) -- 0:03:23
15000 -- (-1296.526) (-1298.360) (-1296.336) [-1296.832] * (-1299.857) (-1300.792) (-1302.723) [-1298.416] -- 0:03:17
Average standard deviation of split frequencies: 0.000000
15500 -- (-1291.594) (-1299.388) (-1301.846) [-1296.622] * [-1297.661] (-1300.936) (-1300.823) (-1302.109) -- 0:03:10
16000 -- (-1296.122) [-1300.641] (-1293.219) (-1298.652) * (-1294.859) (-1298.423) (-1291.906) [-1296.157] -- 0:03:04
16500 -- [-1297.743] (-1298.329) (-1293.626) (-1298.397) * (-1300.858) (-1304.183) [-1296.054] (-1296.600) -- 0:02:58
17000 -- (-1300.236) (-1297.826) [-1296.370] (-1298.322) * (-1294.563) (-1295.027) (-1296.403) [-1300.163] -- 0:02:53
17500 -- (-1298.925) [-1301.613] (-1295.642) (-1300.108) * (-1297.075) (-1291.688) [-1296.123] (-1297.898) -- 0:02:48
18000 -- (-1297.508) [-1294.539] (-1294.373) (-1295.362) * [-1297.381] (-1294.091) (-1296.681) (-1297.436) -- 0:02:43
18500 -- (-1302.869) (-1297.878) (-1292.982) [-1296.409] * (-1300.315) [-1296.172] (-1294.893) (-1295.403) -- 0:02:39
19000 -- (-1302.612) (-1294.382) (-1295.603) [-1290.787] * (-1299.186) (-1301.826) (-1297.943) [-1294.828] -- 0:02:34
19500 -- (-1298.284) (-1293.904) (-1292.800) [-1293.343] * (-1296.866) (-1306.356) (-1299.036) [-1298.125] -- 0:02:30
20000 -- (-1300.896) (-1297.621) [-1296.229] (-1297.389) * (-1296.449) (-1303.102) [-1298.385] (-1299.177) -- 0:02:27
Average standard deviation of split frequencies: 0.000000
20500 -- (-1303.794) (-1299.745) [-1294.992] (-1293.220) * [-1293.369] (-1305.884) (-1301.326) (-1300.247) -- 0:03:11
21000 -- (-1304.686) [-1294.962] (-1299.130) (-1296.176) * (-1298.474) (-1296.461) [-1294.752] (-1296.093) -- 0:03:06
21500 -- (-1298.167) (-1293.331) [-1299.522] (-1296.692) * (-1300.277) (-1296.738) [-1299.322] (-1295.762) -- 0:03:02
22000 -- (-1297.314) (-1299.735) (-1298.193) [-1296.129] * [-1296.543] (-1296.018) (-1304.682) (-1304.228) -- 0:02:57
22500 -- (-1297.190) [-1297.012] (-1302.034) (-1299.511) * (-1296.127) (-1299.270) (-1305.416) [-1297.354] -- 0:02:53
23000 -- (-1300.517) (-1301.611) (-1295.336) [-1295.754] * (-1295.707) (-1293.448) (-1317.492) [-1300.143] -- 0:02:49
23500 -- (-1297.577) (-1298.643) (-1301.134) [-1293.070] * (-1302.250) (-1297.253) [-1309.407] (-1299.784) -- 0:02:46
24000 -- (-1301.356) (-1298.866) [-1299.776] (-1293.559) * (-1296.027) (-1291.856) (-1306.440) [-1297.315] -- 0:02:42
24500 -- (-1298.614) [-1298.179] (-1300.500) (-1294.191) * (-1298.310) [-1298.618] (-1301.297) (-1304.157) -- 0:02:39
25000 -- [-1299.130] (-1296.262) (-1301.419) (-1293.819) * (-1296.181) (-1303.774) (-1302.935) [-1299.119] -- 0:02:36
Average standard deviation of split frequencies: 0.000000
25500 -- (-1296.490) (-1301.941) (-1297.584) [-1297.257] * [-1294.053] (-1296.570) (-1297.332) (-1299.174) -- 0:02:32
26000 -- (-1298.386) [-1297.106] (-1292.612) (-1297.834) * [-1294.862] (-1299.006) (-1302.217) (-1304.272) -- 0:02:29
26500 -- (-1298.915) (-1302.127) (-1295.070) [-1298.638] * [-1294.969] (-1302.126) (-1297.237) (-1296.295) -- 0:03:03
27000 -- (-1299.413) (-1310.082) [-1295.034] (-1303.171) * (-1298.056) [-1303.110] (-1299.519) (-1298.668) -- 0:03:00
27500 -- (-1302.370) [-1296.109] (-1294.552) (-1298.776) * [-1296.338] (-1295.521) (-1302.716) (-1297.914) -- 0:02:56
28000 -- (-1296.007) (-1297.555) [-1296.641] (-1305.653) * [-1293.972] (-1298.186) (-1304.061) (-1299.699) -- 0:02:53
28500 -- [-1292.842] (-1299.738) (-1295.222) (-1295.788) * (-1299.444) (-1300.022) [-1295.505] (-1295.766) -- 0:02:50
29000 -- (-1299.255) (-1294.173) (-1300.237) [-1299.239] * (-1295.882) [-1295.553] (-1297.730) (-1297.804) -- 0:02:47
29500 -- [-1299.463] (-1293.925) (-1303.008) (-1294.434) * (-1295.712) (-1296.684) [-1292.269] (-1305.780) -- 0:02:44
30000 -- (-1298.197) (-1294.311) [-1304.134] (-1303.137) * [-1299.498] (-1299.849) (-1294.783) (-1306.730) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
30500 -- (-1299.501) (-1296.385) [-1301.316] (-1301.540) * (-1298.680) (-1300.486) (-1297.057) [-1300.598] -- 0:02:38
31000 -- (-1300.820) (-1307.489) [-1293.432] (-1301.955) * [-1298.048] (-1298.453) (-1298.302) (-1302.016) -- 0:02:36
31500 -- (-1304.694) (-1304.419) [-1295.188] (-1304.691) * (-1295.235) (-1298.506) [-1297.380] (-1297.479) -- 0:02:33
32000 -- (-1301.405) (-1307.575) [-1299.085] (-1302.394) * [-1298.297] (-1299.427) (-1298.484) (-1306.609) -- 0:03:01
32500 -- (-1298.512) (-1309.466) [-1291.622] (-1300.959) * (-1298.382) (-1303.699) [-1297.048] (-1295.480) -- 0:02:58
33000 -- (-1296.874) (-1308.994) [-1296.369] (-1299.665) * [-1295.463] (-1300.567) (-1297.909) (-1294.992) -- 0:02:55
33500 -- (-1296.316) (-1303.310) (-1296.267) [-1300.942] * (-1304.221) [-1292.824] (-1299.186) (-1296.464) -- 0:02:53
34000 -- (-1302.604) [-1302.608] (-1301.492) (-1297.806) * (-1299.043) (-1297.936) [-1298.720] (-1302.985) -- 0:02:50
34500 -- (-1305.398) (-1297.427) [-1297.413] (-1301.923) * [-1297.977] (-1295.528) (-1297.175) (-1298.695) -- 0:02:47
35000 -- [-1295.877] (-1301.188) (-1298.460) (-1305.162) * [-1303.633] (-1295.413) (-1299.228) (-1297.774) -- 0:02:45
Average standard deviation of split frequencies: 0.006547
35500 -- [-1298.139] (-1294.448) (-1302.682) (-1301.259) * (-1298.172) [-1294.073] (-1299.607) (-1297.698) -- 0:02:43
36000 -- (-1304.074) [-1300.123] (-1304.839) (-1301.795) * (-1298.630) (-1302.014) (-1295.587) [-1297.536] -- 0:02:40
36500 -- (-1312.234) [-1298.356] (-1305.218) (-1294.707) * [-1296.949] (-1298.046) (-1302.976) (-1302.269) -- 0:02:38
37000 -- (-1302.074) (-1298.090) [-1302.241] (-1297.645) * (-1295.128) (-1299.511) [-1299.735] (-1298.492) -- 0:02:36
37500 -- (-1299.664) (-1294.340) (-1301.016) [-1301.463] * [-1294.387] (-1302.237) (-1295.977) (-1302.509) -- 0:02:34
38000 -- (-1305.195) (-1295.482) (-1300.619) [-1300.024] * [-1300.505] (-1300.317) (-1298.497) (-1294.721) -- 0:02:57
38500 -- (-1296.750) (-1305.065) [-1299.922] (-1303.428) * (-1298.141) (-1294.956) [-1298.484] (-1298.708) -- 0:02:54
39000 -- (-1299.495) (-1304.612) (-1300.232) [-1303.454] * [-1299.406] (-1297.284) (-1304.903) (-1301.730) -- 0:02:52
39500 -- [-1294.983] (-1301.783) (-1297.998) (-1301.773) * (-1299.522) [-1297.858] (-1305.502) (-1296.161) -- 0:02:50
40000 -- (-1302.912) [-1304.044] (-1301.639) (-1298.570) * (-1292.293) (-1299.147) [-1302.398] (-1306.011) -- 0:02:48
Average standard deviation of split frequencies: 0.011592
40500 -- (-1300.000) (-1299.259) (-1302.171) [-1300.315] * (-1299.036) (-1294.155) (-1301.203) [-1299.070] -- 0:02:45
41000 -- (-1301.817) (-1302.251) (-1304.448) [-1310.803] * (-1296.421) (-1296.534) (-1298.171) [-1298.064] -- 0:02:43
41500 -- (-1301.463) [-1299.181] (-1295.313) (-1315.959) * (-1300.080) [-1294.504] (-1303.985) (-1305.624) -- 0:02:41
42000 -- (-1300.473) (-1300.029) (-1295.937) [-1298.377] * (-1311.433) (-1293.109) [-1294.508] (-1298.746) -- 0:02:39
42500 -- (-1295.683) (-1294.245) [-1300.786] (-1305.946) * (-1301.524) [-1297.763] (-1302.194) (-1302.352) -- 0:02:37
43000 -- (-1301.987) (-1296.567) [-1294.857] (-1296.961) * (-1304.042) (-1302.333) (-1302.620) [-1295.867] -- 0:02:35
43500 -- (-1297.406) (-1295.036) [-1296.825] (-1295.812) * (-1297.487) [-1295.582] (-1305.487) (-1303.453) -- 0:02:33
44000 -- (-1297.070) (-1296.146) (-1294.625) [-1292.575] * (-1295.733) [-1295.907] (-1301.226) (-1297.367) -- 0:02:53
44500 -- (-1296.883) (-1298.889) [-1295.417] (-1297.052) * [-1294.811] (-1305.843) (-1300.318) (-1293.877) -- 0:02:51
45000 -- (-1296.059) (-1298.341) (-1297.669) [-1304.302] * [-1301.826] (-1298.455) (-1300.971) (-1295.380) -- 0:02:49
Average standard deviation of split frequencies: 0.010248
45500 -- (-1298.482) (-1293.716) (-1303.539) [-1304.099] * (-1300.424) [-1296.022] (-1300.596) (-1294.747) -- 0:02:47
46000 -- (-1297.313) [-1293.673] (-1300.673) (-1303.560) * (-1295.497) (-1298.176) (-1300.913) [-1294.045] -- 0:02:45
46500 -- (-1298.283) [-1297.253] (-1307.442) (-1307.576) * (-1301.849) [-1297.727] (-1301.965) (-1295.682) -- 0:02:44
47000 -- (-1309.443) [-1292.943] (-1297.767) (-1302.036) * [-1297.936] (-1296.326) (-1303.115) (-1296.484) -- 0:02:42
47500 -- (-1303.019) (-1293.155) [-1299.929] (-1298.650) * (-1295.233) (-1294.099) [-1298.322] (-1298.418) -- 0:02:40
48000 -- [-1297.300] (-1297.665) (-1303.246) (-1303.905) * (-1295.988) (-1296.702) (-1298.359) [-1297.151] -- 0:02:38
48500 -- (-1301.473) [-1294.938] (-1301.566) (-1301.954) * (-1296.678) (-1297.020) [-1293.532] (-1296.478) -- 0:02:36
49000 -- (-1304.662) (-1299.954) [-1300.898] (-1301.452) * (-1305.283) (-1296.746) [-1297.654] (-1297.708) -- 0:02:35
49500 -- (-1299.247) [-1300.695] (-1298.737) (-1301.450) * [-1293.494] (-1295.119) (-1307.608) (-1295.448) -- 0:02:52
50000 -- (-1297.426) (-1298.696) [-1300.532] (-1299.213) * [-1294.945] (-1297.426) (-1294.019) (-1304.015) -- 0:02:51
Average standard deviation of split frequencies: 0.009304
50500 -- (-1304.226) [-1296.182] (-1295.590) (-1297.946) * (-1293.818) [-1296.259] (-1297.374) (-1299.528) -- 0:02:49
51000 -- (-1300.865) (-1298.030) (-1293.850) [-1300.155] * (-1298.084) [-1295.435] (-1299.536) (-1299.161) -- 0:02:47
51500 -- (-1299.795) [-1298.641] (-1294.489) (-1299.474) * (-1302.149) [-1296.837] (-1297.309) (-1302.559) -- 0:02:45
52000 -- (-1297.783) [-1298.380] (-1293.034) (-1298.118) * (-1301.533) (-1297.519) (-1299.466) [-1296.766] -- 0:02:44
52500 -- (-1295.518) (-1309.294) (-1302.823) [-1296.613] * (-1300.459) [-1300.069] (-1300.454) (-1300.020) -- 0:02:42
53000 -- (-1297.701) (-1302.328) [-1298.970] (-1298.099) * [-1295.027] (-1297.540) (-1305.916) (-1296.504) -- 0:02:40
53500 -- (-1298.699) [-1299.334] (-1296.720) (-1294.624) * (-1308.793) [-1299.092] (-1300.315) (-1294.134) -- 0:02:39
54000 -- [-1295.294] (-1299.768) (-1297.268) (-1298.724) * (-1297.576) (-1298.196) (-1298.989) [-1294.424] -- 0:02:37
54500 -- (-1303.405) [-1295.598] (-1298.146) (-1295.649) * (-1298.013) [-1301.293] (-1298.522) (-1296.544) -- 0:02:36
55000 -- (-1301.460) [-1296.897] (-1300.267) (-1304.085) * (-1301.467) [-1300.708] (-1295.311) (-1296.978) -- 0:02:34
Average standard deviation of split frequencies: 0.008418
55500 -- (-1306.819) (-1293.802) (-1303.634) [-1298.333] * (-1294.470) [-1309.811] (-1301.483) (-1292.529) -- 0:02:50
56000 -- (-1296.720) (-1295.752) [-1296.904] (-1296.623) * (-1298.057) (-1300.738) [-1295.314] (-1296.682) -- 0:02:48
56500 -- (-1298.373) (-1295.380) [-1298.728] (-1294.675) * (-1301.331) [-1297.731] (-1298.774) (-1294.342) -- 0:02:46
57000 -- (-1296.540) (-1296.225) (-1302.191) [-1297.802] * (-1298.669) [-1297.771] (-1308.064) (-1300.823) -- 0:02:45
57500 -- (-1304.376) (-1295.790) [-1297.473] (-1298.791) * [-1293.579] (-1302.409) (-1297.522) (-1300.940) -- 0:02:43
58000 -- (-1301.923) [-1297.965] (-1295.893) (-1300.042) * (-1298.539) (-1306.100) (-1300.829) [-1295.626] -- 0:02:42
58500 -- [-1300.225] (-1300.937) (-1295.426) (-1303.399) * [-1304.173] (-1299.870) (-1300.648) (-1300.732) -- 0:02:40
59000 -- (-1299.336) (-1303.115) (-1299.087) [-1298.488] * (-1301.935) (-1303.936) [-1300.498] (-1296.079) -- 0:02:39
59500 -- (-1296.756) [-1302.928] (-1300.940) (-1301.802) * (-1303.557) [-1298.419] (-1295.807) (-1302.750) -- 0:02:38
60000 -- [-1293.766] (-1303.897) (-1295.904) (-1300.234) * (-1297.003) (-1303.510) [-1295.487] (-1296.900) -- 0:02:36
Average standard deviation of split frequencies: 0.011656
60500 -- (-1294.581) [-1298.522] (-1296.131) (-1298.019) * (-1296.936) (-1301.409) (-1303.959) [-1296.432] -- 0:02:35
61000 -- (-1292.163) (-1305.290) (-1294.395) [-1296.278] * [-1296.342] (-1306.138) (-1306.032) (-1297.388) -- 0:02:33
61500 -- (-1298.410) (-1300.023) (-1300.146) [-1294.630] * [-1300.477] (-1299.153) (-1302.102) (-1295.812) -- 0:02:47
62000 -- (-1295.267) (-1303.278) [-1296.432] (-1294.830) * (-1301.053) (-1304.104) [-1300.479] (-1300.292) -- 0:02:46
62500 -- (-1298.019) (-1296.046) (-1296.303) [-1298.447] * (-1303.898) (-1301.402) [-1298.611] (-1294.383) -- 0:02:45
63000 -- (-1298.927) (-1302.148) (-1300.049) [-1296.387] * [-1299.752] (-1302.663) (-1301.187) (-1295.744) -- 0:02:43
63500 -- (-1302.604) (-1307.290) (-1303.055) [-1296.231] * (-1296.644) [-1298.523] (-1302.422) (-1302.612) -- 0:02:42
64000 -- (-1301.929) (-1298.288) (-1295.339) [-1293.529] * (-1303.411) (-1296.941) (-1303.193) [-1297.965] -- 0:02:40
64500 -- (-1298.418) [-1299.311] (-1296.727) (-1298.825) * (-1300.213) [-1299.281] (-1299.022) (-1297.366) -- 0:02:39
65000 -- (-1304.499) [-1299.580] (-1300.636) (-1296.610) * (-1302.161) (-1296.445) [-1298.104] (-1296.442) -- 0:02:38
Average standard deviation of split frequencies: 0.010714
65500 -- [-1313.328] (-1301.602) (-1302.035) (-1305.275) * (-1308.253) (-1296.319) [-1300.498] (-1297.788) -- 0:02:36
66000 -- (-1303.527) [-1295.147] (-1300.866) (-1305.375) * (-1303.684) (-1294.918) [-1301.471] (-1302.677) -- 0:02:35
66500 -- (-1301.543) [-1293.888] (-1296.457) (-1298.930) * (-1304.777) [-1296.043] (-1298.498) (-1308.249) -- 0:02:34
67000 -- (-1302.691) (-1300.301) [-1296.551] (-1301.909) * (-1299.922) (-1292.145) (-1301.033) [-1302.825] -- 0:02:47
67500 -- (-1305.558) (-1297.311) [-1298.435] (-1300.581) * (-1297.845) (-1299.654) [-1300.795] (-1301.330) -- 0:02:45
68000 -- [-1298.738] (-1292.493) (-1300.350) (-1296.122) * [-1294.736] (-1303.369) (-1295.916) (-1299.718) -- 0:02:44
68500 -- [-1301.131] (-1295.992) (-1303.386) (-1303.116) * (-1295.384) (-1298.545) [-1296.669] (-1303.408) -- 0:02:43
69000 -- (-1294.823) (-1304.719) (-1301.151) [-1291.868] * (-1297.954) [-1294.278] (-1298.715) (-1297.667) -- 0:02:41
69500 -- (-1299.520) (-1298.988) [-1295.687] (-1295.815) * [-1298.750] (-1292.840) (-1299.168) (-1297.291) -- 0:02:40
70000 -- (-1303.334) (-1301.050) (-1294.135) [-1294.117] * (-1296.758) (-1297.839) [-1297.264] (-1295.743) -- 0:02:39
Average standard deviation of split frequencies: 0.010006
70500 -- (-1299.014) [-1298.301] (-1301.012) (-1301.084) * (-1298.643) [-1298.696] (-1300.110) (-1297.345) -- 0:02:38
71000 -- (-1305.606) (-1298.351) (-1294.994) [-1303.382] * [-1299.372] (-1300.433) (-1302.146) (-1295.467) -- 0:02:37
71500 -- (-1299.930) (-1298.486) [-1296.204] (-1295.280) * [-1293.234] (-1297.902) (-1299.059) (-1296.877) -- 0:02:35
72000 -- (-1305.529) (-1296.018) [-1298.252] (-1294.425) * (-1299.161) (-1300.766) [-1297.575] (-1304.045) -- 0:02:34
72500 -- (-1311.080) (-1295.799) (-1294.884) [-1303.692] * [-1296.802] (-1302.363) (-1305.044) (-1302.892) -- 0:02:33
73000 -- (-1303.022) (-1299.372) [-1296.282] (-1297.687) * (-1302.210) [-1297.507] (-1296.780) (-1295.620) -- 0:02:45
73500 -- (-1298.035) (-1295.794) (-1296.540) [-1296.899] * (-1301.937) (-1301.359) (-1300.931) [-1298.594] -- 0:02:43
74000 -- (-1302.176) [-1296.699] (-1297.632) (-1296.873) * [-1305.640] (-1298.164) (-1301.451) (-1298.250) -- 0:02:42
74500 -- [-1309.534] (-1301.015) (-1300.998) (-1299.518) * (-1312.504) [-1297.988] (-1296.081) (-1297.245) -- 0:02:41
75000 -- (-1302.799) (-1301.578) [-1299.801] (-1305.504) * [-1297.963] (-1300.819) (-1293.516) (-1298.939) -- 0:02:40
Average standard deviation of split frequencies: 0.009304
75500 -- (-1305.561) [-1295.904] (-1300.838) (-1304.014) * (-1296.146) [-1295.820] (-1301.810) (-1300.911) -- 0:02:39
76000 -- (-1301.623) (-1297.508) [-1295.509] (-1308.112) * (-1294.334) (-1300.848) (-1297.050) [-1300.753] -- 0:02:38
76500 -- [-1299.579] (-1300.188) (-1298.948) (-1305.823) * (-1303.253) (-1305.775) (-1298.963) [-1302.614] -- 0:02:36
77000 -- [-1298.291] (-1297.505) (-1292.889) (-1298.012) * [-1296.634] (-1300.640) (-1300.615) (-1300.619) -- 0:02:35
77500 -- (-1301.777) (-1297.916) (-1295.777) [-1301.218] * (-1304.567) [-1301.582] (-1301.837) (-1303.892) -- 0:02:34
78000 -- (-1307.726) [-1300.910] (-1294.132) (-1294.259) * (-1298.473) [-1301.810] (-1297.361) (-1302.470) -- 0:02:33
78500 -- (-1301.884) (-1294.228) [-1293.988] (-1299.707) * (-1305.382) (-1293.243) [-1296.173] (-1299.115) -- 0:02:44
79000 -- (-1299.208) [-1297.451] (-1297.443) (-1294.684) * (-1296.492) (-1302.004) [-1299.370] (-1294.691) -- 0:02:43
79500 -- (-1301.195) [-1298.036] (-1299.973) (-1296.454) * [-1293.984] (-1299.826) (-1300.731) (-1300.153) -- 0:02:42
80000 -- (-1295.533) [-1302.820] (-1299.518) (-1297.232) * (-1296.791) (-1308.320) (-1298.953) [-1294.757] -- 0:02:41
Average standard deviation of split frequencies: 0.008766
80500 -- (-1301.677) [-1297.082] (-1296.791) (-1297.847) * [-1294.324] (-1305.615) (-1301.022) (-1292.329) -- 0:02:39
81000 -- (-1303.699) (-1292.195) [-1299.974] (-1298.189) * (-1296.630) [-1308.450] (-1294.816) (-1295.244) -- 0:02:38
81500 -- (-1300.786) (-1295.633) (-1296.795) [-1297.776] * (-1299.948) (-1307.940) (-1296.148) [-1294.642] -- 0:02:37
82000 -- (-1295.842) (-1299.850) (-1305.720) [-1293.549] * (-1298.818) (-1296.210) [-1297.990] (-1298.802) -- 0:02:36
82500 -- (-1299.384) [-1299.171] (-1299.129) (-1308.152) * (-1299.310) [-1299.904] (-1300.369) (-1293.691) -- 0:02:35
83000 -- (-1298.044) (-1303.568) (-1301.917) [-1295.618] * [-1297.376] (-1301.357) (-1302.150) (-1294.580) -- 0:02:34
83500 -- (-1295.809) (-1306.804) (-1302.851) [-1302.716] * [-1293.717] (-1300.409) (-1300.600) (-1294.980) -- 0:02:33
84000 -- (-1296.156) [-1298.745] (-1300.738) (-1297.170) * (-1295.102) [-1304.394] (-1299.757) (-1296.990) -- 0:02:32
84500 -- [-1301.760] (-1301.321) (-1293.495) (-1294.786) * (-1296.786) (-1299.591) (-1303.824) [-1297.235] -- 0:02:42
85000 -- (-1305.208) [-1306.973] (-1298.383) (-1296.472) * (-1301.522) (-1304.133) (-1299.500) [-1302.218] -- 0:02:41
Average standard deviation of split frequencies: 0.008222
85500 -- (-1303.404) (-1301.081) [-1303.093] (-1300.548) * (-1297.131) (-1300.624) [-1294.644] (-1299.908) -- 0:02:40
86000 -- (-1301.257) (-1298.574) (-1304.622) [-1299.988] * (-1299.752) (-1308.675) [-1298.402] (-1301.213) -- 0:02:39
86500 -- (-1294.002) [-1300.949] (-1304.391) (-1304.953) * (-1308.495) (-1304.053) [-1297.328] (-1300.674) -- 0:02:38
87000 -- [-1297.053] (-1293.851) (-1299.161) (-1301.912) * (-1315.896) (-1299.915) [-1305.150] (-1298.857) -- 0:02:37
87500 -- (-1298.886) (-1296.084) (-1306.411) [-1298.721] * (-1301.166) (-1302.775) [-1307.063] (-1300.470) -- 0:02:36
88000 -- [-1297.783] (-1298.131) (-1310.318) (-1299.084) * (-1300.417) [-1298.559] (-1296.757) (-1301.139) -- 0:02:35
88500 -- (-1298.322) [-1299.583] (-1308.352) (-1299.366) * (-1301.995) (-1307.968) [-1297.542] (-1301.185) -- 0:02:34
89000 -- (-1301.040) (-1300.965) (-1302.061) [-1302.162] * (-1302.600) [-1309.527] (-1295.200) (-1299.838) -- 0:02:33
89500 -- (-1300.015) (-1295.727) (-1301.141) [-1304.991] * [-1295.497] (-1307.205) (-1296.293) (-1300.008) -- 0:02:32
90000 -- (-1297.641) (-1302.320) [-1299.441] (-1300.767) * (-1297.398) (-1314.478) [-1294.314] (-1302.645) -- 0:02:41
Average standard deviation of split frequencies: 0.007799
90500 -- [-1297.449] (-1299.425) (-1299.159) (-1302.885) * (-1298.742) (-1315.922) (-1298.114) [-1302.578] -- 0:02:40
91000 -- [-1294.721] (-1296.236) (-1302.295) (-1299.973) * (-1298.610) (-1309.552) (-1294.131) [-1296.582] -- 0:02:39
91500 -- (-1297.411) (-1298.666) (-1302.923) [-1296.355] * (-1298.185) [-1300.024] (-1298.946) (-1296.245) -- 0:02:38
92000 -- (-1300.206) (-1300.761) [-1301.528] (-1302.305) * (-1296.019) (-1304.098) [-1292.471] (-1300.475) -- 0:02:37
92500 -- (-1298.658) [-1295.683] (-1294.935) (-1301.355) * (-1297.473) (-1300.094) (-1297.975) [-1297.458] -- 0:02:36
93000 -- [-1293.484] (-1300.436) (-1293.510) (-1304.936) * (-1297.898) (-1302.220) (-1300.243) [-1300.869] -- 0:02:36
93500 -- (-1297.703) [-1294.625] (-1298.112) (-1311.380) * (-1301.502) [-1299.995] (-1302.481) (-1296.342) -- 0:02:35
94000 -- (-1305.836) (-1296.925) [-1295.944] (-1301.938) * (-1298.840) (-1299.682) [-1297.607] (-1299.353) -- 0:02:34
94500 -- [-1295.825] (-1297.680) (-1303.670) (-1306.218) * [-1293.503] (-1300.834) (-1295.158) (-1301.976) -- 0:02:33
95000 -- (-1306.680) (-1298.795) [-1295.672] (-1297.408) * (-1301.643) (-1296.521) (-1298.967) [-1296.495] -- 0:02:32
Average standard deviation of split frequencies: 0.007366
95500 -- [-1296.101] (-1294.920) (-1297.161) (-1300.503) * (-1297.076) (-1305.282) [-1299.101] (-1299.342) -- 0:02:31
96000 -- (-1304.925) (-1297.878) [-1298.088] (-1301.725) * (-1297.116) (-1297.123) (-1296.687) [-1297.643] -- 0:02:40
96500 -- (-1300.557) [-1293.436] (-1304.517) (-1294.155) * (-1297.723) (-1311.484) [-1297.454] (-1299.840) -- 0:02:39
97000 -- (-1301.246) [-1297.133] (-1302.227) (-1297.991) * (-1298.684) (-1302.136) (-1298.481) [-1298.882] -- 0:02:38
97500 -- (-1299.989) (-1295.535) (-1311.443) [-1297.330] * [-1305.177] (-1311.171) (-1295.730) (-1297.040) -- 0:02:37
98000 -- (-1299.037) [-1298.113] (-1302.983) (-1292.370) * (-1296.915) (-1301.830) (-1300.557) [-1298.035] -- 0:02:36
98500 -- (-1299.549) (-1297.466) [-1301.321] (-1297.817) * (-1298.488) [-1295.588] (-1296.723) (-1296.323) -- 0:02:35
99000 -- [-1296.661] (-1302.329) (-1297.235) (-1295.868) * (-1300.592) (-1292.901) [-1296.335] (-1298.349) -- 0:02:34
99500 -- [-1296.658] (-1304.205) (-1301.402) (-1297.825) * [-1297.273] (-1298.350) (-1297.197) (-1305.478) -- 0:02:33
100000 -- (-1304.188) [-1295.754] (-1298.832) (-1301.858) * [-1296.979] (-1294.637) (-1302.246) (-1296.979) -- 0:02:33
Average standard deviation of split frequencies: 0.007024
100500 -- (-1303.248) [-1296.311] (-1298.163) (-1299.311) * (-1297.705) (-1300.394) [-1302.605] (-1302.371) -- 0:02:32
101000 -- (-1299.743) [-1297.861] (-1302.787) (-1296.842) * (-1296.820) (-1294.914) [-1296.699] (-1300.934) -- 0:02:31
101500 -- (-1301.154) (-1294.420) [-1297.331] (-1311.273) * [-1292.455] (-1297.307) (-1300.259) (-1300.779) -- 0:02:30
102000 -- (-1303.161) (-1295.455) [-1301.679] (-1299.464) * [-1294.141] (-1300.627) (-1299.935) (-1300.691) -- 0:02:38
102500 -- (-1304.939) (-1305.268) (-1301.667) [-1292.108] * [-1296.854] (-1298.290) (-1298.339) (-1303.591) -- 0:02:37
103000 -- (-1300.451) (-1292.981) (-1297.040) [-1292.824] * [-1294.871] (-1302.240) (-1299.559) (-1310.159) -- 0:02:36
103500 -- (-1301.347) (-1295.229) [-1294.672] (-1301.087) * [-1298.382] (-1294.986) (-1299.844) (-1305.145) -- 0:02:35
104000 -- [-1296.551] (-1295.836) (-1302.550) (-1297.331) * (-1299.689) [-1296.155] (-1301.879) (-1304.739) -- 0:02:35
104500 -- (-1298.617) [-1301.656] (-1293.948) (-1298.496) * [-1298.453] (-1296.860) (-1298.336) (-1305.595) -- 0:02:34
105000 -- (-1307.857) (-1300.066) (-1298.670) [-1293.349] * [-1291.969] (-1302.529) (-1299.757) (-1309.451) -- 0:02:33
Average standard deviation of split frequencies: 0.006671
105500 -- (-1298.695) (-1295.822) [-1297.155] (-1298.960) * (-1299.807) (-1306.369) [-1297.435] (-1313.759) -- 0:02:32
106000 -- [-1309.120] (-1299.767) (-1295.795) (-1303.338) * (-1299.530) (-1300.438) [-1298.432] (-1309.043) -- 0:02:31
106500 -- [-1299.320] (-1298.341) (-1295.080) (-1295.675) * (-1301.396) [-1300.627] (-1298.272) (-1308.879) -- 0:02:31
107000 -- (-1302.235) [-1303.381] (-1295.125) (-1296.045) * (-1312.621) (-1294.713) [-1299.954] (-1305.453) -- 0:02:30
107500 -- (-1304.341) [-1294.246] (-1296.839) (-1297.542) * (-1303.727) [-1296.382] (-1299.441) (-1314.384) -- 0:02:37
108000 -- (-1304.850) [-1301.548] (-1296.229) (-1300.638) * (-1308.437) (-1300.785) [-1297.453] (-1309.592) -- 0:02:36
108500 -- (-1299.714) (-1300.403) [-1296.858] (-1296.837) * (-1300.699) [-1297.756] (-1300.661) (-1305.927) -- 0:02:36
109000 -- [-1306.424] (-1301.720) (-1304.242) (-1294.310) * (-1303.074) [-1298.835] (-1298.174) (-1305.324) -- 0:02:35
109500 -- (-1305.096) (-1297.977) [-1297.391] (-1296.137) * (-1298.966) [-1297.816] (-1295.654) (-1307.125) -- 0:02:34
110000 -- (-1304.377) (-1299.316) (-1298.510) [-1296.052] * (-1300.081) [-1296.226] (-1299.546) (-1303.195) -- 0:02:33
Average standard deviation of split frequencies: 0.006390
110500 -- (-1306.102) (-1301.797) (-1298.104) [-1298.635] * (-1296.650) (-1299.308) (-1302.245) [-1297.122] -- 0:02:32
111000 -- (-1299.490) (-1301.250) (-1298.737) [-1295.475] * (-1301.671) [-1295.589] (-1297.851) (-1297.129) -- 0:02:32
111500 -- [-1299.146] (-1300.172) (-1308.158) (-1296.613) * (-1298.561) [-1293.321] (-1294.119) (-1298.294) -- 0:02:31
112000 -- (-1293.852) (-1307.521) (-1299.259) [-1297.843] * (-1296.621) [-1300.584] (-1297.800) (-1299.662) -- 0:02:30
112500 -- (-1294.858) (-1300.910) (-1296.722) [-1297.282] * [-1295.950] (-1295.901) (-1298.154) (-1297.877) -- 0:02:29
113000 -- (-1297.759) (-1296.712) [-1295.317] (-1298.103) * (-1300.243) (-1298.626) [-1297.252] (-1301.905) -- 0:02:29
113500 -- (-1294.491) [-1300.147] (-1298.409) (-1295.874) * (-1298.769) (-1294.199) (-1302.395) [-1300.261] -- 0:02:36
114000 -- (-1295.379) [-1302.991] (-1298.733) (-1299.142) * (-1296.761) (-1298.480) (-1297.750) [-1305.536] -- 0:02:35
114500 -- (-1299.947) (-1298.516) [-1299.211] (-1301.213) * (-1306.717) [-1294.997] (-1304.235) (-1298.523) -- 0:02:34
115000 -- (-1299.403) [-1301.060] (-1297.717) (-1305.008) * (-1299.139) [-1298.290] (-1297.962) (-1304.867) -- 0:02:33
Average standard deviation of split frequencies: 0.006096
115500 -- [-1294.608] (-1298.714) (-1298.648) (-1309.452) * [-1294.720] (-1297.671) (-1295.323) (-1298.636) -- 0:02:33
116000 -- (-1300.888) [-1297.945] (-1297.616) (-1309.678) * (-1297.322) (-1306.603) [-1296.655] (-1300.103) -- 0:02:32
116500 -- [-1296.083] (-1294.820) (-1299.454) (-1300.106) * (-1300.544) (-1294.120) (-1296.325) [-1299.448] -- 0:02:31
117000 -- (-1301.121) (-1304.952) [-1302.353] (-1300.563) * (-1298.105) (-1295.310) [-1293.977] (-1298.562) -- 0:02:30
117500 -- (-1295.993) (-1298.888) (-1301.195) [-1297.512] * (-1299.365) (-1296.879) [-1298.316] (-1295.535) -- 0:02:30
118000 -- (-1295.641) [-1303.188] (-1299.245) (-1297.844) * [-1295.852] (-1296.916) (-1306.547) (-1298.798) -- 0:02:29
118500 -- (-1300.296) (-1294.771) [-1294.364] (-1301.061) * (-1304.431) [-1296.151] (-1301.082) (-1294.303) -- 0:02:28
119000 -- (-1298.138) (-1292.926) [-1296.071] (-1294.437) * [-1310.540] (-1302.975) (-1299.604) (-1297.552) -- 0:02:28
119500 -- (-1293.248) (-1296.040) (-1301.449) [-1297.636] * (-1301.224) (-1295.850) [-1300.050] (-1300.069) -- 0:02:34
120000 -- (-1298.949) (-1298.981) [-1304.931] (-1293.782) * (-1306.891) (-1294.763) (-1299.669) [-1299.328] -- 0:02:34
Average standard deviation of split frequencies: 0.005860
120500 -- (-1295.710) [-1298.776] (-1302.237) (-1300.714) * (-1304.155) [-1296.062] (-1300.558) (-1300.504) -- 0:02:33
121000 -- (-1301.494) (-1298.209) (-1301.808) [-1295.987] * (-1303.897) (-1297.521) (-1298.719) [-1299.211] -- 0:02:32
121500 -- (-1297.776) (-1299.121) (-1304.140) [-1308.945] * (-1298.772) (-1294.528) [-1292.688] (-1294.900) -- 0:02:31
122000 -- (-1295.604) [-1299.084] (-1300.380) (-1302.295) * [-1295.254] (-1299.871) (-1300.474) (-1299.355) -- 0:02:31
122500 -- [-1294.694] (-1294.474) (-1296.456) (-1302.385) * (-1298.978) (-1300.289) (-1308.782) [-1299.126] -- 0:02:30
123000 -- [-1293.666] (-1295.482) (-1300.145) (-1310.680) * [-1295.275] (-1302.902) (-1297.628) (-1299.689) -- 0:02:29
123500 -- (-1298.197) (-1302.671) (-1302.402) [-1301.136] * (-1299.277) (-1306.170) (-1301.851) [-1294.094] -- 0:02:29
124000 -- (-1297.601) [-1296.320] (-1298.983) (-1311.613) * [-1299.151] (-1303.173) (-1308.108) (-1300.680) -- 0:02:28
124500 -- (-1299.225) (-1298.891) [-1298.516] (-1301.789) * (-1303.407) (-1308.240) [-1295.637] (-1301.784) -- 0:02:27
125000 -- [-1297.500] (-1294.499) (-1306.711) (-1306.573) * (-1297.656) [-1293.710] (-1296.778) (-1298.579) -- 0:02:34
Average standard deviation of split frequencies: 0.003741
125500 -- (-1301.879) [-1293.313] (-1295.303) (-1298.575) * (-1296.708) (-1293.788) [-1296.294] (-1302.587) -- 0:02:33
126000 -- (-1296.084) [-1294.049] (-1298.377) (-1300.492) * (-1294.836) [-1303.281] (-1297.601) (-1304.028) -- 0:02:32
126500 -- (-1301.810) (-1296.045) (-1307.660) [-1293.569] * [-1301.252] (-1295.220) (-1296.821) (-1300.811) -- 0:02:31
127000 -- [-1297.500] (-1295.862) (-1303.518) (-1302.139) * [-1302.801] (-1297.120) (-1300.046) (-1299.824) -- 0:02:31
127500 -- (-1295.721) [-1296.624] (-1301.744) (-1293.069) * (-1295.107) (-1296.996) (-1305.935) [-1298.881] -- 0:02:30
128000 -- (-1297.846) (-1304.875) [-1295.460] (-1297.959) * (-1299.237) [-1295.238] (-1303.214) (-1299.382) -- 0:02:29
128500 -- [-1300.806] (-1300.621) (-1297.237) (-1304.008) * (-1296.916) [-1299.129] (-1302.380) (-1298.594) -- 0:02:29
129000 -- (-1303.792) [-1302.901] (-1301.946) (-1300.011) * (-1296.248) (-1298.746) (-1295.245) [-1295.894] -- 0:02:28
129500 -- (-1298.428) (-1298.956) (-1301.650) [-1296.636] * (-1303.257) (-1298.949) (-1295.884) [-1298.082] -- 0:02:27
130000 -- [-1297.223] (-1302.503) (-1299.243) (-1303.192) * [-1300.430] (-1301.006) (-1298.262) (-1301.977) -- 0:02:27
Average standard deviation of split frequencies: 0.003608
130500 -- (-1307.658) [-1301.462] (-1302.526) (-1295.397) * (-1296.709) (-1304.575) (-1295.129) [-1297.907] -- 0:02:26
131000 -- (-1297.215) (-1301.118) (-1302.740) [-1292.825] * [-1293.903] (-1300.462) (-1301.869) (-1300.417) -- 0:02:32
131500 -- (-1296.203) (-1297.781) [-1293.983] (-1298.091) * (-1301.961) (-1301.757) [-1297.963] (-1309.370) -- 0:02:31
132000 -- (-1298.199) [-1301.104] (-1302.552) (-1297.239) * (-1297.539) [-1296.433] (-1301.004) (-1302.250) -- 0:02:31
132500 -- (-1304.146) (-1305.798) (-1304.528) [-1294.653] * [-1298.788] (-1298.091) (-1299.342) (-1307.219) -- 0:02:30
133000 -- (-1307.159) (-1308.380) (-1307.816) [-1297.460] * (-1303.121) [-1299.175] (-1297.524) (-1292.234) -- 0:02:29
133500 -- (-1297.437) (-1308.755) [-1297.767] (-1300.912) * [-1296.986] (-1293.453) (-1300.189) (-1300.409) -- 0:02:29
134000 -- (-1299.295) (-1298.242) [-1295.570] (-1302.266) * (-1299.774) [-1294.778] (-1302.960) (-1294.503) -- 0:02:28
134500 -- [-1296.022] (-1299.282) (-1298.141) (-1305.084) * (-1298.890) (-1296.333) (-1301.262) [-1300.019] -- 0:02:28
135000 -- [-1294.002] (-1305.331) (-1297.656) (-1302.288) * (-1303.176) (-1296.028) (-1298.637) [-1298.738] -- 0:02:27
Average standard deviation of split frequencies: 0.003466
135500 -- (-1301.239) (-1308.048) (-1300.068) [-1294.848] * [-1302.151] (-1295.406) (-1298.955) (-1301.460) -- 0:02:26
136000 -- [-1299.027] (-1306.977) (-1298.257) (-1298.330) * (-1305.902) [-1295.982] (-1295.822) (-1303.317) -- 0:02:26
136500 -- [-1292.826] (-1305.866) (-1303.223) (-1299.509) * (-1306.516) (-1299.738) (-1300.733) [-1297.201] -- 0:02:25
137000 -- [-1304.917] (-1305.376) (-1298.798) (-1297.244) * (-1305.877) (-1294.929) [-1301.982] (-1300.147) -- 0:02:31
137500 -- [-1298.637] (-1303.957) (-1303.528) (-1293.391) * (-1299.571) [-1296.411] (-1305.055) (-1296.419) -- 0:02:30
138000 -- [-1300.380] (-1304.176) (-1296.028) (-1294.903) * (-1301.899) [-1296.755] (-1297.605) (-1294.023) -- 0:02:29
138500 -- [-1300.491] (-1305.778) (-1297.228) (-1296.295) * (-1305.517) (-1296.507) (-1300.123) [-1298.801] -- 0:02:29
139000 -- (-1302.966) (-1303.879) [-1290.932] (-1292.215) * (-1303.471) (-1303.445) [-1295.944] (-1300.413) -- 0:02:28
139500 -- [-1296.664] (-1308.677) (-1295.999) (-1296.897) * (-1306.271) (-1296.150) (-1298.100) [-1297.582] -- 0:02:28
140000 -- (-1296.349) [-1298.213] (-1294.526) (-1297.429) * (-1301.935) (-1298.121) (-1296.236) [-1296.729] -- 0:02:27
Average standard deviation of split frequencies: 0.003351
140500 -- (-1299.020) (-1299.869) [-1296.016] (-1296.201) * (-1303.213) (-1296.447) (-1302.137) [-1294.444] -- 0:02:26
141000 -- (-1303.144) [-1298.938] (-1300.296) (-1295.187) * (-1300.777) [-1299.853] (-1298.029) (-1295.339) -- 0:02:26
141500 -- (-1297.517) (-1298.027) (-1299.571) [-1294.695] * (-1298.386) (-1297.684) [-1295.421] (-1296.806) -- 0:02:25
142000 -- (-1300.006) [-1295.618] (-1299.606) (-1300.469) * (-1301.645) [-1298.676] (-1297.617) (-1295.070) -- 0:02:25
142500 -- (-1297.880) (-1294.150) (-1308.467) [-1298.336] * [-1297.176] (-1293.552) (-1303.508) (-1292.093) -- 0:02:24
143000 -- [-1298.838] (-1299.363) (-1308.082) (-1296.161) * (-1300.243) [-1293.072] (-1306.702) (-1298.023) -- 0:02:29
143500 -- (-1297.297) (-1296.568) [-1303.432] (-1299.091) * (-1298.112) (-1295.809) [-1296.099] (-1296.793) -- 0:02:29
144000 -- [-1294.541] (-1296.375) (-1301.351) (-1304.510) * (-1295.990) (-1298.219) [-1299.555] (-1297.062) -- 0:02:28
144500 -- (-1298.099) [-1298.732] (-1299.026) (-1293.256) * [-1301.934] (-1300.070) (-1301.074) (-1298.676) -- 0:02:28
145000 -- (-1295.553) (-1298.393) (-1294.967) [-1290.904] * (-1297.119) (-1293.898) (-1303.150) [-1293.142] -- 0:02:27
Average standard deviation of split frequencies: 0.003229
145500 -- (-1299.028) (-1297.075) (-1302.800) [-1293.307] * (-1298.119) (-1293.343) (-1300.654) [-1292.291] -- 0:02:26
146000 -- (-1299.429) (-1300.280) [-1302.828] (-1294.600) * (-1293.739) (-1298.410) [-1298.104] (-1298.931) -- 0:02:26
146500 -- (-1296.777) (-1296.048) [-1300.145] (-1291.691) * [-1295.214] (-1295.691) (-1292.142) (-1303.181) -- 0:02:25
147000 -- (-1294.964) (-1295.303) (-1306.432) [-1297.292] * [-1297.648] (-1298.508) (-1300.156) (-1299.321) -- 0:02:25
147500 -- (-1303.024) [-1298.244] (-1295.880) (-1295.463) * (-1299.211) (-1300.043) [-1294.103] (-1298.576) -- 0:02:24
148000 -- (-1305.194) (-1301.471) (-1298.142) [-1294.867] * (-1302.868) [-1298.238] (-1307.941) (-1296.688) -- 0:02:23
148500 -- [-1298.348] (-1305.624) (-1298.717) (-1296.647) * [-1297.916] (-1299.327) (-1302.080) (-1304.643) -- 0:02:29
149000 -- (-1301.396) (-1303.317) (-1293.417) [-1297.832] * (-1299.427) [-1291.855] (-1298.929) (-1302.194) -- 0:02:28
149500 -- (-1302.847) (-1302.049) [-1295.868] (-1294.496) * [-1301.548] (-1293.780) (-1297.907) (-1293.514) -- 0:02:27
150000 -- [-1300.676] (-1303.093) (-1299.957) (-1298.881) * (-1296.318) (-1294.422) (-1292.593) [-1299.165] -- 0:02:27
Average standard deviation of split frequencies: 0.001564
150500 -- (-1300.241) [-1304.649] (-1301.647) (-1300.341) * (-1293.678) (-1300.621) [-1297.723] (-1294.958) -- 0:02:26
151000 -- (-1300.473) (-1305.843) (-1302.758) [-1299.403] * (-1299.191) (-1297.878) (-1302.079) [-1294.091] -- 0:02:26
151500 -- (-1296.002) (-1306.301) (-1301.569) [-1297.116] * (-1309.131) (-1295.459) (-1298.805) [-1302.408] -- 0:02:25
152000 -- (-1299.536) (-1304.578) (-1308.550) [-1296.623] * (-1304.592) (-1297.271) [-1303.641] (-1300.693) -- 0:02:25
152500 -- (-1298.361) (-1308.139) [-1304.397] (-1298.682) * [-1295.205] (-1299.665) (-1304.112) (-1295.854) -- 0:02:24
153000 -- (-1297.245) (-1304.556) [-1299.111] (-1297.528) * (-1304.580) (-1294.812) [-1298.774] (-1303.988) -- 0:02:23
153500 -- (-1301.938) (-1303.042) (-1302.003) [-1301.115] * (-1298.650) (-1310.788) (-1298.645) [-1296.692] -- 0:02:23
154000 -- (-1296.004) (-1297.760) (-1298.466) [-1300.053] * (-1304.779) [-1297.781] (-1294.376) (-1301.750) -- 0:02:22
154500 -- (-1299.005) (-1297.205) [-1301.158] (-1303.413) * (-1297.544) (-1301.884) [-1296.143] (-1298.470) -- 0:02:27
155000 -- (-1298.093) [-1295.866] (-1298.014) (-1305.734) * (-1300.749) [-1296.853] (-1298.893) (-1299.469) -- 0:02:27
Average standard deviation of split frequencies: 0.001511
155500 -- (-1305.147) [-1301.227] (-1300.974) (-1310.372) * (-1298.663) (-1298.499) [-1303.520] (-1305.178) -- 0:02:26
156000 -- (-1301.594) (-1305.043) (-1299.817) [-1304.352] * (-1302.105) [-1300.184] (-1298.126) (-1301.676) -- 0:02:26
156500 -- (-1301.954) [-1300.311] (-1299.581) (-1301.185) * (-1301.269) (-1295.825) [-1294.339] (-1301.535) -- 0:02:25
157000 -- (-1303.157) (-1295.593) (-1298.092) [-1300.258] * (-1297.282) [-1300.462] (-1298.579) (-1298.740) -- 0:02:24
157500 -- [-1300.783] (-1295.281) (-1297.762) (-1296.909) * (-1298.074) [-1296.711] (-1298.792) (-1300.819) -- 0:02:24
158000 -- (-1299.844) [-1296.768] (-1299.471) (-1297.935) * (-1293.644) [-1301.346] (-1301.265) (-1300.399) -- 0:02:23
158500 -- (-1298.336) (-1301.688) [-1299.269] (-1305.114) * [-1295.394] (-1298.359) (-1300.679) (-1298.550) -- 0:02:23
159000 -- (-1297.247) [-1299.624] (-1300.155) (-1294.887) * (-1297.837) (-1302.781) [-1300.608] (-1294.789) -- 0:02:22
159500 -- [-1295.204] (-1299.653) (-1297.865) (-1295.404) * (-1292.762) (-1297.811) (-1299.971) [-1299.232] -- 0:02:22
160000 -- (-1298.105) [-1299.851] (-1297.832) (-1299.969) * (-1295.588) (-1297.636) (-1302.940) [-1298.650] -- 0:02:21
Average standard deviation of split frequencies: 0.001467
160500 -- (-1297.700) [-1293.714] (-1294.319) (-1292.876) * [-1295.879] (-1300.136) (-1299.875) (-1290.764) -- 0:02:26
161000 -- (-1299.004) (-1298.831) (-1292.927) [-1297.285] * [-1296.207] (-1295.738) (-1301.891) (-1295.660) -- 0:02:25
161500 -- (-1304.392) (-1298.546) [-1293.488] (-1296.596) * (-1306.778) (-1300.632) [-1299.386] (-1295.861) -- 0:02:25
162000 -- (-1300.648) (-1298.709) (-1295.383) [-1301.037] * (-1301.569) (-1303.742) (-1305.493) [-1297.259] -- 0:02:24
162500 -- (-1299.110) (-1303.646) [-1296.024] (-1297.583) * [-1298.106] (-1299.562) (-1298.199) (-1299.991) -- 0:02:24
163000 -- (-1301.758) (-1298.168) (-1297.452) [-1302.980] * (-1301.344) (-1301.156) [-1301.340] (-1302.180) -- 0:02:23
163500 -- [-1296.792] (-1295.421) (-1297.141) (-1297.645) * (-1302.763) (-1300.667) (-1302.192) [-1295.478] -- 0:02:23
164000 -- (-1297.336) (-1301.938) [-1298.544] (-1300.814) * (-1300.467) (-1306.635) [-1299.165] (-1295.586) -- 0:02:22
164500 -- (-1302.657) [-1297.542] (-1300.912) (-1297.301) * (-1300.527) (-1306.446) (-1306.734) [-1295.681] -- 0:02:22
165000 -- (-1294.732) (-1298.336) [-1299.832] (-1297.938) * [-1301.651] (-1302.259) (-1298.871) (-1297.492) -- 0:02:21
Average standard deviation of split frequencies: 0.002840
165500 -- (-1297.839) (-1295.472) [-1302.730] (-1298.212) * (-1314.690) (-1292.713) (-1294.735) [-1295.450] -- 0:02:21
166000 -- (-1294.291) [-1293.615] (-1300.486) (-1303.692) * (-1302.555) (-1296.470) [-1295.506] (-1304.846) -- 0:02:25
166500 -- (-1296.322) (-1296.438) (-1299.222) [-1299.916] * [-1304.871] (-1301.119) (-1297.160) (-1294.220) -- 0:02:25
167000 -- [-1294.731] (-1302.084) (-1296.073) (-1301.011) * (-1301.255) (-1297.463) [-1297.478] (-1297.492) -- 0:02:24
167500 -- (-1301.677) (-1303.800) [-1299.981] (-1297.531) * (-1303.394) [-1299.088] (-1313.197) (-1300.149) -- 0:02:24
168000 -- [-1294.719] (-1306.336) (-1293.893) (-1296.513) * (-1297.894) (-1300.453) (-1300.138) [-1300.182] -- 0:02:23
168500 -- (-1296.268) (-1299.082) (-1299.836) [-1296.213] * (-1297.545) (-1296.172) (-1304.309) [-1295.889] -- 0:02:23
169000 -- (-1297.953) [-1300.128] (-1298.470) (-1293.312) * [-1298.467] (-1298.658) (-1302.103) (-1296.588) -- 0:02:22
169500 -- (-1297.398) (-1304.215) [-1302.366] (-1298.246) * [-1302.158] (-1297.231) (-1298.628) (-1296.212) -- 0:02:22
170000 -- (-1299.187) (-1306.722) (-1297.858) [-1301.118] * (-1298.402) (-1297.548) [-1294.788] (-1297.436) -- 0:02:21
Average standard deviation of split frequencies: 0.002762
170500 -- (-1294.445) (-1295.005) (-1300.548) [-1302.935] * [-1300.358] (-1299.274) (-1294.792) (-1300.451) -- 0:02:21
171000 -- [-1297.555] (-1295.190) (-1298.851) (-1297.139) * (-1297.158) (-1303.173) [-1303.541] (-1292.883) -- 0:02:20
171500 -- (-1297.189) (-1298.614) [-1298.731] (-1299.399) * [-1292.801] (-1314.719) (-1302.942) (-1293.943) -- 0:02:20
172000 -- (-1305.165) (-1295.984) [-1299.373] (-1308.817) * (-1302.658) (-1304.877) (-1298.068) [-1294.166] -- 0:02:24
172500 -- (-1302.723) (-1305.349) (-1301.519) [-1301.757] * (-1298.347) (-1297.094) [-1299.482] (-1297.665) -- 0:02:23
173000 -- (-1297.770) (-1307.463) (-1292.670) [-1299.230] * [-1296.005] (-1301.362) (-1302.878) (-1293.154) -- 0:02:23
173500 -- (-1298.076) (-1298.819) (-1296.687) [-1297.263] * [-1295.945] (-1309.078) (-1302.124) (-1302.233) -- 0:02:22
174000 -- (-1304.844) [-1295.670] (-1297.559) (-1296.573) * [-1297.251] (-1295.659) (-1301.969) (-1296.337) -- 0:02:22
174500 -- (-1303.868) (-1295.977) (-1300.260) [-1296.969] * (-1297.733) [-1301.298] (-1303.347) (-1297.945) -- 0:02:21
175000 -- (-1293.900) [-1307.366] (-1295.646) (-1296.197) * (-1298.900) [-1302.364] (-1301.988) (-1299.342) -- 0:02:21
Average standard deviation of split frequencies: 0.004018
175500 -- (-1299.430) [-1302.402] (-1297.151) (-1299.313) * (-1296.520) (-1300.463) (-1300.083) [-1295.921] -- 0:02:20
176000 -- (-1300.234) [-1295.402] (-1299.642) (-1300.992) * (-1302.144) (-1301.349) [-1302.390] (-1298.449) -- 0:02:20
176500 -- [-1299.540] (-1296.717) (-1301.474) (-1293.328) * (-1303.044) [-1299.023] (-1311.697) (-1293.006) -- 0:02:19
177000 -- (-1301.417) (-1297.773) (-1301.253) [-1295.988] * [-1298.522] (-1296.550) (-1308.331) (-1296.748) -- 0:02:19
177500 -- (-1300.687) (-1295.400) [-1301.889] (-1296.481) * (-1299.463) (-1295.369) (-1298.133) [-1300.497] -- 0:02:19
178000 -- (-1301.573) (-1299.878) (-1296.648) [-1297.929] * (-1304.765) (-1301.448) (-1301.291) [-1297.372] -- 0:02:23
178500 -- (-1301.154) [-1295.994] (-1300.661) (-1294.204) * [-1300.004] (-1299.600) (-1303.330) (-1301.171) -- 0:02:22
179000 -- [-1298.281] (-1295.142) (-1298.419) (-1297.371) * (-1301.404) (-1299.941) [-1300.825] (-1292.722) -- 0:02:22
179500 -- (-1312.074) (-1299.876) [-1298.446] (-1296.911) * (-1299.298) (-1302.612) [-1299.540] (-1296.635) -- 0:02:21
180000 -- (-1301.124) (-1298.982) (-1299.314) [-1301.873] * [-1293.759] (-1295.209) (-1298.345) (-1291.550) -- 0:02:21
Average standard deviation of split frequencies: 0.003914
180500 -- (-1296.583) [-1294.948] (-1304.639) (-1302.622) * (-1299.802) [-1300.773] (-1301.301) (-1299.568) -- 0:02:20
181000 -- [-1296.895] (-1299.324) (-1304.118) (-1299.498) * (-1293.162) [-1292.821] (-1302.784) (-1296.525) -- 0:02:20
181500 -- (-1299.115) [-1301.112] (-1308.923) (-1300.185) * [-1295.526] (-1299.377) (-1300.187) (-1307.573) -- 0:02:19
182000 -- (-1295.647) (-1300.440) (-1305.898) [-1314.189] * (-1294.241) (-1298.257) (-1302.335) [-1299.396] -- 0:02:19
182500 -- (-1301.908) (-1296.940) (-1304.083) [-1302.777] * (-1296.435) [-1298.286] (-1295.239) (-1303.063) -- 0:02:18
183000 -- (-1299.756) (-1296.038) [-1294.020] (-1300.019) * (-1297.296) (-1303.290) (-1303.585) [-1299.031] -- 0:02:18
183500 -- (-1298.903) [-1294.339] (-1294.191) (-1299.592) * (-1294.980) (-1297.808) (-1296.290) [-1299.177] -- 0:02:22
184000 -- [-1296.378] (-1293.277) (-1298.701) (-1306.425) * (-1297.396) [-1300.746] (-1301.782) (-1301.322) -- 0:02:21
184500 -- (-1298.135) (-1296.234) [-1294.066] (-1302.607) * (-1301.639) (-1297.909) [-1296.228] (-1302.625) -- 0:02:21
185000 -- [-1298.800] (-1295.816) (-1296.714) (-1304.616) * (-1300.054) (-1300.494) (-1300.483) [-1295.928] -- 0:02:20
Average standard deviation of split frequencies: 0.003802
185500 -- [-1299.165] (-1300.266) (-1301.754) (-1301.237) * (-1300.537) [-1293.412] (-1298.130) (-1301.891) -- 0:02:20
186000 -- (-1303.265) (-1298.661) (-1300.413) [-1302.338] * [-1303.037] (-1299.321) (-1302.084) (-1296.447) -- 0:02:20
186500 -- [-1301.503] (-1295.679) (-1300.153) (-1302.183) * (-1300.023) (-1296.565) [-1293.074] (-1301.789) -- 0:02:19
187000 -- (-1302.234) [-1297.695] (-1299.402) (-1298.642) * (-1295.635) (-1301.004) [-1297.628] (-1299.681) -- 0:02:19
187500 -- [-1298.925] (-1298.586) (-1305.640) (-1296.544) * [-1293.745] (-1304.792) (-1293.157) (-1297.587) -- 0:02:18
188000 -- (-1301.336) (-1299.820) [-1302.229] (-1298.554) * (-1295.468) (-1312.459) (-1292.973) [-1300.277] -- 0:02:18
188500 -- [-1304.382] (-1293.433) (-1301.342) (-1296.981) * [-1305.818] (-1303.416) (-1293.337) (-1300.351) -- 0:02:17
189000 -- [-1303.603] (-1301.096) (-1301.131) (-1294.718) * (-1307.740) (-1305.117) (-1299.101) [-1302.305] -- 0:02:17
189500 -- (-1303.096) (-1299.240) (-1296.381) [-1295.494] * (-1302.613) (-1301.424) [-1298.552] (-1301.729) -- 0:02:21
190000 -- [-1300.884] (-1300.628) (-1299.194) (-1301.311) * [-1295.448] (-1295.212) (-1298.586) (-1301.445) -- 0:02:20
Average standard deviation of split frequencies: 0.003709
190500 -- (-1303.698) (-1305.784) (-1298.561) [-1299.813] * [-1296.106] (-1294.908) (-1300.477) (-1296.050) -- 0:02:20
191000 -- (-1299.097) (-1298.503) (-1298.912) [-1295.650] * (-1306.185) [-1295.811] (-1304.674) (-1305.519) -- 0:02:19
191500 -- (-1304.128) [-1296.243] (-1299.920) (-1298.672) * (-1296.643) [-1297.376] (-1300.962) (-1295.264) -- 0:02:19
192000 -- [-1301.150] (-1295.256) (-1300.673) (-1299.364) * (-1301.889) [-1296.057] (-1296.864) (-1300.226) -- 0:02:18
192500 -- (-1299.721) (-1301.670) [-1299.854] (-1300.702) * (-1296.585) [-1300.099] (-1301.178) (-1295.779) -- 0:02:18
193000 -- (-1300.273) (-1302.110) (-1301.294) [-1296.831] * [-1298.251] (-1298.525) (-1298.744) (-1295.565) -- 0:02:17
193500 -- (-1304.834) [-1292.441] (-1302.329) (-1297.310) * (-1299.081) (-1305.466) [-1296.341] (-1300.311) -- 0:02:17
194000 -- (-1308.286) [-1300.562] (-1303.291) (-1296.997) * [-1296.308] (-1297.299) (-1293.982) (-1296.739) -- 0:02:17
194500 -- [-1302.841] (-1303.431) (-1297.757) (-1294.797) * [-1293.494] (-1303.670) (-1302.883) (-1296.515) -- 0:02:16
195000 -- [-1305.731] (-1303.948) (-1296.136) (-1295.839) * (-1293.144) (-1314.309) [-1292.733] (-1294.903) -- 0:02:20
Average standard deviation of split frequencies: 0.003608
195500 -- (-1299.555) (-1301.137) (-1301.608) [-1305.330] * (-1301.683) (-1300.774) [-1304.307] (-1295.077) -- 0:02:19
196000 -- (-1295.601) (-1300.022) [-1299.286] (-1305.973) * (-1297.216) (-1301.838) [-1300.837] (-1296.271) -- 0:02:19
196500 -- [-1293.723] (-1295.471) (-1294.996) (-1302.516) * [-1299.526] (-1302.151) (-1298.443) (-1294.772) -- 0:02:19
197000 -- (-1295.734) (-1299.582) (-1299.066) [-1296.140] * (-1298.325) (-1296.076) [-1301.162] (-1293.076) -- 0:02:18
197500 -- (-1295.860) (-1307.630) [-1294.561] (-1297.543) * (-1295.956) [-1299.705] (-1301.403) (-1297.598) -- 0:02:18
198000 -- (-1295.097) [-1299.908] (-1297.205) (-1296.507) * (-1299.627) [-1293.618] (-1301.146) (-1295.497) -- 0:02:17
198500 -- (-1302.855) (-1302.589) [-1303.146] (-1298.500) * (-1299.526) (-1296.727) [-1298.944] (-1299.267) -- 0:02:17
199000 -- [-1298.660] (-1302.015) (-1299.467) (-1297.226) * (-1297.745) (-1300.875) [-1295.568] (-1299.314) -- 0:02:16
199500 -- (-1298.570) (-1302.935) [-1301.954] (-1296.157) * [-1297.969] (-1297.214) (-1303.202) (-1300.723) -- 0:02:16
200000 -- (-1298.761) (-1298.324) [-1300.353] (-1298.377) * [-1296.424] (-1302.295) (-1295.154) (-1293.726) -- 0:02:16
Average standard deviation of split frequencies: 0.003524
200500 -- (-1301.411) (-1300.618) [-1304.688] (-1298.130) * (-1303.187) (-1296.586) [-1292.309] (-1296.795) -- 0:02:15
201000 -- (-1303.687) [-1298.786] (-1304.644) (-1296.179) * (-1296.122) (-1296.048) (-1295.464) [-1298.454] -- 0:02:19
201500 -- (-1297.869) (-1292.679) (-1300.438) [-1293.997] * (-1299.056) [-1295.668] (-1298.320) (-1296.787) -- 0:02:18
202000 -- (-1303.574) [-1294.260] (-1299.680) (-1298.451) * (-1304.071) (-1297.231) (-1295.289) [-1297.530] -- 0:02:18
202500 -- (-1298.819) (-1297.502) (-1301.599) [-1296.859] * (-1312.641) [-1295.727] (-1298.240) (-1302.179) -- 0:02:17
203000 -- (-1293.567) (-1301.789) [-1299.204] (-1295.115) * (-1305.173) (-1297.744) [-1303.418] (-1299.770) -- 0:02:17
203500 -- (-1298.099) (-1295.957) (-1296.563) [-1295.781] * (-1293.395) (-1299.916) [-1296.777] (-1301.170) -- 0:02:16
204000 -- [-1295.206] (-1299.508) (-1308.446) (-1308.045) * (-1297.702) [-1302.978] (-1300.747) (-1301.315) -- 0:02:16
204500 -- (-1294.523) (-1298.693) (-1302.109) [-1295.712] * (-1295.524) (-1303.140) [-1298.442] (-1304.623) -- 0:02:16
205000 -- (-1294.413) (-1299.415) [-1301.280] (-1295.766) * [-1292.652] (-1297.396) (-1297.108) (-1302.097) -- 0:02:15
Average standard deviation of split frequencies: 0.003433
205500 -- (-1294.161) [-1297.060] (-1299.985) (-1295.560) * [-1297.018] (-1298.669) (-1294.878) (-1312.356) -- 0:02:15
206000 -- [-1297.642] (-1298.547) (-1311.425) (-1295.996) * [-1300.730] (-1304.155) (-1297.012) (-1302.228) -- 0:02:14
206500 -- (-1294.522) (-1301.640) (-1307.245) [-1294.759] * (-1297.291) (-1298.221) [-1296.650] (-1298.016) -- 0:02:14
207000 -- (-1297.693) (-1294.900) [-1301.088] (-1292.137) * (-1297.883) (-1300.695) [-1297.741] (-1299.849) -- 0:02:17
207500 -- (-1299.481) (-1302.575) (-1299.163) [-1299.463] * (-1292.287) (-1301.702) (-1295.251) [-1298.561] -- 0:02:17
208000 -- [-1303.587] (-1296.298) (-1300.529) (-1301.451) * (-1297.095) [-1299.722] (-1292.165) (-1297.025) -- 0:02:17
208500 -- [-1297.782] (-1294.073) (-1302.649) (-1298.853) * [-1302.524] (-1296.599) (-1297.572) (-1302.761) -- 0:02:16
209000 -- (-1301.358) [-1298.735] (-1302.796) (-1304.101) * (-1299.624) (-1303.087) [-1299.192] (-1295.233) -- 0:02:16
209500 -- (-1298.530) (-1297.193) (-1306.322) [-1300.199] * (-1299.275) [-1297.818] (-1301.269) (-1298.513) -- 0:02:15
210000 -- (-1302.913) (-1297.714) [-1304.740] (-1300.249) * (-1301.812) [-1296.922] (-1304.572) (-1296.425) -- 0:02:15
Average standard deviation of split frequencies: 0.003357
210500 -- (-1299.584) (-1303.194) (-1305.867) [-1296.205] * [-1306.168] (-1297.377) (-1306.606) (-1297.378) -- 0:02:15
211000 -- (-1307.502) [-1298.026] (-1307.189) (-1296.756) * (-1302.807) [-1293.889] (-1302.843) (-1304.703) -- 0:02:14
211500 -- (-1293.529) (-1298.911) [-1302.094] (-1298.444) * [-1300.558] (-1296.818) (-1304.053) (-1302.140) -- 0:02:14
212000 -- (-1300.662) [-1300.096] (-1305.801) (-1296.078) * (-1304.870) [-1299.610] (-1299.400) (-1299.883) -- 0:02:13
212500 -- (-1305.699) (-1300.418) [-1298.304] (-1307.110) * [-1301.276] (-1297.104) (-1300.789) (-1299.520) -- 0:02:17
213000 -- (-1295.005) [-1294.497] (-1305.085) (-1302.966) * (-1301.127) (-1294.765) (-1302.604) [-1302.030] -- 0:02:16
213500 -- (-1297.784) (-1298.433) [-1293.988] (-1298.000) * [-1300.031] (-1296.410) (-1298.932) (-1296.159) -- 0:02:16
214000 -- (-1303.316) (-1307.028) [-1292.582] (-1298.962) * (-1302.638) [-1297.987] (-1296.434) (-1295.623) -- 0:02:15
214500 -- (-1296.900) (-1297.812) [-1298.907] (-1297.900) * (-1300.721) (-1300.113) (-1300.453) [-1298.559] -- 0:02:15
215000 -- (-1301.526) (-1299.625) [-1299.434] (-1298.671) * (-1302.505) (-1299.582) [-1296.285] (-1298.420) -- 0:02:15
Average standard deviation of split frequencies: 0.003274
215500 -- (-1298.071) [-1295.545] (-1300.562) (-1296.290) * (-1306.169) (-1299.702) (-1298.932) [-1294.304] -- 0:02:14
216000 -- [-1298.046] (-1301.450) (-1303.242) (-1299.897) * (-1302.342) (-1305.646) (-1301.779) [-1296.329] -- 0:02:14
216500 -- (-1305.363) (-1300.865) [-1300.663] (-1302.969) * (-1310.915) (-1296.983) (-1303.639) [-1297.083] -- 0:02:13
217000 -- [-1301.783] (-1300.329) (-1302.365) (-1300.587) * (-1302.655) (-1302.513) [-1300.678] (-1302.507) -- 0:02:13
217500 -- (-1298.559) (-1304.386) (-1305.866) [-1297.889] * (-1297.085) (-1295.794) [-1299.059] (-1297.483) -- 0:02:13
218000 -- (-1305.087) [-1299.579] (-1308.967) (-1294.708) * (-1298.282) (-1297.485) [-1295.823] (-1304.312) -- 0:02:12
218500 -- (-1303.904) [-1298.433] (-1298.727) (-1301.521) * [-1296.772] (-1303.790) (-1302.889) (-1301.456) -- 0:02:15
219000 -- [-1302.146] (-1297.938) (-1301.191) (-1303.585) * (-1296.309) (-1306.836) [-1302.080] (-1297.681) -- 0:02:15
219500 -- (-1304.551) (-1303.006) [-1299.001] (-1303.967) * (-1295.618) (-1307.282) (-1301.905) [-1295.387] -- 0:02:15
220000 -- (-1301.540) [-1294.061] (-1308.653) (-1292.495) * (-1296.851) (-1295.778) (-1299.657) [-1299.706] -- 0:02:14
Average standard deviation of split frequencies: 0.003204
220500 -- (-1300.947) [-1295.623] (-1299.421) (-1298.482) * (-1300.015) (-1302.134) [-1298.634] (-1299.954) -- 0:02:14
221000 -- (-1298.604) (-1294.549) (-1305.858) [-1296.988] * (-1296.622) (-1292.867) [-1299.541] (-1305.312) -- 0:02:13
221500 -- (-1299.217) (-1298.120) [-1301.071] (-1295.709) * (-1298.642) [-1296.098] (-1300.992) (-1297.352) -- 0:02:13
222000 -- (-1299.852) (-1301.941) [-1300.481] (-1301.297) * (-1302.187) (-1296.106) [-1295.862] (-1298.995) -- 0:02:13
222500 -- (-1308.057) [-1299.905] (-1299.703) (-1300.575) * (-1309.372) (-1303.231) (-1299.196) [-1299.125] -- 0:02:12
223000 -- [-1303.956] (-1299.484) (-1301.968) (-1306.547) * (-1304.781) (-1295.066) [-1294.745] (-1299.713) -- 0:02:12
223500 -- (-1302.563) [-1301.107] (-1296.306) (-1306.152) * (-1301.264) [-1295.139] (-1296.120) (-1300.926) -- 0:02:12
224000 -- (-1298.831) [-1295.245] (-1303.104) (-1306.671) * (-1291.644) (-1293.079) [-1298.567] (-1301.299) -- 0:02:11
224500 -- (-1299.484) [-1296.207] (-1297.036) (-1300.857) * (-1298.305) (-1301.750) [-1300.388] (-1302.250) -- 0:02:14
225000 -- (-1299.605) (-1300.312) [-1296.265] (-1298.789) * (-1302.194) (-1298.615) [-1292.329] (-1299.156) -- 0:02:14
Average standard deviation of split frequencies: 0.003129
225500 -- (-1299.364) [-1298.089] (-1295.720) (-1308.744) * (-1299.144) [-1302.094] (-1297.201) (-1299.330) -- 0:02:13
226000 -- (-1306.018) (-1298.480) (-1299.278) [-1298.694] * (-1295.732) (-1301.304) [-1297.327] (-1297.666) -- 0:02:13
226500 -- (-1301.939) [-1299.803] (-1297.582) (-1298.083) * (-1304.008) (-1302.891) [-1296.488] (-1297.625) -- 0:02:13
227000 -- (-1301.097) [-1295.357] (-1294.070) (-1295.624) * [-1299.142] (-1303.059) (-1296.072) (-1300.202) -- 0:02:12
227500 -- [-1299.786] (-1301.476) (-1293.475) (-1301.974) * (-1295.378) (-1303.946) (-1298.803) [-1295.449] -- 0:02:12
228000 -- [-1302.302] (-1305.913) (-1294.194) (-1297.577) * (-1295.939) (-1298.733) (-1303.028) [-1296.763] -- 0:02:12
228500 -- [-1295.299] (-1301.526) (-1300.023) (-1298.291) * [-1300.668] (-1298.998) (-1303.558) (-1299.282) -- 0:02:11
229000 -- (-1297.593) [-1297.603] (-1302.891) (-1294.679) * (-1296.534) (-1304.027) [-1300.821] (-1295.673) -- 0:02:11
229500 -- (-1300.214) (-1307.927) (-1297.122) [-1294.953] * (-1301.941) (-1302.938) (-1299.140) [-1292.415] -- 0:02:10
230000 -- (-1299.079) (-1308.239) (-1294.368) [-1300.188] * [-1299.899] (-1305.957) (-1305.584) (-1297.563) -- 0:02:10
Average standard deviation of split frequencies: 0.003065
230500 -- (-1294.217) (-1301.784) [-1296.801] (-1298.504) * [-1303.758] (-1303.737) (-1302.478) (-1299.276) -- 0:02:13
231000 -- [-1294.371] (-1303.330) (-1295.610) (-1297.016) * (-1309.240) [-1300.998] (-1299.906) (-1299.493) -- 0:02:13
231500 -- (-1296.370) (-1303.586) (-1297.708) [-1298.083] * [-1299.327] (-1303.753) (-1305.104) (-1301.441) -- 0:02:12
232000 -- [-1300.882] (-1295.697) (-1310.059) (-1298.166) * (-1294.470) [-1302.830] (-1296.208) (-1298.846) -- 0:02:12
232500 -- [-1296.657] (-1298.480) (-1300.745) (-1301.296) * [-1295.577] (-1301.239) (-1299.158) (-1296.736) -- 0:02:12
233000 -- (-1296.595) (-1302.518) (-1303.287) [-1295.287] * [-1299.629] (-1299.279) (-1296.206) (-1305.414) -- 0:02:11
233500 -- [-1295.774] (-1297.551) (-1315.513) (-1295.960) * [-1300.031] (-1299.376) (-1295.058) (-1301.057) -- 0:02:11
234000 -- (-1299.946) (-1295.158) [-1299.715] (-1295.855) * (-1298.200) [-1299.702] (-1295.254) (-1302.666) -- 0:02:10
234500 -- [-1300.899] (-1298.033) (-1299.083) (-1292.918) * [-1295.614] (-1297.661) (-1299.196) (-1299.093) -- 0:02:10
235000 -- (-1296.715) (-1299.820) (-1296.494) [-1295.346] * (-1296.041) (-1301.325) [-1301.043] (-1292.816) -- 0:02:10
Average standard deviation of split frequencies: 0.001997
235500 -- (-1300.427) [-1299.340] (-1301.368) (-1299.382) * (-1297.262) (-1303.296) (-1300.983) [-1299.937] -- 0:02:09
236000 -- (-1294.658) (-1303.832) (-1292.536) [-1294.419] * [-1292.500] (-1298.813) (-1299.266) (-1294.822) -- 0:02:12
236500 -- [-1295.641] (-1296.802) (-1298.065) (-1297.256) * (-1295.502) (-1304.441) [-1297.001] (-1296.070) -- 0:02:12
237000 -- (-1297.014) (-1304.085) [-1298.504] (-1296.631) * [-1298.123] (-1302.739) (-1292.955) (-1297.169) -- 0:02:11
237500 -- (-1301.059) [-1300.943] (-1296.723) (-1302.182) * (-1292.957) (-1299.343) (-1297.391) [-1296.405] -- 0:02:11
238000 -- (-1298.630) (-1300.926) (-1310.314) [-1297.319] * (-1301.202) (-1298.243) (-1292.557) [-1304.320] -- 0:02:11
238500 -- (-1299.663) (-1301.849) [-1295.406] (-1302.198) * (-1299.473) (-1300.726) [-1293.289] (-1303.035) -- 0:02:10
239000 -- (-1302.481) (-1306.683) [-1304.239] (-1304.452) * (-1304.604) [-1302.145] (-1303.726) (-1296.042) -- 0:02:10
239500 -- (-1303.554) (-1302.396) [-1293.646] (-1305.420) * (-1297.806) (-1295.099) [-1298.234] (-1306.089) -- 0:02:10
240000 -- (-1298.287) [-1296.259] (-1295.873) (-1301.447) * (-1301.455) (-1303.986) [-1295.526] (-1301.689) -- 0:02:09
Average standard deviation of split frequencies: 0.001959
240500 -- (-1293.768) (-1305.513) [-1297.269] (-1293.952) * [-1303.893] (-1297.549) (-1303.117) (-1305.025) -- 0:02:09
241000 -- (-1294.042) (-1295.506) [-1295.416] (-1301.405) * (-1299.419) (-1296.256) (-1303.523) [-1295.459] -- 0:02:09
241500 -- (-1296.519) [-1295.661] (-1296.021) (-1296.842) * (-1297.905) (-1300.035) (-1299.423) [-1295.502] -- 0:02:08
242000 -- [-1294.107] (-1303.378) (-1301.582) (-1296.951) * [-1298.188] (-1301.282) (-1306.771) (-1298.143) -- 0:02:11
242500 -- [-1294.420] (-1296.253) (-1303.869) (-1295.354) * [-1296.275] (-1304.476) (-1305.116) (-1296.283) -- 0:02:11
243000 -- (-1293.480) [-1302.894] (-1297.918) (-1298.205) * [-1294.461] (-1298.103) (-1298.554) (-1298.981) -- 0:02:10
243500 -- (-1303.338) (-1296.514) (-1296.859) [-1299.847] * (-1301.508) (-1292.555) [-1295.436] (-1297.402) -- 0:02:10
244000 -- (-1299.353) [-1293.681] (-1298.554) (-1298.533) * (-1296.656) [-1295.326] (-1297.805) (-1298.629) -- 0:02:10
244500 -- (-1298.149) (-1293.448) (-1306.045) [-1303.883] * [-1292.158] (-1293.672) (-1298.972) (-1297.815) -- 0:02:09
245000 -- (-1296.706) (-1303.470) (-1298.567) [-1299.243] * (-1295.174) (-1302.417) (-1299.689) [-1294.457] -- 0:02:09
Average standard deviation of split frequencies: 0.001916
245500 -- [-1300.402] (-1301.404) (-1298.222) (-1296.845) * (-1299.272) [-1294.731] (-1305.239) (-1294.795) -- 0:02:09
246000 -- (-1295.260) (-1306.388) [-1296.979] (-1299.599) * (-1294.923) (-1291.971) (-1296.613) [-1299.092] -- 0:02:08
246500 -- (-1307.567) (-1303.340) (-1298.308) [-1298.244] * (-1305.059) (-1300.846) [-1300.568] (-1303.623) -- 0:02:08
247000 -- (-1299.913) (-1297.817) (-1299.487) [-1295.934] * [-1295.779] (-1295.907) (-1296.991) (-1296.538) -- 0:02:08
247500 -- (-1307.248) [-1295.284] (-1300.045) (-1295.948) * (-1298.889) (-1300.560) [-1294.107] (-1302.862) -- 0:02:10
248000 -- (-1301.767) (-1296.640) [-1293.002] (-1300.463) * (-1297.128) (-1294.715) (-1294.828) [-1296.136] -- 0:02:10
248500 -- (-1303.013) [-1295.946] (-1299.682) (-1294.473) * (-1296.585) [-1295.724] (-1297.326) (-1295.276) -- 0:02:10
249000 -- (-1306.178) [-1298.000] (-1297.459) (-1301.796) * (-1296.302) (-1297.915) (-1295.688) [-1296.244] -- 0:02:09
249500 -- (-1296.177) (-1301.605) [-1299.936] (-1296.913) * [-1300.195] (-1305.416) (-1296.993) (-1303.188) -- 0:02:09
250000 -- (-1301.313) (-1303.009) [-1297.729] (-1296.217) * [-1304.259] (-1300.715) (-1302.001) (-1296.937) -- 0:02:09
Average standard deviation of split frequencies: 0.001881
250500 -- (-1297.351) (-1306.004) (-1297.646) [-1303.046] * [-1300.942] (-1307.248) (-1295.247) (-1297.654) -- 0:02:08
251000 -- (-1295.415) (-1300.460) (-1301.936) [-1294.892] * (-1302.411) [-1295.624] (-1296.220) (-1295.409) -- 0:02:08
251500 -- (-1297.378) (-1300.498) [-1300.891] (-1294.408) * [-1296.330] (-1295.995) (-1295.496) (-1303.125) -- 0:02:07
252000 -- [-1297.919] (-1309.391) (-1295.579) (-1295.514) * (-1298.171) [-1294.355] (-1298.757) (-1297.533) -- 0:02:07
252500 -- [-1299.959] (-1297.858) (-1303.074) (-1296.953) * (-1307.962) [-1294.516] (-1301.168) (-1297.288) -- 0:02:07
253000 -- [-1295.711] (-1300.261) (-1301.620) (-1301.706) * (-1299.446) (-1300.787) (-1298.173) [-1302.811] -- 0:02:06
253500 -- (-1301.629) (-1301.083) (-1296.246) [-1296.612] * (-1302.820) (-1301.610) [-1298.962] (-1299.440) -- 0:02:09
254000 -- [-1293.892] (-1297.680) (-1299.089) (-1295.003) * (-1296.425) (-1298.503) (-1297.263) [-1299.077] -- 0:02:09
254500 -- (-1297.000) (-1298.400) [-1297.168] (-1299.354) * (-1301.208) (-1300.053) (-1302.357) [-1296.480] -- 0:02:08
255000 -- [-1300.347] (-1299.366) (-1303.101) (-1303.342) * (-1296.605) (-1301.188) (-1306.334) [-1301.338] -- 0:02:08
Average standard deviation of split frequencies: 0.001841
255500 -- (-1300.714) (-1296.053) [-1301.222] (-1296.522) * (-1295.848) (-1302.337) (-1300.284) [-1298.147] -- 0:02:08
256000 -- (-1300.081) [-1297.550] (-1301.604) (-1300.730) * (-1296.352) (-1302.722) [-1297.743] (-1293.546) -- 0:02:07
256500 -- (-1298.062) (-1295.956) (-1299.250) [-1298.984] * (-1295.651) (-1294.570) (-1309.702) [-1293.723] -- 0:02:07
257000 -- [-1297.186] (-1293.018) (-1301.881) (-1298.017) * [-1297.283] (-1293.877) (-1295.110) (-1299.411) -- 0:02:07
257500 -- (-1302.006) (-1298.705) (-1300.645) [-1301.658] * (-1298.156) (-1302.483) (-1297.721) [-1298.065] -- 0:02:06
258000 -- (-1300.229) [-1296.376] (-1301.042) (-1299.653) * [-1294.714] (-1299.208) (-1299.488) (-1303.788) -- 0:02:06
258500 -- (-1308.520) (-1296.657) [-1303.810] (-1298.770) * [-1299.206] (-1299.827) (-1299.652) (-1299.621) -- 0:02:06
259000 -- (-1301.829) [-1300.977] (-1300.564) (-1298.684) * (-1297.744) [-1301.495] (-1300.854) (-1300.020) -- 0:02:08
259500 -- (-1300.875) (-1299.653) [-1297.511] (-1294.150) * (-1297.834) [-1297.996] (-1298.941) (-1308.079) -- 0:02:08
260000 -- (-1300.650) (-1304.215) (-1296.468) [-1295.888] * (-1296.764) (-1304.907) [-1297.919] (-1297.988) -- 0:02:08
Average standard deviation of split frequencies: 0.001808
260500 -- (-1300.969) (-1300.109) (-1303.078) [-1296.135] * [-1306.167] (-1294.969) (-1299.137) (-1299.073) -- 0:02:07
261000 -- (-1307.083) (-1303.117) (-1300.858) [-1297.529] * [-1299.213] (-1298.754) (-1306.311) (-1294.495) -- 0:02:07
261500 -- (-1304.278) [-1301.214] (-1301.695) (-1303.663) * (-1301.563) [-1295.353] (-1301.122) (-1301.121) -- 0:02:07
262000 -- [-1300.110] (-1300.528) (-1295.808) (-1302.664) * (-1301.807) [-1296.456] (-1298.037) (-1298.305) -- 0:02:06
262500 -- (-1305.621) [-1296.708] (-1299.715) (-1294.398) * (-1293.402) [-1295.357] (-1305.407) (-1298.372) -- 0:02:06
263000 -- (-1303.966) (-1295.507) (-1294.088) [-1297.464] * [-1296.248] (-1295.517) (-1299.339) (-1296.819) -- 0:02:06
263500 -- (-1301.031) [-1302.616] (-1296.457) (-1300.436) * (-1302.762) (-1299.035) (-1295.453) [-1299.753] -- 0:02:05
264000 -- [-1299.169] (-1301.115) (-1301.135) (-1301.786) * (-1304.860) [-1296.384] (-1299.445) (-1301.689) -- 0:02:05
264500 -- (-1294.385) [-1299.896] (-1299.186) (-1296.098) * [-1298.072] (-1304.188) (-1294.247) (-1300.587) -- 0:02:05
265000 -- (-1295.295) (-1298.140) [-1296.636] (-1296.654) * (-1293.945) (-1304.010) [-1295.825] (-1301.800) -- 0:02:07
Average standard deviation of split frequencies: 0.001772
265500 -- (-1297.597) (-1296.005) (-1299.513) [-1297.184] * (-1299.298) (-1297.474) (-1296.973) [-1293.863] -- 0:02:07
266000 -- (-1297.039) [-1300.239] (-1297.619) (-1299.411) * (-1296.590) (-1303.985) [-1294.043] (-1296.372) -- 0:02:06
266500 -- (-1296.819) (-1303.029) (-1305.198) [-1295.152] * (-1297.001) [-1296.032] (-1296.552) (-1293.450) -- 0:02:06
267000 -- [-1298.323] (-1302.312) (-1299.764) (-1300.065) * (-1304.530) (-1302.730) (-1297.209) [-1298.629] -- 0:02:06
267500 -- [-1297.130] (-1302.740) (-1304.997) (-1304.442) * (-1301.878) (-1304.745) (-1303.302) [-1298.135] -- 0:02:05
268000 -- [-1298.175] (-1304.305) (-1297.217) (-1298.338) * (-1299.282) (-1295.229) [-1294.408] (-1293.190) -- 0:02:05
268500 -- (-1293.455) (-1300.729) [-1301.449] (-1298.431) * (-1305.162) (-1297.183) [-1294.358] (-1296.919) -- 0:02:05
269000 -- (-1302.603) (-1301.119) [-1299.241] (-1296.796) * (-1298.665) (-1299.371) [-1299.948] (-1296.973) -- 0:02:05
269500 -- [-1305.854] (-1302.313) (-1296.887) (-1306.657) * [-1296.887] (-1303.239) (-1296.360) (-1291.182) -- 0:02:04
270000 -- (-1305.642) (-1297.795) (-1294.676) [-1298.839] * (-1296.778) (-1299.972) (-1293.436) [-1295.360] -- 0:02:04
Average standard deviation of split frequencies: 0.001742
270500 -- [-1299.523] (-1293.730) (-1297.223) (-1302.328) * (-1297.722) (-1299.136) [-1295.229] (-1297.062) -- 0:02:04
271000 -- [-1295.226] (-1292.602) (-1301.057) (-1300.899) * (-1300.831) [-1295.678] (-1298.932) (-1300.708) -- 0:02:06
271500 -- (-1305.386) (-1296.702) [-1297.671] (-1299.079) * (-1299.506) (-1297.956) (-1297.121) [-1298.023] -- 0:02:06
272000 -- [-1296.309] (-1300.207) (-1298.710) (-1295.980) * [-1297.287] (-1296.171) (-1297.082) (-1303.913) -- 0:02:05
272500 -- (-1295.280) (-1295.542) [-1295.628] (-1300.769) * [-1300.275] (-1299.863) (-1296.586) (-1296.896) -- 0:02:05
273000 -- (-1298.541) [-1296.625] (-1298.926) (-1301.273) * (-1302.509) (-1303.299) (-1298.486) [-1295.642] -- 0:02:05
273500 -- (-1308.106) [-1295.250] (-1298.418) (-1301.237) * [-1299.579] (-1297.145) (-1304.582) (-1296.979) -- 0:02:04
274000 -- (-1301.433) [-1296.716] (-1309.147) (-1295.441) * (-1297.040) [-1298.414] (-1294.483) (-1299.510) -- 0:02:04
274500 -- (-1302.159) [-1295.953] (-1308.608) (-1298.758) * [-1296.745] (-1303.380) (-1299.571) (-1301.074) -- 0:02:04
275000 -- (-1304.582) (-1300.688) (-1306.165) [-1298.894] * (-1299.178) (-1298.465) (-1299.754) [-1301.641] -- 0:02:03
Average standard deviation of split frequencies: 0.001708
275500 -- (-1300.350) (-1300.473) [-1297.289] (-1300.851) * (-1305.146) [-1297.205] (-1299.658) (-1295.734) -- 0:02:03
276000 -- (-1299.061) (-1299.589) (-1303.636) [-1297.103] * [-1299.403] (-1293.348) (-1300.341) (-1298.310) -- 0:02:03
276500 -- (-1301.283) (-1300.159) (-1299.166) [-1295.455] * [-1298.308] (-1302.370) (-1295.893) (-1297.046) -- 0:02:05
277000 -- (-1300.420) [-1300.924] (-1303.184) (-1300.822) * (-1302.212) (-1300.749) [-1298.155] (-1299.405) -- 0:02:05
277500 -- [-1302.275] (-1303.178) (-1298.488) (-1304.999) * [-1302.104] (-1297.057) (-1292.378) (-1304.451) -- 0:02:04
278000 -- [-1303.093] (-1300.969) (-1309.464) (-1303.831) * (-1298.975) (-1296.330) [-1294.450] (-1301.961) -- 0:02:04
278500 -- [-1301.464] (-1302.121) (-1299.390) (-1303.483) * (-1297.508) (-1297.199) [-1302.479] (-1305.524) -- 0:02:04
279000 -- (-1300.190) (-1300.086) (-1301.157) [-1294.696] * (-1306.749) (-1297.128) [-1298.700] (-1304.065) -- 0:02:04
279500 -- (-1299.232) [-1293.518] (-1298.651) (-1298.544) * (-1298.581) (-1300.698) (-1299.935) [-1299.797] -- 0:02:03
280000 -- (-1300.182) (-1295.982) (-1294.897) [-1296.625] * (-1294.806) (-1298.978) [-1296.668] (-1298.966) -- 0:02:03
Average standard deviation of split frequencies: 0.001680
280500 -- (-1300.555) [-1301.756] (-1302.371) (-1304.950) * [-1298.350] (-1300.751) (-1298.703) (-1298.160) -- 0:02:03
281000 -- (-1305.358) [-1299.323] (-1295.733) (-1293.187) * (-1294.773) (-1301.666) [-1293.309] (-1293.382) -- 0:02:02
281500 -- (-1302.445) (-1298.793) (-1297.634) [-1295.222] * (-1300.880) (-1301.787) [-1294.937] (-1292.868) -- 0:02:02
282000 -- (-1303.141) (-1304.155) (-1302.454) [-1295.701] * (-1298.822) (-1299.566) [-1294.633] (-1293.343) -- 0:02:02
282500 -- [-1299.589] (-1297.990) (-1303.561) (-1301.201) * (-1297.846) (-1295.583) [-1297.718] (-1298.108) -- 0:02:04
283000 -- (-1300.752) [-1298.031] (-1299.947) (-1300.131) * (-1301.363) (-1296.125) [-1299.259] (-1300.063) -- 0:02:04
283500 -- (-1300.831) [-1302.354] (-1299.057) (-1300.580) * (-1304.721) (-1298.066) [-1296.966] (-1305.210) -- 0:02:03
284000 -- (-1297.851) [-1295.346] (-1305.394) (-1307.511) * (-1304.410) (-1296.138) (-1295.939) [-1296.746] -- 0:02:03
284500 -- [-1295.958] (-1300.910) (-1296.820) (-1307.330) * [-1297.300] (-1301.504) (-1295.330) (-1300.664) -- 0:02:03
285000 -- (-1297.900) (-1297.366) [-1298.974] (-1301.854) * (-1302.534) [-1293.285] (-1297.434) (-1301.523) -- 0:02:02
Average standard deviation of split frequencies: 0.002472
285500 -- (-1298.656) [-1296.765] (-1304.185) (-1303.016) * (-1297.665) (-1301.038) (-1304.653) [-1300.887] -- 0:02:02
286000 -- (-1307.760) (-1296.061) [-1297.220] (-1304.976) * (-1308.919) [-1302.409] (-1303.615) (-1296.939) -- 0:02:02
286500 -- (-1300.972) (-1298.290) (-1296.308) [-1301.352] * (-1297.079) (-1300.471) (-1299.676) [-1299.706] -- 0:02:02
287000 -- (-1308.323) [-1294.538] (-1299.290) (-1303.139) * (-1299.823) (-1295.642) (-1301.071) [-1299.380] -- 0:02:01
287500 -- (-1307.715) (-1296.102) (-1299.987) [-1294.586] * (-1297.177) [-1297.149] (-1299.027) (-1304.067) -- 0:02:01
288000 -- [-1301.026] (-1296.739) (-1300.952) (-1296.868) * (-1296.734) (-1295.584) (-1299.526) [-1298.770] -- 0:02:01
288500 -- (-1300.448) [-1295.702] (-1295.147) (-1298.284) * (-1295.832) (-1300.122) (-1299.211) [-1295.488] -- 0:02:03
289000 -- (-1297.789) (-1299.005) (-1301.505) [-1296.098] * (-1295.540) (-1302.303) [-1295.595] (-1296.007) -- 0:02:03
289500 -- (-1303.514) (-1295.522) [-1300.349] (-1295.212) * (-1294.218) (-1301.955) (-1296.546) [-1300.145] -- 0:02:02
290000 -- (-1303.031) (-1305.271) (-1298.696) [-1298.254] * [-1294.843] (-1296.947) (-1295.819) (-1302.450) -- 0:02:02
Average standard deviation of split frequencies: 0.002433
290500 -- (-1297.060) [-1298.646] (-1301.152) (-1305.069) * [-1301.020] (-1299.899) (-1296.656) (-1294.136) -- 0:02:02
291000 -- (-1297.361) (-1307.478) (-1306.053) [-1294.924] * (-1306.679) (-1297.909) (-1295.264) [-1299.026] -- 0:02:01
291500 -- [-1298.781] (-1301.507) (-1298.639) (-1299.611) * [-1298.827] (-1298.594) (-1295.138) (-1294.170) -- 0:02:01
292000 -- (-1300.298) [-1296.059] (-1302.064) (-1299.993) * (-1302.492) [-1293.251] (-1301.148) (-1297.451) -- 0:02:01
292500 -- (-1304.857) (-1298.196) (-1296.533) [-1296.775] * (-1299.750) (-1297.831) [-1297.315] (-1306.497) -- 0:02:00
293000 -- (-1299.175) (-1305.159) (-1302.493) [-1297.753] * (-1299.273) [-1297.925] (-1294.808) (-1299.666) -- 0:02:00
293500 -- (-1299.584) [-1303.062] (-1299.468) (-1298.037) * [-1295.955] (-1299.518) (-1298.622) (-1295.495) -- 0:02:00
294000 -- (-1299.106) (-1301.693) [-1297.850] (-1299.793) * (-1292.611) (-1305.160) [-1298.469] (-1301.985) -- 0:02:02
294500 -- [-1300.405] (-1304.062) (-1299.403) (-1298.348) * (-1295.899) (-1297.251) (-1299.915) [-1294.666] -- 0:02:02
295000 -- (-1303.544) (-1293.738) [-1296.117] (-1309.004) * (-1305.007) (-1302.147) [-1294.246] (-1297.854) -- 0:02:01
Average standard deviation of split frequencies: 0.002389
295500 -- [-1296.301] (-1300.804) (-1298.188) (-1306.113) * (-1298.975) (-1307.740) [-1300.961] (-1298.141) -- 0:02:01
296000 -- (-1297.097) [-1297.707] (-1301.958) (-1299.661) * (-1305.726) [-1303.922] (-1302.461) (-1297.784) -- 0:02:01
296500 -- [-1298.750] (-1302.367) (-1307.480) (-1302.246) * [-1298.957] (-1299.300) (-1298.969) (-1307.720) -- 0:02:01
297000 -- (-1297.354) (-1297.065) (-1304.843) [-1297.699] * [-1295.719] (-1293.593) (-1295.153) (-1303.835) -- 0:02:00
297500 -- [-1294.328] (-1296.628) (-1303.703) (-1298.160) * (-1294.971) (-1298.833) [-1298.698] (-1301.765) -- 0:02:00
298000 -- (-1296.514) (-1300.483) (-1299.211) [-1300.975] * (-1296.128) (-1301.237) (-1296.445) [-1294.748] -- 0:02:00
298500 -- (-1298.907) [-1297.974] (-1297.988) (-1306.568) * (-1293.895) (-1304.367) [-1299.985] (-1297.104) -- 0:01:59
299000 -- (-1300.600) (-1303.534) (-1296.760) [-1299.076] * [-1293.671] (-1304.459) (-1305.434) (-1299.812) -- 0:01:59
299500 -- [-1296.008] (-1303.006) (-1300.791) (-1295.629) * (-1309.167) (-1298.413) (-1299.155) [-1298.315] -- 0:01:59
300000 -- [-1294.718] (-1298.178) (-1297.979) (-1297.581) * [-1298.327] (-1304.735) (-1300.350) (-1300.223) -- 0:02:01
Average standard deviation of split frequencies: 0.002352
300500 -- (-1299.007) [-1295.111] (-1303.560) (-1297.949) * (-1303.227) (-1298.685) (-1296.143) [-1295.686] -- 0:02:01
301000 -- (-1301.805) [-1296.879] (-1299.108) (-1299.273) * (-1298.076) (-1301.125) [-1300.629] (-1296.074) -- 0:02:00
301500 -- (-1300.361) (-1305.958) (-1299.898) [-1299.988] * [-1298.973] (-1305.858) (-1300.889) (-1304.217) -- 0:02:00
302000 -- (-1303.982) [-1302.002] (-1300.020) (-1297.642) * (-1297.103) (-1304.999) [-1298.612] (-1302.105) -- 0:02:00
302500 -- (-1299.850) (-1301.284) [-1299.570] (-1295.882) * [-1294.768] (-1297.074) (-1297.488) (-1296.656) -- 0:01:59
303000 -- (-1296.158) (-1299.888) (-1297.447) [-1298.771] * (-1302.032) [-1299.059] (-1297.675) (-1296.586) -- 0:01:59
303500 -- (-1297.758) [-1297.402] (-1303.401) (-1297.897) * [-1296.008] (-1297.432) (-1296.459) (-1294.289) -- 0:01:59
304000 -- (-1294.607) (-1299.735) (-1298.545) [-1299.214] * [-1302.076] (-1307.844) (-1294.578) (-1294.999) -- 0:01:59
304500 -- [-1298.564] (-1299.565) (-1303.249) (-1301.500) * [-1296.721] (-1305.160) (-1295.862) (-1301.184) -- 0:01:58
305000 -- [-1296.928] (-1295.794) (-1296.846) (-1297.220) * (-1296.619) (-1303.891) [-1295.819] (-1302.946) -- 0:01:58
Average standard deviation of split frequencies: 0.002311
305500 -- (-1298.393) (-1301.704) (-1299.766) [-1298.214] * (-1300.899) (-1299.908) [-1295.479] (-1298.815) -- 0:01:58
306000 -- (-1297.075) [-1293.492] (-1299.447) (-1298.520) * [-1299.303] (-1300.417) (-1302.191) (-1298.429) -- 0:02:00
306500 -- (-1300.803) [-1297.134] (-1299.644) (-1293.359) * (-1301.770) (-1299.744) [-1301.971] (-1296.031) -- 0:01:59
307000 -- [-1296.805] (-1303.547) (-1295.844) (-1297.188) * (-1300.835) (-1296.085) (-1302.243) [-1295.997] -- 0:01:59
307500 -- (-1301.225) (-1298.471) (-1294.884) [-1299.677] * (-1301.329) [-1298.590] (-1303.059) (-1297.018) -- 0:01:59
308000 -- (-1298.846) (-1298.409) [-1296.714] (-1300.931) * (-1301.407) (-1294.169) (-1301.859) [-1299.715] -- 0:01:59
308500 -- (-1296.819) (-1299.645) (-1303.657) [-1295.881] * (-1303.053) [-1297.800] (-1296.881) (-1297.350) -- 0:01:58
309000 -- [-1295.982] (-1299.121) (-1296.640) (-1305.196) * (-1310.542) (-1296.530) (-1300.963) [-1301.358] -- 0:01:58
309500 -- (-1300.134) (-1301.070) [-1296.982] (-1300.572) * (-1311.746) [-1299.925] (-1308.091) (-1299.307) -- 0:01:58
310000 -- (-1299.004) (-1295.232) [-1297.260] (-1302.433) * (-1308.469) (-1296.543) [-1298.166] (-1301.435) -- 0:01:57
Average standard deviation of split frequencies: 0.002276
310500 -- [-1293.007] (-1302.881) (-1298.975) (-1295.908) * [-1301.257] (-1301.441) (-1302.520) (-1305.804) -- 0:01:57
311000 -- (-1299.731) (-1296.084) [-1296.592] (-1304.206) * (-1293.752) [-1293.219] (-1306.578) (-1296.694) -- 0:01:57
311500 -- (-1296.220) (-1299.978) (-1301.902) [-1302.024] * (-1295.007) (-1301.715) [-1300.494] (-1293.488) -- 0:01:59
312000 -- (-1298.222) (-1296.689) [-1299.995] (-1298.833) * (-1293.451) (-1305.680) (-1300.318) [-1301.423] -- 0:01:59
312500 -- (-1298.367) [-1294.606] (-1303.345) (-1303.058) * [-1296.316] (-1306.284) (-1300.611) (-1300.436) -- 0:01:58
313000 -- (-1299.027) [-1295.107] (-1300.564) (-1296.688) * [-1296.208] (-1299.209) (-1299.789) (-1300.544) -- 0:01:58
313500 -- (-1293.291) [-1302.515] (-1297.405) (-1302.512) * [-1294.078] (-1294.964) (-1300.651) (-1302.458) -- 0:01:58
314000 -- (-1298.596) (-1297.633) (-1299.911) [-1299.218] * (-1302.111) [-1295.197] (-1299.531) (-1299.350) -- 0:01:57
314500 -- (-1296.462) [-1301.508] (-1298.925) (-1301.626) * (-1299.722) [-1296.697] (-1305.394) (-1303.299) -- 0:01:57
315000 -- (-1298.939) (-1298.620) [-1302.550] (-1297.158) * [-1298.992] (-1299.256) (-1299.398) (-1295.732) -- 0:01:57
Average standard deviation of split frequencies: 0.002238
315500 -- (-1303.037) (-1295.871) (-1295.738) [-1297.842] * [-1298.473] (-1300.933) (-1302.563) (-1296.772) -- 0:01:57
316000 -- [-1299.498] (-1298.049) (-1294.226) (-1294.317) * [-1294.340] (-1300.406) (-1306.679) (-1297.952) -- 0:01:56
316500 -- (-1300.211) [-1299.203] (-1310.301) (-1305.269) * [-1300.620] (-1310.841) (-1299.794) (-1298.962) -- 0:01:56
317000 -- (-1295.641) (-1300.061) (-1303.672) [-1303.857] * (-1298.803) (-1304.682) [-1300.978] (-1298.962) -- 0:01:56
317500 -- (-1295.469) (-1294.215) (-1306.982) [-1302.113] * (-1301.345) (-1302.009) [-1298.904] (-1297.127) -- 0:01:58
318000 -- [-1300.768] (-1301.745) (-1302.673) (-1300.181) * (-1302.378) [-1304.151] (-1301.722) (-1301.905) -- 0:01:57
318500 -- (-1296.019) (-1298.704) (-1300.964) [-1310.084] * (-1297.261) (-1300.227) [-1295.256] (-1305.131) -- 0:01:57
319000 -- (-1302.276) [-1295.028] (-1299.754) (-1299.018) * (-1298.835) (-1299.020) (-1301.486) [-1298.578] -- 0:01:57
319500 -- [-1299.935] (-1296.363) (-1299.746) (-1295.243) * (-1296.969) (-1308.026) [-1301.172] (-1300.415) -- 0:01:57
320000 -- [-1298.508] (-1293.172) (-1300.055) (-1297.480) * (-1299.493) (-1300.914) (-1300.798) [-1299.031] -- 0:01:56
Average standard deviation of split frequencies: 0.002205
320500 -- (-1303.298) [-1296.231] (-1300.239) (-1296.004) * (-1299.754) [-1300.559] (-1300.023) (-1295.667) -- 0:01:56
321000 -- (-1309.785) [-1294.756] (-1299.884) (-1301.644) * (-1300.300) (-1305.632) [-1299.596] (-1297.325) -- 0:01:56
321500 -- (-1296.707) (-1302.653) [-1299.961] (-1302.313) * (-1300.183) [-1298.325] (-1303.117) (-1297.239) -- 0:01:56
322000 -- (-1298.743) (-1306.608) [-1294.952] (-1302.962) * (-1308.903) (-1293.376) [-1296.780] (-1294.514) -- 0:01:55
322500 -- [-1295.782] (-1302.368) (-1296.041) (-1303.823) * (-1307.270) (-1298.540) (-1298.730) [-1296.006] -- 0:01:55
323000 -- (-1308.093) (-1295.601) (-1292.707) [-1299.226] * (-1308.007) (-1297.455) [-1301.272] (-1302.377) -- 0:01:55
323500 -- (-1298.139) (-1301.006) (-1294.311) [-1295.089] * [-1297.032] (-1297.139) (-1305.212) (-1298.615) -- 0:01:57
324000 -- [-1298.760] (-1301.335) (-1297.635) (-1305.929) * [-1298.431] (-1302.839) (-1301.921) (-1295.647) -- 0:01:56
324500 -- (-1299.612) [-1300.435] (-1297.028) (-1294.571) * [-1296.437] (-1298.733) (-1303.311) (-1297.323) -- 0:01:56
325000 -- [-1295.217] (-1299.188) (-1298.191) (-1298.930) * (-1298.792) (-1295.575) (-1295.970) [-1293.496] -- 0:01:56
Average standard deviation of split frequencies: 0.002169
325500 -- [-1300.818] (-1296.850) (-1296.202) (-1300.917) * (-1304.423) (-1300.273) [-1296.717] (-1303.963) -- 0:01:56
326000 -- [-1293.883] (-1300.185) (-1296.531) (-1299.004) * (-1300.979) [-1296.376] (-1294.509) (-1296.746) -- 0:01:55
326500 -- (-1299.221) (-1298.989) (-1300.148) [-1302.932] * (-1304.300) (-1302.438) [-1294.870] (-1307.329) -- 0:01:55
327000 -- (-1300.842) (-1292.485) (-1298.050) [-1299.721] * [-1296.375] (-1298.765) (-1298.463) (-1301.606) -- 0:01:55
327500 -- (-1298.140) (-1296.597) [-1300.243] (-1294.428) * (-1301.539) [-1291.825] (-1301.935) (-1301.617) -- 0:01:54
328000 -- (-1298.152) [-1298.097] (-1297.804) (-1294.672) * (-1302.343) (-1294.132) (-1300.189) [-1297.352] -- 0:01:54
328500 -- (-1299.317) [-1298.749] (-1305.828) (-1294.989) * (-1302.504) [-1293.133] (-1304.801) (-1303.411) -- 0:01:54
329000 -- [-1297.169] (-1298.733) (-1294.139) (-1299.530) * (-1297.260) [-1297.272] (-1300.440) (-1301.260) -- 0:01:56
329500 -- (-1298.436) (-1300.028) (-1301.952) [-1295.169] * (-1295.698) (-1298.132) [-1297.801] (-1297.834) -- 0:01:55
330000 -- (-1305.528) [-1300.896] (-1302.577) (-1298.088) * (-1299.480) (-1296.426) (-1298.440) [-1297.967] -- 0:01:55
Average standard deviation of split frequencies: 0.002138
330500 -- (-1299.296) (-1303.837) [-1298.338] (-1299.954) * (-1294.767) (-1296.928) [-1300.017] (-1296.774) -- 0:01:55
331000 -- (-1301.104) (-1298.843) (-1306.095) [-1298.365] * [-1297.946] (-1302.198) (-1302.821) (-1302.064) -- 0:01:55
331500 -- [-1304.581] (-1298.027) (-1301.180) (-1301.997) * [-1294.079] (-1298.944) (-1295.980) (-1294.677) -- 0:01:54
332000 -- (-1316.425) [-1300.931] (-1296.854) (-1299.061) * (-1299.589) (-1294.671) [-1295.764] (-1302.500) -- 0:01:54
332500 -- [-1303.165] (-1301.293) (-1296.685) (-1295.377) * (-1301.408) (-1298.867) [-1300.596] (-1305.495) -- 0:01:54
333000 -- [-1302.647] (-1298.736) (-1292.711) (-1300.866) * (-1294.161) (-1296.559) (-1297.740) [-1299.319] -- 0:01:54
333500 -- (-1299.989) (-1295.571) [-1296.805] (-1297.779) * (-1303.707) (-1293.794) [-1301.777] (-1296.084) -- 0:01:53
334000 -- [-1304.650] (-1301.682) (-1292.668) (-1297.671) * (-1299.620) (-1294.501) (-1303.754) [-1298.425] -- 0:01:53
334500 -- (-1296.169) (-1295.582) (-1292.014) [-1303.627] * [-1296.243] (-1300.344) (-1302.780) (-1292.562) -- 0:01:53
335000 -- (-1299.306) (-1300.541) (-1299.499) [-1298.801] * [-1297.209] (-1294.862) (-1299.345) (-1297.462) -- 0:01:55
Average standard deviation of split frequencies: 0.002104
335500 -- (-1302.517) (-1296.100) [-1299.404] (-1296.651) * (-1298.846) [-1301.628] (-1301.451) (-1302.301) -- 0:01:54
336000 -- (-1294.641) [-1298.128] (-1300.470) (-1297.125) * (-1300.007) (-1296.269) (-1299.799) [-1298.901] -- 0:01:54
336500 -- (-1295.172) [-1299.204] (-1294.439) (-1295.039) * (-1296.178) [-1297.716] (-1300.073) (-1301.575) -- 0:01:54
337000 -- (-1302.812) [-1297.917] (-1295.301) (-1302.810) * (-1298.633) [-1293.894] (-1296.600) (-1300.956) -- 0:01:54
337500 -- (-1307.473) [-1303.738] (-1297.143) (-1300.362) * (-1298.716) (-1298.357) [-1295.990] (-1297.049) -- 0:01:53
338000 -- [-1299.905] (-1298.945) (-1299.069) (-1295.270) * (-1301.674) (-1297.102) [-1296.266] (-1291.928) -- 0:01:53
338500 -- [-1298.837] (-1295.541) (-1295.292) (-1296.215) * (-1304.805) (-1303.960) (-1296.258) [-1301.293] -- 0:01:53
339000 -- (-1305.381) (-1298.721) (-1295.792) [-1296.993] * (-1299.266) (-1299.803) (-1298.664) [-1297.660] -- 0:01:53
339500 -- (-1297.737) (-1296.951) (-1294.832) [-1295.753] * [-1298.732] (-1297.378) (-1304.948) (-1295.862) -- 0:01:52
340000 -- (-1297.942) (-1300.684) (-1295.579) [-1296.417] * (-1300.561) [-1294.043] (-1299.291) (-1301.750) -- 0:01:52
Average standard deviation of split frequencies: 0.002076
340500 -- [-1295.545] (-1298.244) (-1295.690) (-1299.364) * (-1301.072) (-1296.664) [-1295.012] (-1298.709) -- 0:01:52
341000 -- (-1302.580) (-1297.668) [-1299.503] (-1294.086) * [-1296.324] (-1296.823) (-1299.426) (-1296.386) -- 0:01:54
341500 -- [-1297.419] (-1295.833) (-1292.466) (-1293.608) * (-1299.615) (-1293.464) (-1297.970) [-1299.924] -- 0:01:53
342000 -- (-1298.532) [-1299.265] (-1296.169) (-1294.183) * (-1301.737) (-1296.486) [-1297.128] (-1295.274) -- 0:01:53
342500 -- (-1299.895) (-1296.399) [-1301.181] (-1296.278) * (-1298.478) (-1301.698) [-1302.684] (-1298.559) -- 0:01:53
343000 -- (-1304.785) (-1294.939) [-1294.768] (-1309.249) * (-1300.124) (-1310.670) [-1296.251] (-1302.723) -- 0:01:53
343500 -- (-1301.563) (-1304.012) [-1295.099] (-1301.555) * (-1300.581) (-1299.539) [-1298.243] (-1309.804) -- 0:01:52
344000 -- (-1300.130) (-1297.618) [-1296.585] (-1301.975) * (-1303.199) (-1302.184) [-1296.319] (-1304.900) -- 0:01:52
344500 -- (-1298.277) (-1298.277) (-1300.581) [-1297.252] * [-1305.380] (-1299.312) (-1301.705) (-1308.706) -- 0:01:52
345000 -- (-1296.671) (-1301.896) (-1299.337) [-1294.719] * (-1299.218) (-1303.177) (-1302.339) [-1295.965] -- 0:01:52
Average standard deviation of split frequencies: 0.002044
345500 -- (-1299.362) [-1299.263] (-1305.233) (-1295.620) * [-1295.358] (-1303.068) (-1297.541) (-1296.962) -- 0:01:51
346000 -- (-1300.202) [-1294.852] (-1301.162) (-1302.231) * [-1292.552] (-1305.002) (-1299.954) (-1295.400) -- 0:01:51
346500 -- (-1300.319) (-1303.747) (-1294.935) [-1297.892] * (-1297.302) (-1306.420) (-1306.866) [-1296.261] -- 0:01:53
347000 -- (-1299.984) (-1297.474) [-1295.212] (-1301.566) * (-1297.163) (-1301.904) [-1295.980] (-1297.109) -- 0:01:52
347500 -- (-1302.960) (-1299.725) (-1299.251) [-1297.902] * [-1296.868] (-1296.892) (-1301.805) (-1298.692) -- 0:01:52
348000 -- (-1298.226) [-1295.323] (-1306.410) (-1300.957) * (-1301.628) (-1298.723) [-1303.073] (-1300.375) -- 0:01:52
348500 -- [-1299.143] (-1299.902) (-1299.751) (-1305.959) * [-1294.256] (-1302.540) (-1298.963) (-1300.442) -- 0:01:52
349000 -- [-1298.392] (-1297.587) (-1299.154) (-1300.108) * (-1300.382) (-1299.094) [-1294.075] (-1302.720) -- 0:01:51
349500 -- (-1297.849) (-1299.800) [-1300.429] (-1296.402) * (-1297.613) [-1302.589] (-1299.766) (-1301.297) -- 0:01:51
350000 -- (-1295.015) (-1297.652) (-1301.535) [-1298.921] * (-1295.323) (-1297.320) (-1301.393) [-1298.484] -- 0:01:51
Average standard deviation of split frequencies: 0.002016
350500 -- (-1300.568) (-1295.971) [-1299.000] (-1305.909) * (-1294.493) (-1301.365) (-1297.357) [-1294.484] -- 0:01:51
351000 -- [-1297.856] (-1297.602) (-1302.271) (-1301.161) * [-1300.312] (-1294.614) (-1299.941) (-1295.795) -- 0:01:50
351500 -- [-1294.622] (-1294.561) (-1302.618) (-1294.504) * [-1295.581] (-1292.150) (-1306.085) (-1305.388) -- 0:01:50
352000 -- [-1296.888] (-1305.402) (-1296.601) (-1296.230) * (-1306.344) [-1294.367] (-1304.307) (-1305.501) -- 0:01:50
352500 -- (-1296.522) (-1303.375) [-1295.737] (-1303.205) * (-1296.601) (-1296.596) [-1299.975] (-1302.801) -- 0:01:52
353000 -- (-1302.822) [-1303.919] (-1293.981) (-1300.796) * (-1303.194) [-1300.253] (-1302.306) (-1302.120) -- 0:01:51
353500 -- [-1296.141] (-1297.648) (-1298.121) (-1299.337) * (-1296.649) (-1306.576) (-1298.354) [-1305.629] -- 0:01:51
354000 -- (-1306.955) [-1293.938] (-1295.505) (-1294.544) * (-1296.770) (-1302.029) [-1301.538] (-1296.161) -- 0:01:51
354500 -- (-1299.991) [-1297.188] (-1301.813) (-1295.288) * (-1298.878) (-1298.612) [-1296.804] (-1294.238) -- 0:01:51
355000 -- (-1303.816) (-1296.962) (-1299.714) [-1295.804] * [-1301.742] (-1296.355) (-1296.089) (-1294.152) -- 0:01:50
Average standard deviation of split frequencies: 0.001986
355500 -- (-1298.153) [-1297.135] (-1304.714) (-1303.250) * (-1303.313) [-1306.987] (-1294.703) (-1297.614) -- 0:01:50
356000 -- (-1295.680) (-1294.918) [-1306.051] (-1304.405) * [-1297.808] (-1302.552) (-1296.087) (-1296.601) -- 0:01:50
356500 -- (-1304.382) [-1299.196] (-1300.495) (-1302.740) * (-1300.731) [-1304.932] (-1300.927) (-1294.024) -- 0:01:50
357000 -- (-1302.836) [-1308.305] (-1303.750) (-1299.799) * (-1295.377) (-1303.535) (-1293.129) [-1301.693] -- 0:01:49
357500 -- [-1296.315] (-1301.010) (-1303.735) (-1297.717) * (-1295.986) [-1295.652] (-1292.273) (-1293.884) -- 0:01:49
358000 -- (-1301.133) [-1297.750] (-1300.194) (-1299.213) * (-1301.290) [-1297.153] (-1294.701) (-1300.129) -- 0:01:49
358500 -- (-1299.873) (-1304.207) [-1299.526] (-1297.361) * (-1304.723) (-1307.405) (-1300.171) [-1306.917] -- 0:01:50
359000 -- (-1302.823) (-1298.413) (-1297.328) [-1293.211] * (-1299.020) (-1301.754) [-1300.403] (-1303.804) -- 0:01:50
359500 -- (-1306.398) [-1302.193] (-1292.729) (-1294.975) * (-1305.110) (-1297.062) [-1296.952] (-1297.145) -- 0:01:50
360000 -- (-1301.401) (-1295.358) (-1297.217) [-1296.370] * (-1297.899) (-1308.900) [-1295.336] (-1297.561) -- 0:01:50
Average standard deviation of split frequencies: 0.001961
360500 -- (-1297.891) [-1296.677] (-1296.143) (-1297.474) * (-1294.637) (-1296.075) [-1294.524] (-1294.087) -- 0:01:49
361000 -- [-1301.922] (-1299.436) (-1299.615) (-1302.922) * (-1297.423) [-1295.660] (-1297.423) (-1293.882) -- 0:01:49
361500 -- (-1296.194) (-1306.233) (-1297.337) [-1295.674] * [-1299.114] (-1301.077) (-1300.057) (-1293.853) -- 0:01:49
362000 -- [-1299.402] (-1302.784) (-1295.564) (-1298.389) * (-1304.023) (-1305.717) [-1298.798] (-1298.771) -- 0:01:49
362500 -- (-1296.860) [-1302.316] (-1296.719) (-1301.326) * (-1306.080) (-1301.154) [-1298.203] (-1294.841) -- 0:01:49
363000 -- (-1302.371) (-1306.509) (-1297.569) [-1299.215] * (-1293.948) [-1302.428] (-1297.595) (-1299.812) -- 0:01:48
363500 -- (-1302.843) (-1305.851) (-1295.112) [-1295.191] * (-1299.345) (-1298.646) (-1299.928) [-1298.068] -- 0:01:48
364000 -- (-1307.293) (-1308.792) (-1294.523) [-1295.793] * (-1302.073) [-1297.958] (-1299.281) (-1306.170) -- 0:01:50
364500 -- (-1306.084) (-1295.576) [-1298.679] (-1301.757) * (-1299.417) [-1299.696] (-1298.216) (-1300.406) -- 0:01:49
365000 -- (-1299.433) [-1294.956] (-1298.422) (-1295.141) * (-1299.217) [-1299.302] (-1295.976) (-1310.234) -- 0:01:49
Average standard deviation of split frequencies: 0.001932
365500 -- [-1299.217] (-1300.700) (-1299.039) (-1296.727) * (-1297.701) [-1292.999] (-1299.604) (-1304.372) -- 0:01:49
366000 -- [-1296.890] (-1301.142) (-1305.522) (-1303.542) * (-1296.377) (-1300.213) [-1298.094] (-1306.873) -- 0:01:49
366500 -- (-1298.842) (-1295.356) (-1307.851) [-1299.711] * (-1293.958) (-1298.664) (-1296.915) [-1299.722] -- 0:01:48
367000 -- (-1294.237) (-1300.008) (-1302.088) [-1305.357] * (-1298.084) (-1302.944) [-1293.838] (-1298.368) -- 0:01:48
367500 -- (-1302.449) [-1297.963] (-1303.637) (-1300.780) * (-1310.466) [-1295.222] (-1296.058) (-1301.554) -- 0:01:48
368000 -- (-1296.999) [-1299.905] (-1309.010) (-1299.151) * (-1303.172) (-1295.527) [-1298.848] (-1294.835) -- 0:01:48
368500 -- (-1293.880) [-1293.709] (-1305.193) (-1296.608) * (-1298.473) [-1299.812] (-1307.461) (-1293.929) -- 0:01:47
369000 -- (-1299.946) [-1292.875] (-1299.349) (-1296.677) * (-1299.263) [-1297.777] (-1297.856) (-1297.476) -- 0:01:47
369500 -- (-1295.431) (-1297.292) [-1297.720] (-1297.296) * (-1301.284) (-1294.176) (-1293.770) [-1300.563] -- 0:01:47
370000 -- (-1297.207) (-1295.287) [-1294.265] (-1296.059) * (-1298.177) (-1300.306) [-1295.994] (-1296.470) -- 0:01:48
Average standard deviation of split frequencies: 0.001908
370500 -- [-1298.054] (-1299.212) (-1297.710) (-1299.078) * [-1299.547] (-1298.432) (-1307.803) (-1296.137) -- 0:01:48
371000 -- (-1301.630) (-1294.621) (-1299.617) [-1298.999] * [-1295.529] (-1297.873) (-1294.644) (-1304.317) -- 0:01:48
371500 -- (-1294.690) [-1293.762] (-1295.572) (-1295.726) * (-1295.506) [-1295.437] (-1299.250) (-1297.522) -- 0:01:48
372000 -- (-1302.727) [-1295.255] (-1299.427) (-1296.849) * (-1299.441) (-1300.376) (-1301.731) [-1294.967] -- 0:01:48
372500 -- [-1297.196] (-1298.284) (-1293.159) (-1309.623) * (-1298.557) [-1294.933] (-1296.184) (-1295.889) -- 0:01:47
373000 -- (-1301.762) (-1300.466) (-1295.738) [-1299.605] * (-1297.199) [-1296.648] (-1306.979) (-1297.581) -- 0:01:47
373500 -- (-1300.174) (-1297.455) [-1305.184] (-1301.325) * (-1302.173) [-1295.162] (-1299.861) (-1297.926) -- 0:01:47
374000 -- [-1301.233] (-1299.696) (-1300.335) (-1300.024) * (-1294.825) (-1292.858) (-1298.602) [-1297.267] -- 0:01:47
374500 -- [-1306.187] (-1295.277) (-1296.621) (-1298.958) * (-1299.097) (-1298.294) [-1296.882] (-1309.589) -- 0:01:46
375000 -- (-1302.958) (-1296.645) (-1299.438) [-1294.610] * (-1298.073) (-1297.826) [-1299.478] (-1302.014) -- 0:01:46
Average standard deviation of split frequencies: 0.001881
375500 -- [-1296.035] (-1295.372) (-1296.483) (-1296.750) * (-1299.966) (-1303.769) [-1303.543] (-1299.684) -- 0:01:48
376000 -- (-1298.598) [-1297.159] (-1304.122) (-1298.508) * (-1302.130) [-1298.519] (-1299.241) (-1297.595) -- 0:01:47
376500 -- [-1303.832] (-1299.713) (-1297.511) (-1297.689) * (-1310.378) (-1298.386) [-1300.106] (-1301.186) -- 0:01:47
377000 -- [-1296.433] (-1299.232) (-1296.537) (-1298.845) * [-1298.550] (-1299.183) (-1298.452) (-1300.081) -- 0:01:47
377500 -- [-1298.161] (-1299.302) (-1297.493) (-1295.206) * [-1300.210] (-1296.190) (-1295.974) (-1300.646) -- 0:01:47
378000 -- (-1306.380) (-1300.464) (-1294.115) [-1299.337] * (-1296.020) (-1293.652) (-1297.580) [-1300.070] -- 0:01:46
378500 -- [-1299.089] (-1295.483) (-1301.108) (-1294.341) * (-1300.422) (-1294.456) [-1301.235] (-1297.291) -- 0:01:46
379000 -- (-1299.316) (-1297.043) (-1299.790) [-1298.956] * (-1299.050) (-1300.532) [-1293.387] (-1297.287) -- 0:01:46
379500 -- [-1297.604] (-1299.282) (-1299.456) (-1296.892) * (-1303.689) (-1298.381) (-1296.758) [-1295.208] -- 0:01:46
380000 -- (-1299.221) (-1302.832) (-1304.406) [-1295.492] * (-1300.926) (-1303.071) [-1292.799] (-1297.131) -- 0:01:46
Average standard deviation of split frequencies: 0.001858
380500 -- (-1298.242) (-1307.858) [-1298.371] (-1300.260) * (-1297.287) (-1297.270) [-1297.951] (-1302.723) -- 0:01:47
381000 -- [-1302.284] (-1302.971) (-1304.213) (-1299.968) * (-1300.811) [-1298.429] (-1298.515) (-1296.416) -- 0:01:47
381500 -- (-1302.357) (-1295.171) [-1298.791] (-1304.732) * [-1294.650] (-1297.790) (-1299.545) (-1299.331) -- 0:01:47
382000 -- [-1300.900] (-1299.810) (-1298.630) (-1295.978) * (-1298.243) (-1300.365) (-1296.190) [-1299.574] -- 0:01:46
382500 -- (-1305.237) (-1299.085) [-1298.232] (-1303.226) * (-1297.904) [-1298.148] (-1300.358) (-1298.227) -- 0:01:46
383000 -- (-1304.145) [-1299.723] (-1299.423) (-1300.556) * [-1294.579] (-1305.215) (-1304.136) (-1313.456) -- 0:01:46
383500 -- (-1306.527) (-1302.853) [-1298.258] (-1302.385) * (-1297.428) [-1301.422] (-1303.292) (-1297.955) -- 0:01:46
384000 -- (-1301.661) (-1294.003) [-1299.810] (-1298.604) * [-1301.440] (-1301.880) (-1295.824) (-1298.508) -- 0:01:47
384500 -- [-1300.111] (-1293.657) (-1299.671) (-1295.131) * (-1294.498) (-1299.314) (-1302.334) [-1299.148] -- 0:01:47
385000 -- (-1301.206) (-1305.627) (-1301.169) [-1297.868] * (-1295.167) (-1305.250) (-1299.735) [-1301.671] -- 0:01:47
Average standard deviation of split frequencies: 0.001832
385500 -- (-1303.391) [-1294.346] (-1308.392) (-1298.617) * (-1299.679) (-1305.371) (-1297.598) [-1303.688] -- 0:01:46
386000 -- (-1303.599) [-1296.272] (-1302.304) (-1295.454) * (-1299.079) (-1302.378) (-1300.339) [-1302.404] -- 0:01:46
386500 -- (-1296.804) [-1294.137] (-1300.987) (-1296.282) * (-1296.744) (-1307.424) [-1299.319] (-1297.361) -- 0:01:46
387000 -- (-1295.290) (-1292.969) (-1298.481) [-1294.967] * (-1296.468) (-1300.541) (-1301.379) [-1297.318] -- 0:01:46
387500 -- (-1303.093) [-1297.678] (-1308.285) (-1297.775) * (-1293.703) (-1297.616) (-1300.182) [-1298.523] -- 0:01:45
388000 -- (-1296.792) [-1293.024] (-1298.627) (-1301.263) * (-1300.897) (-1300.761) [-1296.431] (-1303.468) -- 0:01:45
388500 -- (-1297.659) (-1300.776) [-1296.765] (-1301.560) * (-1299.937) (-1292.414) (-1309.884) [-1295.258] -- 0:01:45
389000 -- (-1306.147) (-1298.904) [-1296.244] (-1304.907) * [-1298.078] (-1299.327) (-1301.771) (-1302.578) -- 0:01:46
389500 -- (-1297.231) (-1306.896) (-1294.964) [-1296.539] * (-1297.708) [-1302.402] (-1296.266) (-1298.214) -- 0:01:46
390000 -- (-1298.744) (-1305.136) [-1297.829] (-1295.682) * [-1297.385] (-1294.675) (-1298.693) (-1298.133) -- 0:01:46
Average standard deviation of split frequencies: 0.002413
390500 -- (-1299.788) (-1305.819) (-1295.864) [-1295.150] * (-1302.161) [-1295.782] (-1295.885) (-1305.297) -- 0:01:46
391000 -- (-1296.622) (-1307.399) (-1299.771) [-1300.458] * (-1299.298) (-1298.457) (-1300.304) [-1299.388] -- 0:01:45
391500 -- (-1297.815) (-1298.653) [-1299.772] (-1299.481) * (-1302.293) [-1297.351] (-1298.187) (-1295.867) -- 0:01:45
392000 -- (-1299.907) [-1293.924] (-1294.348) (-1294.307) * (-1295.751) (-1294.389) [-1296.744] (-1300.760) -- 0:01:45
392500 -- (-1300.339) (-1296.595) [-1299.378] (-1296.238) * [-1299.058] (-1297.497) (-1302.544) (-1296.826) -- 0:01:45
393000 -- (-1300.472) [-1299.107] (-1293.752) (-1303.120) * (-1301.355) (-1301.200) [-1294.743] (-1299.765) -- 0:01:45
393500 -- (-1298.576) (-1301.776) (-1301.010) [-1298.480] * (-1299.742) (-1297.797) (-1298.226) [-1294.894] -- 0:01:44
394000 -- (-1299.083) (-1306.958) (-1301.697) [-1296.805] * [-1294.820] (-1297.446) (-1294.436) (-1296.417) -- 0:01:44
394500 -- (-1298.095) [-1302.540] (-1299.872) (-1298.437) * (-1293.274) (-1293.934) (-1303.842) [-1300.723] -- 0:01:44
395000 -- [-1302.812] (-1298.242) (-1294.992) (-1298.607) * (-1301.729) (-1293.794) (-1294.816) [-1294.227] -- 0:01:45
Average standard deviation of split frequencies: 0.001786
395500 -- (-1299.529) (-1296.221) (-1298.376) [-1303.967] * (-1309.251) (-1294.030) (-1299.664) [-1302.100] -- 0:01:45
396000 -- (-1298.914) (-1300.499) (-1301.608) [-1303.331] * (-1300.362) [-1298.341] (-1296.182) (-1298.044) -- 0:01:45
396500 -- [-1301.603] (-1297.139) (-1299.213) (-1303.909) * (-1301.652) [-1297.516] (-1305.375) (-1305.222) -- 0:01:45
397000 -- (-1302.478) (-1302.392) (-1294.945) [-1296.667] * (-1297.873) (-1303.175) (-1299.174) [-1300.673] -- 0:01:44
397500 -- (-1301.019) [-1298.806] (-1299.401) (-1302.161) * (-1302.895) (-1297.969) (-1303.754) [-1297.288] -- 0:01:44
398000 -- (-1300.295) (-1297.797) (-1306.120) [-1295.319] * (-1301.072) (-1301.819) [-1299.940] (-1300.567) -- 0:01:44
398500 -- (-1300.260) (-1294.186) (-1297.652) [-1293.387] * (-1298.859) (-1300.052) (-1299.067) [-1297.971] -- 0:01:44
399000 -- (-1301.446) [-1297.743] (-1292.852) (-1296.178) * [-1296.076] (-1296.825) (-1296.995) (-1305.745) -- 0:01:43
399500 -- (-1298.072) (-1295.786) [-1296.003] (-1302.152) * (-1297.407) [-1296.732] (-1295.007) (-1294.166) -- 0:01:43
400000 -- (-1297.499) (-1293.209) (-1295.009) [-1303.011] * (-1296.589) [-1305.255] (-1297.403) (-1302.670) -- 0:01:43
Average standard deviation of split frequencies: 0.001177
400500 -- (-1297.349) (-1301.308) [-1297.877] (-1301.744) * (-1296.844) [-1295.004] (-1301.412) (-1301.749) -- 0:01:44
401000 -- [-1299.242] (-1304.970) (-1298.129) (-1298.222) * (-1302.347) (-1295.968) [-1300.364] (-1296.762) -- 0:01:44
401500 -- (-1294.788) (-1306.801) [-1301.004] (-1298.901) * [-1299.432] (-1299.248) (-1297.068) (-1297.611) -- 0:01:44
402000 -- (-1294.502) (-1305.078) (-1304.208) [-1296.861] * (-1296.708) (-1296.233) (-1294.440) [-1297.210] -- 0:01:44
402500 -- (-1297.233) (-1304.052) [-1300.834] (-1297.184) * [-1296.059] (-1305.880) (-1295.407) (-1294.784) -- 0:01:43
403000 -- (-1296.377) (-1297.853) (-1299.364) [-1301.941] * (-1294.590) [-1298.661] (-1301.015) (-1294.176) -- 0:01:43
403500 -- (-1298.255) (-1305.566) [-1296.249] (-1300.946) * [-1296.583] (-1297.426) (-1305.135) (-1301.071) -- 0:01:43
404000 -- (-1295.647) (-1304.638) [-1297.161] (-1301.415) * (-1297.206) [-1302.617] (-1299.179) (-1295.886) -- 0:01:43
404500 -- (-1296.303) [-1298.451] (-1296.631) (-1299.662) * (-1299.690) (-1307.421) (-1295.681) [-1300.711] -- 0:01:43
405000 -- [-1298.721] (-1303.640) (-1308.486) (-1294.832) * [-1301.513] (-1310.316) (-1300.711) (-1296.407) -- 0:01:42
Average standard deviation of split frequencies: 0.001161
405500 -- (-1293.829) (-1300.097) (-1300.289) [-1293.794] * (-1306.518) [-1297.829] (-1303.170) (-1293.700) -- 0:01:42
406000 -- [-1297.814] (-1304.512) (-1305.356) (-1300.348) * (-1305.699) [-1296.386] (-1299.511) (-1308.347) -- 0:01:42
406500 -- [-1295.043] (-1301.003) (-1300.847) (-1305.527) * (-1308.598) [-1293.919] (-1303.713) (-1304.913) -- 0:01:43
407000 -- (-1301.362) [-1297.936] (-1296.600) (-1307.725) * (-1301.068) (-1295.353) (-1295.736) [-1303.524] -- 0:01:43
407500 -- (-1297.028) (-1298.043) (-1294.725) [-1302.811] * [-1305.058] (-1296.025) (-1297.000) (-1307.641) -- 0:01:43
408000 -- [-1294.309] (-1295.495) (-1293.429) (-1305.499) * (-1303.196) (-1297.792) (-1297.361) [-1296.491] -- 0:01:43
408500 -- (-1302.947) (-1295.734) [-1298.988] (-1296.137) * (-1296.516) (-1295.770) [-1298.300] (-1299.366) -- 0:01:42
409000 -- (-1298.381) [-1298.087] (-1301.030) (-1297.386) * (-1302.942) (-1296.135) [-1298.835] (-1298.415) -- 0:01:42
409500 -- (-1296.238) [-1302.085] (-1294.928) (-1299.935) * (-1303.117) [-1294.188] (-1297.352) (-1297.216) -- 0:01:42
410000 -- (-1298.396) (-1296.501) (-1294.158) [-1298.171] * [-1298.178] (-1296.940) (-1300.450) (-1303.599) -- 0:01:42
Average standard deviation of split frequencies: 0.001148
410500 -- [-1296.121] (-1297.924) (-1295.676) (-1299.312) * (-1296.706) (-1298.551) [-1301.959] (-1309.576) -- 0:01:41
411000 -- (-1293.228) [-1297.929] (-1300.898) (-1299.870) * (-1297.563) (-1302.062) (-1298.672) [-1298.570] -- 0:01:41
411500 -- (-1295.755) (-1301.346) [-1298.801] (-1302.487) * [-1296.371] (-1299.185) (-1294.868) (-1298.238) -- 0:01:41
412000 -- (-1298.271) (-1297.153) [-1301.026] (-1307.386) * (-1300.525) (-1306.081) [-1298.839] (-1298.463) -- 0:01:41
412500 -- (-1299.626) (-1303.902) [-1300.318] (-1296.820) * (-1306.618) [-1301.031] (-1303.327) (-1302.871) -- 0:01:42
413000 -- (-1301.240) [-1296.825] (-1302.380) (-1300.732) * (-1301.318) [-1297.698] (-1302.791) (-1295.360) -- 0:01:42
413500 -- (-1303.197) [-1301.198] (-1299.048) (-1301.762) * (-1300.644) [-1303.425] (-1306.285) (-1302.142) -- 0:01:42
414000 -- (-1293.726) (-1297.935) (-1294.093) [-1302.061] * (-1303.128) (-1294.958) [-1299.076] (-1303.408) -- 0:01:41
414500 -- (-1297.625) (-1297.996) (-1307.217) [-1296.880] * (-1301.083) [-1296.594] (-1297.443) (-1296.645) -- 0:01:41
415000 -- (-1296.965) [-1294.769] (-1297.781) (-1295.801) * (-1298.669) (-1298.728) [-1298.170] (-1299.712) -- 0:01:41
Average standard deviation of split frequencies: 0.001133
415500 -- (-1299.996) (-1304.847) [-1294.631] (-1305.024) * [-1299.443] (-1297.749) (-1295.148) (-1310.056) -- 0:01:41
416000 -- [-1297.242] (-1296.228) (-1297.135) (-1304.234) * (-1296.048) (-1301.473) [-1295.373] (-1303.647) -- 0:01:41
416500 -- (-1295.613) [-1296.377] (-1302.179) (-1301.748) * (-1302.038) (-1295.922) (-1297.202) [-1297.863] -- 0:01:40
417000 -- (-1305.090) (-1301.475) (-1300.627) [-1296.036] * (-1298.951) (-1302.519) (-1302.670) [-1299.561] -- 0:01:40
417500 -- (-1298.906) (-1294.998) (-1296.545) [-1291.748] * (-1294.796) (-1309.074) [-1296.881] (-1297.623) -- 0:01:40
418000 -- (-1301.648) (-1296.508) (-1302.729) [-1299.078] * (-1298.746) (-1297.601) [-1298.142] (-1292.968) -- 0:01:40
418500 -- [-1296.508] (-1302.812) (-1298.633) (-1295.430) * (-1296.951) [-1298.443] (-1294.915) (-1300.023) -- 0:01:41
419000 -- [-1298.035] (-1298.699) (-1300.453) (-1300.277) * (-1302.036) (-1294.922) (-1296.318) [-1299.586] -- 0:01:41
419500 -- (-1298.147) (-1309.019) [-1300.369] (-1299.121) * (-1300.327) [-1296.420] (-1299.428) (-1299.079) -- 0:01:41
420000 -- (-1297.733) [-1297.403] (-1301.214) (-1301.544) * (-1297.588) (-1294.900) (-1298.464) [-1297.719] -- 0:01:40
Average standard deviation of split frequencies: 0.001121
420500 -- [-1295.185] (-1294.223) (-1297.639) (-1295.867) * (-1300.841) (-1296.801) (-1296.861) [-1297.707] -- 0:01:40
421000 -- (-1292.877) (-1292.340) [-1295.442] (-1300.291) * (-1304.509) [-1296.318] (-1293.632) (-1302.116) -- 0:01:40
421500 -- (-1300.890) (-1296.410) [-1295.574] (-1301.917) * (-1303.824) [-1295.921] (-1297.094) (-1298.656) -- 0:01:40
422000 -- (-1301.566) (-1301.500) [-1296.998] (-1298.407) * [-1296.896] (-1296.712) (-1294.924) (-1304.875) -- 0:01:39
422500 -- (-1296.199) (-1298.698) [-1294.317] (-1293.846) * (-1297.432) (-1301.962) (-1299.106) [-1297.014] -- 0:01:39
423000 -- [-1297.306] (-1301.578) (-1299.932) (-1298.852) * (-1302.886) (-1297.132) [-1299.226] (-1294.314) -- 0:01:39
423500 -- (-1299.583) (-1302.371) (-1293.428) [-1303.483] * [-1299.809] (-1297.801) (-1299.600) (-1300.307) -- 0:01:39
424000 -- (-1301.761) (-1297.001) [-1293.828] (-1301.535) * (-1294.551) (-1296.518) [-1297.752] (-1302.342) -- 0:01:40
424500 -- [-1301.516] (-1301.848) (-1295.907) (-1300.752) * (-1294.683) (-1294.242) [-1297.499] (-1303.988) -- 0:01:40
425000 -- (-1297.770) [-1296.048] (-1302.530) (-1297.260) * (-1297.611) (-1298.436) [-1297.041] (-1298.977) -- 0:01:40
Average standard deviation of split frequencies: 0.001107
425500 -- (-1300.826) (-1300.314) [-1294.553] (-1308.118) * (-1295.056) (-1299.821) (-1297.528) [-1295.327] -- 0:01:39
426000 -- (-1299.962) (-1296.396) (-1299.500) [-1294.529] * [-1296.991] (-1310.468) (-1296.992) (-1299.856) -- 0:01:39
426500 -- (-1298.386) [-1290.610] (-1293.819) (-1297.923) * (-1298.959) (-1302.271) (-1295.164) [-1295.268] -- 0:01:39
427000 -- [-1297.762] (-1295.270) (-1302.548) (-1308.490) * (-1301.229) (-1300.313) (-1295.808) [-1295.071] -- 0:01:39
427500 -- (-1297.644) [-1301.306] (-1306.318) (-1297.049) * (-1295.140) (-1298.167) (-1299.907) [-1295.838] -- 0:01:39
428000 -- [-1296.816] (-1299.288) (-1303.559) (-1298.251) * (-1297.175) (-1301.356) (-1301.743) [-1299.609] -- 0:01:38
428500 -- (-1300.201) [-1294.538] (-1301.449) (-1297.577) * (-1294.982) (-1297.345) (-1295.689) [-1294.458] -- 0:01:38
429000 -- (-1299.665) [-1299.557] (-1302.996) (-1295.905) * (-1294.225) (-1301.665) [-1303.049] (-1297.559) -- 0:01:38
429500 -- (-1296.260) (-1297.116) [-1297.921] (-1300.516) * [-1296.301] (-1300.506) (-1303.901) (-1299.256) -- 0:01:38
430000 -- (-1299.790) (-1296.664) [-1296.059] (-1295.715) * [-1294.219] (-1309.122) (-1302.837) (-1297.749) -- 0:01:39
Average standard deviation of split frequencies: 0.001095
430500 -- (-1304.396) [-1298.311] (-1301.982) (-1297.985) * (-1300.140) [-1302.924] (-1299.626) (-1298.525) -- 0:01:39
431000 -- (-1297.284) (-1304.446) [-1295.014] (-1304.538) * (-1297.208) [-1300.217] (-1297.488) (-1297.468) -- 0:01:39
431500 -- (-1295.050) (-1294.725) [-1299.241] (-1299.593) * (-1295.496) (-1298.137) [-1292.647] (-1302.048) -- 0:01:38
432000 -- [-1296.182] (-1298.302) (-1298.070) (-1299.818) * (-1295.183) (-1302.430) [-1296.076] (-1301.147) -- 0:01:38
432500 -- (-1296.364) (-1299.102) [-1300.557] (-1299.512) * (-1294.866) (-1298.306) [-1291.298] (-1301.716) -- 0:01:38
433000 -- (-1304.113) (-1294.351) [-1294.741] (-1310.281) * (-1295.096) [-1299.635] (-1301.412) (-1300.568) -- 0:01:38
433500 -- (-1300.834) [-1296.649] (-1300.061) (-1309.096) * (-1297.135) (-1301.992) [-1294.608] (-1298.051) -- 0:01:38
434000 -- (-1294.828) [-1297.685] (-1297.977) (-1300.026) * [-1296.396] (-1303.531) (-1304.219) (-1298.999) -- 0:01:37
434500 -- (-1294.000) (-1295.983) (-1302.709) [-1297.186] * (-1295.023) (-1302.543) [-1295.660] (-1298.544) -- 0:01:37
435000 -- (-1303.234) (-1298.622) [-1298.318] (-1304.420) * (-1302.197) (-1300.104) [-1297.982] (-1297.298) -- 0:01:37
Average standard deviation of split frequencies: 0.001081
435500 -- (-1294.407) [-1297.010] (-1297.871) (-1301.560) * (-1300.995) [-1296.211] (-1296.614) (-1300.578) -- 0:01:38
436000 -- (-1299.190) [-1297.321] (-1298.007) (-1296.621) * (-1296.492) (-1295.161) (-1299.931) [-1300.114] -- 0:01:38
436500 -- [-1298.113] (-1306.715) (-1297.669) (-1296.421) * [-1296.775] (-1295.875) (-1302.518) (-1305.745) -- 0:01:38
437000 -- (-1300.119) [-1295.666] (-1295.517) (-1301.948) * [-1296.304] (-1298.439) (-1299.131) (-1306.300) -- 0:01:37
437500 -- [-1295.195] (-1302.336) (-1295.792) (-1298.165) * [-1293.843] (-1298.095) (-1302.475) (-1305.774) -- 0:01:37
438000 -- (-1293.888) (-1299.412) [-1298.422] (-1299.423) * (-1294.345) [-1300.442] (-1299.692) (-1301.284) -- 0:01:37
438500 -- (-1300.555) (-1299.566) (-1302.686) [-1299.741] * (-1294.866) (-1303.057) (-1299.086) [-1306.112] -- 0:01:37
439000 -- [-1303.924] (-1294.444) (-1302.002) (-1297.330) * (-1297.642) (-1301.397) (-1295.316) [-1296.288] -- 0:01:37
439500 -- [-1296.374] (-1295.795) (-1300.077) (-1297.715) * (-1294.431) (-1301.813) (-1301.591) [-1303.766] -- 0:01:36
440000 -- (-1305.219) [-1298.337] (-1305.499) (-1299.512) * [-1294.386] (-1304.990) (-1297.532) (-1300.817) -- 0:01:36
Average standard deviation of split frequencies: 0.001070
440500 -- (-1295.279) [-1297.395] (-1300.848) (-1298.759) * (-1294.361) [-1300.320] (-1297.304) (-1303.107) -- 0:01:36
441000 -- (-1295.656) (-1296.916) [-1300.828] (-1301.727) * [-1296.203] (-1299.793) (-1299.799) (-1307.585) -- 0:01:36
441500 -- [-1297.075] (-1306.850) (-1306.199) (-1293.737) * (-1294.522) [-1299.983] (-1301.913) (-1297.448) -- 0:01:37
442000 -- [-1293.556] (-1303.233) (-1297.690) (-1301.609) * (-1294.038) [-1303.746] (-1296.722) (-1298.826) -- 0:01:37
442500 -- [-1293.790] (-1298.720) (-1301.605) (-1297.152) * [-1292.149] (-1302.829) (-1298.135) (-1298.844) -- 0:01:37
443000 -- (-1300.397) (-1295.675) (-1304.792) [-1299.992] * [-1297.398] (-1302.303) (-1302.194) (-1296.054) -- 0:01:36
443500 -- (-1296.093) (-1302.023) [-1298.250] (-1296.353) * (-1305.996) [-1296.489] (-1301.196) (-1296.290) -- 0:01:36
444000 -- [-1294.123] (-1300.457) (-1301.018) (-1293.260) * (-1301.873) (-1297.639) [-1298.800] (-1294.112) -- 0:01:36
444500 -- [-1296.607] (-1298.713) (-1297.345) (-1298.701) * (-1296.373) [-1302.272] (-1296.187) (-1298.332) -- 0:01:36
445000 -- (-1296.746) [-1300.298] (-1295.135) (-1305.846) * (-1303.630) (-1299.638) (-1299.821) [-1294.527] -- 0:01:36
Average standard deviation of split frequencies: 0.001057
445500 -- [-1296.011] (-1309.286) (-1297.472) (-1296.704) * (-1297.642) (-1301.344) [-1297.465] (-1297.816) -- 0:01:35
446000 -- (-1293.821) [-1294.518] (-1297.254) (-1302.078) * (-1301.025) [-1294.764] (-1305.892) (-1294.124) -- 0:01:35
446500 -- [-1298.852] (-1301.500) (-1300.883) (-1295.421) * [-1302.345] (-1297.927) (-1300.215) (-1294.275) -- 0:01:35
447000 -- (-1306.266) (-1296.272) (-1300.873) [-1299.062] * (-1307.278) (-1296.115) (-1303.226) [-1300.256] -- 0:01:35
447500 -- (-1295.912) [-1297.074] (-1300.406) (-1298.265) * (-1303.339) (-1301.395) [-1303.742] (-1295.248) -- 0:01:36
448000 -- (-1296.530) [-1298.738] (-1298.808) (-1302.234) * (-1300.073) (-1299.499) (-1298.931) [-1303.873] -- 0:01:36
448500 -- (-1296.376) (-1307.357) [-1298.441] (-1302.408) * [-1298.721] (-1296.488) (-1295.526) (-1298.033) -- 0:01:35
449000 -- (-1301.317) [-1296.577] (-1300.896) (-1299.844) * (-1293.583) (-1298.950) [-1302.218] (-1302.699) -- 0:01:35
449500 -- (-1294.460) (-1301.842) [-1299.556] (-1301.698) * [-1300.270] (-1294.015) (-1295.425) (-1299.753) -- 0:01:35
450000 -- (-1298.521) [-1297.570] (-1301.254) (-1294.420) * (-1300.036) [-1294.560] (-1298.229) (-1301.765) -- 0:01:35
Average standard deviation of split frequencies: 0.001569
450500 -- (-1294.788) (-1301.894) [-1297.511] (-1298.841) * [-1299.854] (-1298.619) (-1297.808) (-1297.092) -- 0:01:35
451000 -- (-1298.129) [-1306.705] (-1296.564) (-1302.867) * [-1300.602] (-1305.601) (-1302.809) (-1297.656) -- 0:01:34
451500 -- (-1304.492) [-1297.307] (-1304.426) (-1306.608) * (-1297.320) (-1303.366) [-1299.666] (-1300.996) -- 0:01:34
452000 -- (-1305.207) [-1301.246] (-1299.196) (-1301.818) * [-1292.338] (-1304.622) (-1299.198) (-1304.353) -- 0:01:34
452500 -- (-1299.687) (-1296.482) [-1299.459] (-1297.801) * (-1300.692) (-1305.350) [-1296.836] (-1296.283) -- 0:01:34
453000 -- (-1304.404) (-1292.962) [-1299.606] (-1301.420) * (-1298.225) [-1300.425] (-1295.201) (-1299.693) -- 0:01:35
453500 -- (-1304.117) (-1296.043) [-1302.100] (-1302.128) * (-1299.335) [-1296.748] (-1296.170) (-1304.142) -- 0:01:35
454000 -- (-1299.888) [-1294.705] (-1298.370) (-1307.264) * (-1295.988) (-1297.419) (-1300.163) [-1294.959] -- 0:01:35
454500 -- (-1298.492) (-1296.198) [-1296.048] (-1301.085) * (-1303.371) [-1298.209] (-1294.743) (-1296.315) -- 0:01:34
455000 -- (-1300.292) (-1293.894) [-1298.991] (-1298.439) * (-1298.591) (-1297.678) [-1297.953] (-1302.528) -- 0:01:34
Average standard deviation of split frequencies: 0.001551
455500 -- (-1297.414) [-1294.321] (-1307.312) (-1302.220) * (-1299.643) [-1296.314] (-1302.540) (-1309.572) -- 0:01:34
456000 -- (-1295.926) (-1296.055) (-1308.486) [-1295.217] * (-1298.033) (-1302.001) [-1300.032] (-1301.439) -- 0:01:34
456500 -- (-1303.493) (-1299.360) [-1301.786] (-1294.733) * (-1300.086) (-1300.727) [-1297.363] (-1299.011) -- 0:01:34
457000 -- [-1296.952] (-1295.609) (-1300.234) (-1300.418) * (-1296.047) [-1300.490] (-1298.117) (-1296.634) -- 0:01:33
457500 -- [-1295.478] (-1294.988) (-1304.446) (-1296.854) * (-1298.903) (-1303.220) [-1292.855] (-1303.256) -- 0:01:33
458000 -- (-1301.835) (-1297.204) (-1306.497) [-1299.871] * [-1296.437] (-1295.763) (-1295.716) (-1302.943) -- 0:01:33
458500 -- [-1291.954] (-1299.673) (-1300.224) (-1303.832) * [-1299.842] (-1306.382) (-1302.640) (-1301.365) -- 0:01:33
459000 -- (-1295.483) (-1296.848) [-1307.773] (-1302.678) * [-1297.503] (-1300.351) (-1297.376) (-1301.492) -- 0:01:34
459500 -- (-1299.343) [-1294.651] (-1306.189) (-1298.905) * [-1299.893] (-1295.646) (-1301.580) (-1299.305) -- 0:01:34
460000 -- (-1296.963) (-1295.333) [-1300.364] (-1298.083) * [-1299.851] (-1300.462) (-1297.913) (-1302.911) -- 0:01:33
Average standard deviation of split frequencies: 0.001535
460500 -- (-1297.851) [-1297.940] (-1301.624) (-1304.864) * (-1299.188) (-1300.808) [-1303.850] (-1301.180) -- 0:01:33
461000 -- [-1295.533] (-1296.946) (-1305.915) (-1302.619) * (-1295.325) (-1305.629) (-1294.726) [-1300.979] -- 0:01:33
461500 -- (-1295.415) (-1301.499) [-1305.685] (-1296.655) * [-1294.739] (-1304.679) (-1304.707) (-1295.107) -- 0:01:33
462000 -- (-1297.794) (-1303.217) [-1304.518] (-1300.898) * (-1297.534) (-1307.350) [-1304.986] (-1301.079) -- 0:01:33
462500 -- (-1310.602) [-1295.031] (-1299.440) (-1305.676) * (-1293.795) [-1303.673] (-1300.586) (-1297.315) -- 0:01:32
463000 -- (-1295.658) (-1299.256) (-1302.250) [-1297.797] * (-1300.100) (-1304.643) (-1305.540) [-1294.909] -- 0:01:32
463500 -- (-1293.061) [-1299.120] (-1292.397) (-1302.010) * (-1295.729) (-1306.391) (-1302.163) [-1306.360] -- 0:01:32
464000 -- [-1295.676] (-1291.557) (-1296.189) (-1301.391) * (-1299.710) (-1300.310) (-1296.942) [-1297.224] -- 0:01:32
464500 -- [-1295.580] (-1303.324) (-1300.259) (-1305.708) * [-1299.805] (-1296.392) (-1295.491) (-1296.112) -- 0:01:32
465000 -- (-1301.252) (-1299.240) (-1299.865) [-1301.449] * (-1294.901) [-1298.147] (-1301.604) (-1297.017) -- 0:01:33
Average standard deviation of split frequencies: 0.001517
465500 -- (-1300.396) (-1304.238) (-1296.662) [-1295.675] * (-1303.084) (-1294.165) [-1301.582] (-1308.042) -- 0:01:33
466000 -- (-1299.242) (-1303.252) [-1295.270] (-1305.341) * (-1299.753) (-1301.143) (-1299.122) [-1299.655] -- 0:01:32
466500 -- [-1298.293] (-1300.670) (-1299.869) (-1300.270) * (-1294.263) [-1298.146] (-1308.532) (-1299.858) -- 0:01:32
467000 -- [-1298.183] (-1299.627) (-1302.464) (-1298.080) * (-1297.968) (-1310.453) (-1303.617) [-1302.676] -- 0:01:32
467500 -- (-1297.455) [-1300.196] (-1298.694) (-1300.236) * (-1296.366) (-1295.921) [-1294.680] (-1303.230) -- 0:01:32
468000 -- (-1304.592) (-1296.266) [-1302.479] (-1295.026) * (-1302.170) [-1295.645] (-1297.441) (-1301.303) -- 0:01:32
468500 -- (-1301.148) (-1306.249) (-1298.188) [-1297.198] * (-1294.376) (-1301.510) [-1296.168] (-1294.779) -- 0:01:31
469000 -- (-1297.273) [-1296.498] (-1302.161) (-1296.499) * [-1297.750] (-1302.215) (-1296.305) (-1301.576) -- 0:01:31
469500 -- (-1299.222) [-1297.584] (-1298.117) (-1302.625) * (-1298.365) (-1299.148) [-1292.086] (-1298.041) -- 0:01:31
470000 -- (-1296.178) [-1301.690] (-1295.625) (-1308.570) * [-1301.233] (-1296.118) (-1290.980) (-1298.279) -- 0:01:31
Average standard deviation of split frequencies: 0.001502
470500 -- (-1299.046) (-1298.320) [-1298.541] (-1297.730) * [-1298.538] (-1301.556) (-1294.268) (-1298.995) -- 0:01:32
471000 -- (-1297.200) (-1302.868) [-1297.174] (-1299.692) * (-1303.413) (-1300.893) [-1296.300] (-1296.252) -- 0:01:32
471500 -- [-1296.028] (-1307.302) (-1303.143) (-1299.357) * [-1295.983] (-1299.454) (-1302.881) (-1300.702) -- 0:01:31
472000 -- (-1298.325) (-1300.055) [-1304.070] (-1300.243) * (-1299.931) (-1296.451) (-1299.648) [-1299.431] -- 0:01:31
472500 -- (-1295.825) (-1302.324) (-1300.645) [-1293.702] * [-1297.600] (-1297.320) (-1294.687) (-1303.390) -- 0:01:31
473000 -- (-1304.014) (-1297.885) (-1303.141) [-1299.671] * (-1299.844) (-1297.108) (-1295.870) [-1295.982] -- 0:01:31
473500 -- (-1299.717) [-1295.576] (-1298.169) (-1307.003) * (-1294.717) (-1295.820) [-1301.647] (-1297.933) -- 0:01:31
474000 -- [-1297.297] (-1295.254) (-1306.152) (-1301.569) * (-1301.320) [-1300.528] (-1302.085) (-1302.317) -- 0:01:30
474500 -- [-1294.637] (-1303.308) (-1311.948) (-1301.075) * [-1294.527] (-1298.183) (-1300.085) (-1299.427) -- 0:01:30
475000 -- [-1294.365] (-1299.840) (-1307.681) (-1303.500) * [-1291.772] (-1298.469) (-1307.943) (-1299.279) -- 0:01:30
Average standard deviation of split frequencies: 0.001486
475500 -- (-1300.511) (-1298.759) [-1306.358] (-1297.470) * [-1295.478] (-1303.178) (-1298.186) (-1310.273) -- 0:01:30
476000 -- (-1301.087) (-1295.446) (-1302.267) [-1299.266] * (-1303.312) [-1298.963] (-1306.058) (-1303.397) -- 0:01:30
476500 -- (-1305.409) (-1299.603) (-1301.675) [-1295.495] * (-1296.666) [-1296.824] (-1299.302) (-1301.512) -- 0:01:31
477000 -- (-1301.076) (-1294.834) [-1307.079] (-1296.958) * (-1294.944) (-1299.997) [-1297.939] (-1304.036) -- 0:01:31
477500 -- (-1295.408) [-1295.019] (-1300.159) (-1299.129) * (-1295.114) (-1300.172) [-1297.172] (-1308.718) -- 0:01:30
478000 -- (-1295.638) (-1294.082) [-1303.491] (-1295.603) * (-1301.461) [-1296.896] (-1299.190) (-1298.129) -- 0:01:30
478500 -- (-1296.815) [-1297.178] (-1307.792) (-1294.744) * (-1302.334) (-1298.691) (-1300.141) [-1300.248] -- 0:01:30
479000 -- (-1300.326) [-1295.886] (-1299.776) (-1303.697) * [-1298.936] (-1300.193) (-1293.866) (-1303.778) -- 0:01:30
479500 -- (-1297.878) [-1295.122] (-1296.476) (-1292.312) * (-1301.027) [-1300.772] (-1299.303) (-1297.018) -- 0:01:30
480000 -- (-1301.787) (-1303.140) (-1300.602) [-1296.725] * (-1298.133) [-1304.107] (-1298.584) (-1298.181) -- 0:01:29
Average standard deviation of split frequencies: 0.001471
480500 -- [-1294.349] (-1306.714) (-1299.042) (-1298.532) * [-1301.548] (-1299.884) (-1299.431) (-1295.466) -- 0:01:29
481000 -- (-1305.800) [-1298.578] (-1298.337) (-1293.757) * (-1300.157) (-1298.361) [-1297.870] (-1296.464) -- 0:01:29
481500 -- (-1306.552) [-1295.853] (-1309.681) (-1301.746) * [-1298.697] (-1295.774) (-1300.024) (-1300.002) -- 0:01:29
482000 -- (-1302.028) (-1303.935) (-1303.123) [-1302.206] * (-1295.275) [-1301.114] (-1304.749) (-1303.325) -- 0:01:30
482500 -- [-1296.112] (-1304.748) (-1301.579) (-1299.277) * (-1300.198) [-1294.639] (-1296.797) (-1304.834) -- 0:01:30
483000 -- (-1300.663) [-1295.111] (-1299.190) (-1302.134) * (-1297.392) (-1301.396) [-1296.563] (-1304.681) -- 0:01:29
483500 -- (-1302.106) (-1295.301) (-1299.684) [-1296.625] * (-1298.948) [-1298.376] (-1293.337) (-1297.133) -- 0:01:29
484000 -- (-1305.917) (-1297.695) [-1297.800] (-1304.306) * (-1295.760) (-1303.028) (-1302.590) [-1297.839] -- 0:01:29
484500 -- (-1297.864) [-1300.241] (-1298.016) (-1302.702) * (-1295.649) (-1305.669) [-1297.621] (-1297.259) -- 0:01:29
485000 -- (-1299.822) (-1305.354) (-1294.477) [-1300.299] * (-1297.155) (-1302.143) [-1295.552] (-1295.791) -- 0:01:29
Average standard deviation of split frequencies: 0.001455
485500 -- (-1303.083) (-1299.877) [-1297.041] (-1301.007) * (-1300.818) (-1304.359) [-1296.764] (-1298.009) -- 0:01:29
486000 -- (-1305.008) (-1300.192) [-1298.931] (-1297.442) * (-1294.843) (-1293.658) [-1293.755] (-1304.315) -- 0:01:28
486500 -- [-1301.179] (-1299.140) (-1301.615) (-1301.877) * [-1295.369] (-1301.083) (-1295.354) (-1301.539) -- 0:01:28
487000 -- [-1294.644] (-1308.875) (-1295.723) (-1295.678) * (-1307.860) [-1300.172] (-1297.716) (-1295.384) -- 0:01:28
487500 -- [-1294.153] (-1303.311) (-1296.858) (-1295.705) * (-1305.074) (-1297.131) (-1293.721) [-1295.922] -- 0:01:28
488000 -- [-1294.519] (-1305.118) (-1297.953) (-1301.856) * (-1302.189) (-1303.478) [-1299.356] (-1303.537) -- 0:01:29
488500 -- (-1301.391) (-1297.507) (-1294.194) [-1295.472] * (-1300.478) [-1303.160] (-1304.934) (-1299.710) -- 0:01:29
489000 -- (-1294.106) [-1302.683] (-1296.404) (-1306.925) * (-1300.482) [-1301.585] (-1298.323) (-1297.588) -- 0:01:28
489500 -- (-1298.720) (-1300.909) [-1294.641] (-1295.304) * (-1305.649) (-1303.469) [-1297.622] (-1295.417) -- 0:01:28
490000 -- (-1296.205) (-1298.224) (-1293.976) [-1295.207] * (-1297.978) (-1293.381) [-1296.222] (-1298.553) -- 0:01:28
Average standard deviation of split frequencies: 0.001441
490500 -- (-1299.127) (-1300.657) [-1306.715] (-1296.580) * (-1296.276) [-1296.047] (-1295.585) (-1298.000) -- 0:01:28
491000 -- (-1303.951) (-1296.720) (-1304.711) [-1297.139] * (-1303.680) (-1300.749) [-1296.033] (-1300.299) -- 0:01:28
491500 -- (-1304.998) (-1303.941) [-1296.450] (-1301.520) * (-1301.957) [-1298.924] (-1294.519) (-1293.360) -- 0:01:27
492000 -- [-1299.473] (-1304.618) (-1297.443) (-1296.319) * (-1297.461) (-1298.962) [-1299.907] (-1295.963) -- 0:01:27
492500 -- (-1295.065) (-1305.931) (-1302.474) [-1296.349] * (-1300.211) (-1301.343) (-1293.969) [-1297.428] -- 0:01:27
493000 -- (-1301.415) (-1307.473) [-1297.121] (-1295.580) * (-1294.965) (-1304.151) (-1296.405) [-1295.843] -- 0:01:27
493500 -- [-1294.187] (-1301.915) (-1298.704) (-1303.087) * [-1296.679] (-1301.586) (-1302.030) (-1294.701) -- 0:01:27
494000 -- (-1296.035) (-1302.285) [-1294.327] (-1303.665) * (-1297.641) (-1301.025) (-1304.923) [-1296.947] -- 0:01:28
494500 -- (-1298.386) (-1304.888) (-1296.616) [-1301.408] * (-1299.804) [-1296.958] (-1299.535) (-1295.179) -- 0:01:27
495000 -- (-1294.897) (-1296.151) (-1299.459) [-1297.415] * (-1292.325) (-1300.975) [-1299.613] (-1296.303) -- 0:01:27
Average standard deviation of split frequencies: 0.001426
495500 -- (-1299.952) [-1298.574] (-1302.772) (-1295.484) * (-1296.463) (-1296.646) (-1300.636) [-1304.023] -- 0:01:27
496000 -- (-1304.248) (-1305.618) (-1295.537) [-1297.981] * (-1294.000) (-1305.946) (-1309.733) [-1293.509] -- 0:01:27
496500 -- [-1298.322] (-1301.170) (-1297.464) (-1300.805) * [-1294.242] (-1298.554) (-1304.264) (-1297.229) -- 0:01:27
497000 -- (-1293.168) [-1296.536] (-1296.133) (-1297.979) * (-1298.134) [-1302.556] (-1296.353) (-1295.399) -- 0:01:27
497500 -- (-1299.488) [-1296.931] (-1306.672) (-1299.237) * (-1296.366) (-1299.715) [-1298.898] (-1297.061) -- 0:01:26
498000 -- (-1298.317) (-1295.452) [-1297.957] (-1298.063) * (-1295.430) (-1304.133) [-1298.010] (-1297.720) -- 0:01:26
498500 -- (-1299.166) (-1294.434) [-1294.515] (-1293.989) * [-1294.463] (-1302.517) (-1304.092) (-1297.132) -- 0:01:26
499000 -- (-1299.682) [-1298.704] (-1296.724) (-1298.900) * (-1302.666) (-1304.550) (-1303.975) [-1300.025] -- 0:01:26
499500 -- (-1308.918) (-1293.777) (-1298.689) [-1296.899] * [-1299.327] (-1310.159) (-1301.841) (-1298.079) -- 0:01:27
500000 -- [-1302.222] (-1296.860) (-1294.986) (-1296.085) * (-1297.393) (-1302.952) (-1298.452) [-1298.854] -- 0:01:27
Average standard deviation of split frequencies: 0.001412
500500 -- (-1304.983) (-1298.128) (-1297.388) [-1292.933] * (-1297.278) (-1307.814) (-1297.114) [-1295.257] -- 0:01:26
501000 -- (-1301.156) [-1300.077] (-1298.927) (-1296.627) * (-1302.853) (-1301.216) [-1297.599] (-1298.466) -- 0:01:26
501500 -- (-1294.913) (-1302.094) [-1300.689] (-1298.874) * (-1298.920) (-1303.578) (-1297.692) [-1302.677] -- 0:01:26
502000 -- (-1294.582) [-1300.328] (-1293.360) (-1308.217) * (-1298.651) (-1305.684) (-1308.083) [-1303.298] -- 0:01:26
502500 -- [-1294.383] (-1301.173) (-1297.899) (-1301.312) * [-1296.872] (-1301.367) (-1297.501) (-1298.544) -- 0:01:26
503000 -- (-1293.532) (-1294.320) [-1302.973] (-1295.159) * [-1298.893] (-1302.203) (-1303.568) (-1294.152) -- 0:01:25
503500 -- (-1300.415) (-1296.720) [-1297.620] (-1297.632) * (-1305.809) [-1298.555] (-1300.782) (-1300.248) -- 0:01:25
504000 -- (-1297.303) (-1302.102) [-1293.409] (-1297.030) * (-1301.941) [-1301.408] (-1305.421) (-1301.295) -- 0:01:25
504500 -- (-1295.407) (-1300.181) (-1293.312) [-1300.418] * [-1298.339] (-1298.996) (-1300.711) (-1304.857) -- 0:01:25
505000 -- (-1302.871) (-1303.181) [-1297.611] (-1296.661) * (-1300.233) (-1296.008) (-1301.364) [-1302.324] -- 0:01:25
Average standard deviation of split frequencies: 0.001397
505500 -- [-1297.543] (-1303.084) (-1295.009) (-1295.942) * (-1297.237) [-1298.190] (-1303.261) (-1298.420) -- 0:01:26
506000 -- (-1305.444) (-1300.927) (-1295.675) [-1306.741] * [-1295.655] (-1299.943) (-1299.247) (-1300.193) -- 0:01:25
506500 -- [-1294.069] (-1299.660) (-1294.701) (-1301.885) * (-1300.965) (-1312.035) [-1301.712] (-1297.299) -- 0:01:25
507000 -- [-1299.355] (-1299.681) (-1299.218) (-1299.767) * (-1298.723) (-1301.943) (-1306.352) [-1297.302] -- 0:01:25
507500 -- [-1294.859] (-1296.760) (-1303.217) (-1304.344) * (-1298.062) [-1306.898] (-1299.513) (-1317.955) -- 0:01:25
508000 -- (-1294.725) (-1298.785) [-1297.258] (-1300.092) * (-1298.551) (-1294.395) [-1297.405] (-1301.475) -- 0:01:25
508500 -- (-1298.214) (-1299.700) [-1298.170] (-1297.837) * (-1300.889) (-1302.561) (-1298.403) [-1304.282] -- 0:01:25
509000 -- (-1304.369) [-1302.928] (-1295.274) (-1300.725) * [-1298.942] (-1305.529) (-1296.080) (-1297.265) -- 0:01:24
509500 -- (-1306.283) (-1299.072) [-1294.173] (-1306.450) * [-1303.910] (-1305.116) (-1299.022) (-1295.667) -- 0:01:24
510000 -- [-1296.398] (-1297.677) (-1301.801) (-1300.214) * [-1302.138] (-1301.064) (-1304.213) (-1295.006) -- 0:01:24
Average standard deviation of split frequencies: 0.001385
510500 -- [-1298.357] (-1301.056) (-1298.617) (-1303.555) * (-1303.718) (-1298.363) (-1298.578) [-1301.257] -- 0:01:24
511000 -- (-1302.344) [-1294.149] (-1302.392) (-1304.647) * (-1306.746) (-1299.934) [-1299.411] (-1298.040) -- 0:01:24
511500 -- (-1298.019) [-1298.064] (-1307.612) (-1297.325) * (-1306.963) (-1301.129) (-1303.400) [-1299.543] -- 0:01:24
512000 -- (-1303.332) (-1305.398) [-1297.079] (-1300.380) * (-1299.300) (-1301.942) (-1297.119) [-1296.501] -- 0:01:24
512500 -- [-1299.147] (-1305.867) (-1300.447) (-1299.643) * (-1299.502) (-1304.301) (-1301.579) [-1298.627] -- 0:01:24
513000 -- [-1297.794] (-1295.944) (-1296.789) (-1307.045) * [-1298.339] (-1297.423) (-1294.705) (-1300.567) -- 0:01:24
513500 -- [-1295.269] (-1302.347) (-1303.166) (-1306.645) * (-1296.894) (-1300.551) [-1294.025] (-1300.561) -- 0:01:24
514000 -- (-1300.195) [-1297.361] (-1302.881) (-1300.778) * (-1293.624) (-1294.570) [-1292.561] (-1297.543) -- 0:01:24
514500 -- (-1298.728) (-1295.119) [-1298.070] (-1302.375) * (-1299.338) (-1300.812) (-1300.371) [-1295.170] -- 0:01:23
515000 -- (-1298.171) [-1296.469] (-1300.996) (-1303.235) * (-1301.767) (-1299.133) (-1301.065) [-1295.086] -- 0:01:23
Average standard deviation of split frequencies: 0.001370
515500 -- [-1300.474] (-1297.425) (-1294.596) (-1305.542) * (-1295.591) [-1302.251] (-1306.590) (-1297.656) -- 0:01:23
516000 -- [-1306.353] (-1302.797) (-1297.039) (-1297.794) * [-1300.314] (-1300.527) (-1304.080) (-1295.916) -- 0:01:23
516500 -- (-1301.249) [-1295.914] (-1295.216) (-1298.497) * (-1296.664) (-1302.520) (-1295.809) [-1293.955] -- 0:01:23
517000 -- (-1299.001) [-1295.072] (-1294.094) (-1299.889) * [-1296.767] (-1300.911) (-1302.524) (-1302.183) -- 0:01:23
517500 -- [-1298.980] (-1292.956) (-1299.610) (-1301.743) * (-1297.046) (-1299.160) (-1292.198) [-1301.709] -- 0:01:23
518000 -- (-1299.194) (-1300.332) (-1304.326) [-1296.509] * (-1298.904) (-1306.169) (-1298.965) [-1303.939] -- 0:01:23
518500 -- [-1297.528] (-1297.214) (-1299.466) (-1298.906) * (-1299.902) [-1301.782] (-1299.540) (-1306.143) -- 0:01:23
519000 -- (-1293.628) [-1299.011] (-1301.621) (-1296.372) * (-1294.173) (-1297.995) [-1300.410] (-1298.860) -- 0:01:23
519500 -- (-1295.911) [-1304.101] (-1305.282) (-1295.634) * (-1296.829) (-1296.092) (-1306.879) [-1297.727] -- 0:01:23
520000 -- (-1299.746) (-1306.721) (-1308.826) [-1295.045] * [-1295.866] (-1298.685) (-1296.352) (-1301.428) -- 0:01:23
Average standard deviation of split frequencies: 0.001358
520500 -- (-1305.883) (-1305.785) (-1309.604) [-1297.857] * [-1298.355] (-1296.328) (-1302.174) (-1295.451) -- 0:01:22
521000 -- (-1300.995) (-1300.671) (-1301.572) [-1294.594] * (-1306.380) [-1301.313] (-1297.030) (-1294.695) -- 0:01:22
521500 -- (-1303.818) (-1305.752) [-1297.864] (-1307.986) * (-1300.026) [-1299.883] (-1309.387) (-1294.948) -- 0:01:22
522000 -- (-1296.400) (-1301.943) [-1297.676] (-1296.409) * (-1300.386) (-1300.064) (-1301.683) [-1301.327] -- 0:01:22
522500 -- (-1299.354) [-1300.774] (-1307.127) (-1291.358) * [-1300.204] (-1299.048) (-1298.873) (-1297.109) -- 0:01:22
523000 -- (-1296.192) (-1304.517) (-1301.071) [-1296.297] * (-1303.898) [-1294.669] (-1303.390) (-1296.624) -- 0:01:22
523500 -- (-1302.255) (-1299.152) [-1300.764] (-1298.471) * (-1297.160) [-1306.466] (-1296.862) (-1295.286) -- 0:01:22
524000 -- (-1302.511) (-1299.370) [-1294.087] (-1303.385) * [-1298.696] (-1306.352) (-1303.812) (-1296.541) -- 0:01:22
524500 -- (-1300.000) (-1300.287) (-1294.682) [-1298.457] * (-1302.837) (-1302.234) (-1299.865) [-1296.673] -- 0:01:22
525000 -- [-1295.185] (-1300.534) (-1298.947) (-1300.492) * (-1300.065) [-1305.692] (-1309.642) (-1298.814) -- 0:01:22
Average standard deviation of split frequencies: 0.001344
525500 -- (-1297.856) (-1297.906) (-1294.951) [-1299.073] * [-1304.338] (-1303.784) (-1300.474) (-1303.824) -- 0:01:22
526000 -- (-1298.661) (-1299.217) [-1298.277] (-1297.658) * (-1301.136) [-1297.438] (-1301.059) (-1299.633) -- 0:01:22
526500 -- (-1296.064) (-1303.080) [-1295.074] (-1301.121) * (-1298.627) [-1296.612] (-1306.452) (-1293.308) -- 0:01:21
527000 -- [-1296.515] (-1306.680) (-1298.314) (-1297.503) * [-1295.835] (-1301.846) (-1301.939) (-1298.603) -- 0:01:21
527500 -- [-1299.614] (-1304.841) (-1297.173) (-1300.313) * (-1297.506) (-1304.663) (-1294.978) [-1295.111] -- 0:01:21
528000 -- [-1295.020] (-1296.743) (-1295.883) (-1301.890) * (-1299.100) (-1301.899) (-1301.386) [-1294.343] -- 0:01:21
528500 -- [-1295.134] (-1294.366) (-1296.556) (-1297.210) * (-1294.450) (-1300.222) [-1296.564] (-1301.125) -- 0:01:21
529000 -- (-1299.306) (-1296.787) (-1306.681) [-1294.381] * (-1297.008) (-1297.113) [-1292.834] (-1302.397) -- 0:01:21
529500 -- (-1297.090) [-1297.806] (-1300.942) (-1298.453) * [-1295.363] (-1306.137) (-1296.335) (-1296.874) -- 0:01:21
530000 -- (-1300.027) (-1299.872) (-1301.273) [-1298.700] * (-1304.627) (-1304.486) (-1296.897) [-1296.543] -- 0:01:21
Average standard deviation of split frequencies: 0.001332
530500 -- (-1298.909) (-1300.727) (-1302.403) [-1293.419] * (-1295.883) (-1298.947) (-1291.929) [-1299.254] -- 0:01:21
531000 -- [-1300.479] (-1301.633) (-1300.602) (-1301.218) * (-1296.445) (-1300.930) (-1303.948) [-1294.911] -- 0:01:21
531500 -- [-1294.122] (-1297.799) (-1293.969) (-1304.638) * [-1298.347] (-1302.383) (-1297.972) (-1298.434) -- 0:01:21
532000 -- (-1296.686) (-1298.586) (-1299.110) [-1300.587] * (-1301.097) (-1303.721) (-1292.391) [-1298.141] -- 0:01:20
532500 -- (-1297.093) [-1295.437] (-1298.834) (-1299.000) * (-1296.758) (-1304.708) [-1294.823] (-1295.235) -- 0:01:20
533000 -- (-1301.224) (-1304.078) (-1296.326) [-1298.182] * (-1302.564) (-1297.420) (-1300.599) [-1295.434] -- 0:01:20
533500 -- [-1299.155] (-1301.666) (-1302.644) (-1301.843) * (-1301.955) (-1296.267) [-1299.811] (-1296.810) -- 0:01:20
534000 -- [-1295.545] (-1298.947) (-1305.966) (-1303.691) * (-1296.292) [-1292.552] (-1302.069) (-1293.494) -- 0:01:20
534500 -- [-1294.824] (-1303.521) (-1308.605) (-1299.372) * (-1307.118) (-1298.602) (-1297.675) [-1300.416] -- 0:01:20
535000 -- (-1294.780) (-1301.537) (-1298.179) [-1295.594] * [-1307.669] (-1299.272) (-1294.407) (-1299.995) -- 0:01:20
Average standard deviation of split frequencies: 0.001319
535500 -- (-1306.538) (-1300.415) (-1299.621) [-1300.989] * (-1309.280) [-1298.845] (-1299.071) (-1302.823) -- 0:01:20
536000 -- (-1299.542) (-1304.306) [-1300.056] (-1296.731) * (-1302.314) [-1301.944] (-1299.534) (-1299.573) -- 0:01:20
536500 -- (-1295.892) [-1300.599] (-1296.728) (-1302.108) * (-1299.469) (-1309.318) [-1294.969] (-1301.829) -- 0:01:20
537000 -- (-1298.805) (-1311.909) [-1301.005] (-1300.684) * (-1302.624) (-1299.621) [-1300.897] (-1298.366) -- 0:01:20
537500 -- (-1299.675) [-1303.893] (-1300.339) (-1300.986) * (-1299.847) (-1303.017) (-1300.682) [-1295.487] -- 0:01:20
538000 -- [-1306.105] (-1298.779) (-1299.875) (-1298.271) * (-1296.142) (-1304.642) (-1295.756) [-1296.099] -- 0:01:19
538500 -- (-1305.353) (-1299.065) [-1292.927] (-1296.934) * (-1302.279) [-1300.690] (-1299.594) (-1293.873) -- 0:01:19
539000 -- (-1303.371) (-1295.562) (-1300.254) [-1296.587] * (-1295.503) (-1303.794) (-1295.144) [-1295.725] -- 0:01:19
539500 -- (-1303.125) (-1301.566) [-1297.470] (-1296.726) * (-1296.227) (-1296.961) [-1294.902] (-1301.246) -- 0:01:19
540000 -- [-1298.726] (-1299.025) (-1296.461) (-1294.702) * (-1299.428) [-1297.344] (-1300.807) (-1306.887) -- 0:01:19
Average standard deviation of split frequencies: 0.001308
540500 -- (-1300.386) (-1304.515) (-1299.799) [-1293.359] * [-1299.479] (-1298.479) (-1294.902) (-1301.724) -- 0:01:19
541000 -- (-1296.879) (-1302.432) [-1298.712] (-1296.348) * [-1295.041] (-1298.610) (-1303.840) (-1295.473) -- 0:01:19
541500 -- [-1296.791] (-1296.693) (-1295.622) (-1297.316) * [-1300.252] (-1299.551) (-1305.950) (-1301.389) -- 0:01:19
542000 -- (-1308.842) [-1297.220] (-1301.722) (-1295.875) * [-1302.591] (-1302.595) (-1308.421) (-1303.342) -- 0:01:19
542500 -- (-1301.131) (-1309.090) (-1299.697) [-1295.922] * (-1299.582) (-1299.762) (-1309.391) [-1294.182] -- 0:01:19
543000 -- (-1300.117) (-1299.851) (-1300.165) [-1295.427] * (-1298.371) (-1310.797) [-1307.148] (-1299.838) -- 0:01:19
543500 -- (-1301.737) [-1300.017] (-1293.780) (-1297.559) * [-1292.528] (-1299.266) (-1309.091) (-1298.406) -- 0:01:18
544000 -- (-1296.989) [-1297.013] (-1295.753) (-1298.480) * [-1300.344] (-1298.299) (-1294.211) (-1301.964) -- 0:01:18
544500 -- (-1299.277) (-1302.038) [-1300.396] (-1298.188) * [-1307.004] (-1300.924) (-1297.215) (-1294.579) -- 0:01:18
545000 -- (-1302.966) [-1304.760] (-1301.704) (-1299.678) * [-1302.623] (-1297.716) (-1300.458) (-1294.833) -- 0:01:18
Average standard deviation of split frequencies: 0.001295
545500 -- [-1296.948] (-1300.076) (-1301.763) (-1299.252) * (-1304.625) (-1294.569) [-1294.793] (-1303.715) -- 0:01:18
546000 -- [-1298.698] (-1302.888) (-1293.905) (-1298.422) * [-1300.573] (-1293.584) (-1295.124) (-1303.667) -- 0:01:18
546500 -- (-1299.377) (-1296.939) (-1300.637) [-1298.488] * [-1300.731] (-1295.444) (-1294.974) (-1299.237) -- 0:01:18
547000 -- [-1297.179] (-1297.400) (-1305.222) (-1295.004) * [-1297.022] (-1303.214) (-1294.737) (-1298.236) -- 0:01:18
547500 -- (-1298.842) (-1298.140) [-1300.339] (-1296.424) * (-1299.819) (-1307.171) (-1297.760) [-1298.258] -- 0:01:18
548000 -- [-1297.230] (-1297.334) (-1299.123) (-1293.723) * [-1297.441] (-1306.321) (-1299.026) (-1294.417) -- 0:01:18
548500 -- [-1301.152] (-1296.991) (-1300.057) (-1293.846) * [-1293.576] (-1303.325) (-1297.048) (-1300.191) -- 0:01:18
549000 -- (-1307.860) (-1299.047) (-1304.698) [-1294.769] * (-1299.020) (-1302.112) [-1300.638] (-1299.363) -- 0:01:18
549500 -- (-1300.294) [-1297.739] (-1302.479) (-1294.266) * (-1297.324) (-1301.377) [-1296.288] (-1304.085) -- 0:01:17
550000 -- (-1300.166) [-1302.579] (-1299.378) (-1296.106) * [-1294.255] (-1300.285) (-1299.448) (-1299.149) -- 0:01:17
Average standard deviation of split frequencies: 0.000856
550500 -- (-1308.287) (-1301.101) (-1299.166) [-1294.098] * (-1301.804) (-1296.715) (-1299.821) [-1299.440] -- 0:01:17
551000 -- [-1303.927] (-1296.539) (-1300.753) (-1295.125) * (-1307.436) (-1295.669) [-1297.639] (-1303.215) -- 0:01:17
551500 -- (-1301.998) (-1298.107) (-1310.711) [-1296.578] * (-1296.689) (-1296.943) [-1295.732] (-1307.164) -- 0:01:17
552000 -- (-1295.382) [-1301.842] (-1308.682) (-1298.485) * (-1301.924) [-1293.010] (-1294.616) (-1297.144) -- 0:01:17
552500 -- (-1300.814) (-1301.678) (-1297.040) [-1295.817] * (-1301.949) (-1299.122) [-1297.783] (-1293.558) -- 0:01:17
553000 -- (-1298.957) (-1299.069) [-1295.701] (-1298.443) * (-1299.114) [-1296.794] (-1299.098) (-1297.025) -- 0:01:17
553500 -- (-1296.906) [-1296.440] (-1295.563) (-1296.445) * (-1302.841) (-1300.351) (-1296.611) [-1296.167] -- 0:01:17
554000 -- (-1299.143) (-1294.099) (-1296.538) [-1303.269] * (-1293.537) (-1297.170) (-1296.645) [-1297.398] -- 0:01:17
554500 -- [-1300.267] (-1298.289) (-1298.242) (-1291.762) * (-1297.166) [-1301.257] (-1298.585) (-1296.813) -- 0:01:17
555000 -- (-1298.072) [-1297.478] (-1305.654) (-1299.515) * (-1293.672) (-1298.334) [-1295.328] (-1301.430) -- 0:01:16
Average standard deviation of split frequencies: 0.000848
555500 -- (-1305.924) [-1297.635] (-1306.971) (-1300.914) * [-1299.701] (-1298.402) (-1295.749) (-1303.845) -- 0:01:16
556000 -- [-1307.659] (-1297.484) (-1299.088) (-1294.441) * (-1298.202) [-1301.351] (-1299.385) (-1304.575) -- 0:01:16
556500 -- (-1311.579) (-1299.947) (-1301.043) [-1299.613] * (-1301.714) [-1297.961] (-1296.695) (-1302.458) -- 0:01:16
557000 -- (-1297.680) (-1297.115) (-1299.788) [-1292.193] * (-1304.342) (-1298.281) [-1295.926] (-1304.563) -- 0:01:16
557500 -- (-1299.985) (-1298.627) [-1302.081] (-1296.813) * (-1301.181) (-1295.933) (-1297.834) [-1310.310] -- 0:01:16
558000 -- [-1302.845] (-1299.667) (-1293.187) (-1293.976) * (-1302.162) [-1300.961] (-1298.030) (-1304.796) -- 0:01:16
558500 -- [-1301.069] (-1300.024) (-1299.616) (-1303.133) * (-1297.768) (-1296.615) [-1295.523] (-1301.513) -- 0:01:16
559000 -- [-1304.721] (-1294.924) (-1295.364) (-1298.684) * [-1296.335] (-1295.187) (-1295.124) (-1292.888) -- 0:01:16
559500 -- (-1296.803) [-1296.748] (-1296.484) (-1299.035) * (-1296.328) (-1299.049) (-1292.915) [-1295.652] -- 0:01:16
560000 -- [-1302.241] (-1298.889) (-1303.213) (-1300.078) * (-1298.132) (-1297.489) (-1295.221) [-1294.337] -- 0:01:16
Average standard deviation of split frequencies: 0.000841
560500 -- (-1299.986) [-1296.835] (-1300.980) (-1297.593) * (-1295.760) (-1296.293) (-1299.441) [-1297.468] -- 0:01:16
561000 -- [-1296.698] (-1293.130) (-1296.400) (-1301.302) * (-1301.789) [-1297.251] (-1300.039) (-1297.878) -- 0:01:15
561500 -- (-1296.170) [-1298.569] (-1293.486) (-1298.454) * (-1300.554) [-1299.048] (-1297.390) (-1299.081) -- 0:01:15
562000 -- (-1299.441) (-1297.643) [-1296.270] (-1300.068) * (-1305.093) (-1302.979) [-1301.700] (-1299.125) -- 0:01:15
562500 -- (-1300.886) [-1296.843] (-1294.789) (-1295.874) * (-1299.067) [-1296.590] (-1294.191) (-1295.637) -- 0:01:15
563000 -- (-1296.286) [-1300.836] (-1299.917) (-1301.659) * (-1294.134) (-1301.600) [-1297.086] (-1293.285) -- 0:01:15
563500 -- (-1296.212) (-1301.680) (-1301.472) [-1293.708] * (-1303.088) [-1300.737] (-1308.276) (-1301.565) -- 0:01:15
564000 -- (-1298.356) (-1301.889) [-1299.702] (-1299.362) * (-1299.564) [-1297.101] (-1304.072) (-1298.376) -- 0:01:15
564500 -- (-1298.070) (-1300.773) (-1299.686) [-1294.984] * (-1300.081) (-1299.071) (-1299.232) [-1307.275] -- 0:01:15
565000 -- [-1297.030] (-1293.517) (-1308.397) (-1301.288) * (-1303.590) [-1298.202] (-1297.404) (-1295.027) -- 0:01:15
Average standard deviation of split frequencies: 0.000833
565500 -- (-1298.562) (-1299.377) (-1303.705) [-1299.367] * (-1299.051) (-1293.254) (-1301.720) [-1298.026] -- 0:01:15
566000 -- (-1299.211) [-1295.282] (-1307.130) (-1296.359) * [-1302.847] (-1294.316) (-1293.564) (-1299.854) -- 0:01:15
566500 -- (-1298.203) [-1296.872] (-1305.134) (-1294.276) * (-1304.699) (-1300.695) (-1295.442) [-1297.277] -- 0:01:14
567000 -- [-1296.993] (-1295.200) (-1304.892) (-1304.906) * [-1295.957] (-1300.891) (-1294.866) (-1301.566) -- 0:01:14
567500 -- (-1296.078) (-1295.844) (-1297.667) [-1295.691] * (-1299.598) (-1296.125) (-1298.795) [-1298.475] -- 0:01:14
568000 -- (-1300.726) (-1296.945) [-1298.045] (-1296.653) * (-1299.420) (-1300.715) [-1298.849] (-1303.031) -- 0:01:14
568500 -- [-1298.446] (-1295.403) (-1299.748) (-1297.654) * [-1302.628] (-1296.154) (-1299.348) (-1298.313) -- 0:01:14
569000 -- [-1293.644] (-1295.904) (-1303.508) (-1301.670) * [-1296.167] (-1297.100) (-1297.161) (-1298.635) -- 0:01:14
569500 -- (-1299.766) [-1298.409] (-1306.650) (-1298.416) * (-1300.698) [-1300.486] (-1303.402) (-1299.256) -- 0:01:14
570000 -- [-1294.195] (-1297.591) (-1299.764) (-1294.497) * (-1299.065) (-1296.318) (-1302.576) [-1297.994] -- 0:01:14
Average standard deviation of split frequencies: 0.000826
570500 -- (-1303.301) (-1292.861) [-1298.636] (-1302.922) * (-1295.983) [-1299.886] (-1299.701) (-1298.113) -- 0:01:14
571000 -- (-1298.103) (-1301.323) [-1299.488] (-1298.146) * (-1299.781) [-1297.811] (-1297.088) (-1299.336) -- 0:01:14
571500 -- (-1302.069) (-1299.191) (-1296.166) [-1298.502] * (-1297.240) (-1298.980) [-1295.736] (-1301.195) -- 0:01:14
572000 -- [-1301.466] (-1296.537) (-1294.136) (-1298.813) * [-1297.249] (-1299.832) (-1302.654) (-1295.361) -- 0:01:14
572500 -- [-1298.394] (-1302.279) (-1295.084) (-1297.521) * (-1300.095) (-1307.969) (-1301.154) [-1304.005] -- 0:01:13
573000 -- [-1298.938] (-1302.181) (-1298.314) (-1294.673) * (-1297.247) (-1299.580) [-1296.626] (-1294.805) -- 0:01:13
573500 -- (-1298.563) [-1298.737] (-1301.655) (-1300.985) * [-1296.906] (-1300.797) (-1296.561) (-1298.854) -- 0:01:13
574000 -- (-1298.504) (-1296.950) (-1299.344) [-1298.486] * (-1294.565) (-1294.831) [-1299.532] (-1302.571) -- 0:01:13
574500 -- (-1303.589) (-1300.104) (-1303.947) [-1299.741] * (-1297.003) [-1297.764] (-1304.866) (-1300.578) -- 0:01:13
575000 -- [-1295.222] (-1294.088) (-1311.049) (-1301.528) * [-1297.755] (-1296.144) (-1306.360) (-1298.105) -- 0:01:13
Average standard deviation of split frequencies: 0.000409
575500 -- (-1302.873) [-1298.106] (-1300.807) (-1295.546) * (-1297.310) (-1304.494) [-1299.321] (-1294.786) -- 0:01:13
576000 -- (-1293.805) (-1295.953) (-1307.595) [-1299.474] * (-1308.213) [-1293.100] (-1299.574) (-1303.444) -- 0:01:13
576500 -- (-1295.099) [-1300.248] (-1307.532) (-1299.434) * [-1300.341] (-1298.181) (-1296.717) (-1302.179) -- 0:01:13
577000 -- (-1302.020) (-1301.276) [-1302.733] (-1299.464) * (-1301.020) (-1299.299) (-1300.305) [-1293.859] -- 0:01:13
577500 -- (-1295.167) (-1300.923) [-1296.790] (-1298.241) * (-1298.371) (-1301.433) [-1300.735] (-1292.904) -- 0:01:13
578000 -- (-1302.892) (-1298.305) [-1303.308] (-1300.985) * (-1297.179) (-1297.886) [-1296.895] (-1294.634) -- 0:01:13
578500 -- [-1294.229] (-1294.739) (-1302.654) (-1300.867) * [-1299.241] (-1297.400) (-1295.577) (-1296.527) -- 0:01:12
579000 -- (-1305.803) [-1292.663] (-1301.048) (-1298.077) * (-1299.378) (-1299.592) [-1298.044] (-1293.760) -- 0:01:12
579500 -- [-1293.567] (-1296.393) (-1296.898) (-1302.245) * (-1298.651) (-1294.878) [-1299.457] (-1292.424) -- 0:01:12
580000 -- [-1295.756] (-1295.151) (-1300.929) (-1297.415) * (-1306.684) [-1295.713] (-1304.657) (-1302.651) -- 0:01:12
Average standard deviation of split frequencies: 0.000406
580500 -- (-1293.651) (-1298.495) (-1295.412) [-1303.021] * (-1303.093) (-1297.320) [-1304.417] (-1297.016) -- 0:01:12
581000 -- (-1300.790) (-1298.114) (-1296.880) [-1303.088] * [-1300.522] (-1298.339) (-1303.610) (-1299.401) -- 0:01:12
581500 -- (-1302.270) (-1296.339) (-1294.002) [-1296.664] * [-1301.301] (-1300.566) (-1308.595) (-1299.425) -- 0:01:12
582000 -- [-1302.069] (-1303.035) (-1298.107) (-1300.861) * [-1302.828] (-1297.612) (-1301.146) (-1299.490) -- 0:01:12
582500 -- (-1299.819) (-1302.776) (-1301.360) [-1298.995] * (-1301.653) [-1296.648] (-1294.658) (-1297.184) -- 0:01:12
583000 -- [-1293.150] (-1299.023) (-1293.086) (-1296.077) * [-1302.435] (-1298.387) (-1296.359) (-1309.909) -- 0:01:12
583500 -- (-1300.049) (-1295.645) [-1299.923] (-1299.920) * (-1303.641) (-1296.885) [-1300.471] (-1298.091) -- 0:01:12
584000 -- (-1300.410) (-1295.399) (-1301.256) [-1297.002] * [-1295.916] (-1296.944) (-1296.777) (-1301.896) -- 0:01:11
584500 -- (-1297.621) (-1303.616) [-1295.075] (-1296.653) * (-1299.128) [-1295.989] (-1296.396) (-1299.992) -- 0:01:11
585000 -- (-1299.144) (-1296.094) (-1297.950) [-1295.088] * (-1296.441) (-1297.442) (-1303.661) [-1301.937] -- 0:01:11
Average standard deviation of split frequencies: 0.000804
585500 -- (-1295.999) (-1299.062) (-1297.593) [-1295.557] * (-1297.228) [-1296.889] (-1304.957) (-1304.881) -- 0:01:11
586000 -- [-1300.415] (-1293.258) (-1293.793) (-1296.150) * [-1300.465] (-1297.403) (-1300.374) (-1301.002) -- 0:01:11
586500 -- (-1298.922) (-1301.025) [-1298.309] (-1298.001) * (-1294.340) [-1295.408] (-1298.273) (-1296.908) -- 0:01:11
587000 -- (-1298.926) (-1297.566) [-1296.828] (-1301.447) * (-1294.774) [-1297.801] (-1299.827) (-1295.682) -- 0:01:11
587500 -- [-1298.729] (-1297.608) (-1305.084) (-1300.188) * [-1296.395] (-1304.701) (-1295.970) (-1298.794) -- 0:01:11
588000 -- (-1299.711) [-1298.804] (-1294.830) (-1294.910) * (-1296.912) (-1303.827) [-1300.416] (-1302.523) -- 0:01:11
588500 -- (-1295.973) (-1296.908) [-1299.023] (-1294.263) * (-1303.635) [-1294.205] (-1295.946) (-1306.343) -- 0:01:11
589000 -- (-1300.536) (-1295.300) (-1299.088) [-1298.011] * (-1300.093) (-1298.318) [-1300.160] (-1301.976) -- 0:01:11
589500 -- (-1305.178) (-1298.208) (-1299.488) [-1301.836] * (-1297.236) (-1295.426) (-1298.646) [-1299.381] -- 0:01:11
590000 -- [-1296.835] (-1297.783) (-1296.356) (-1305.977) * [-1302.515] (-1301.216) (-1296.006) (-1305.848) -- 0:01:10
Average standard deviation of split frequencies: 0.000798
590500 -- [-1297.801] (-1300.534) (-1303.985) (-1296.864) * (-1295.168) (-1296.727) [-1296.829] (-1306.772) -- 0:01:10
591000 -- (-1294.469) (-1302.711) (-1299.787) [-1298.452] * (-1309.286) (-1302.710) (-1298.790) [-1293.454] -- 0:01:10
591500 -- (-1299.979) [-1296.065] (-1307.362) (-1301.697) * [-1300.358] (-1302.566) (-1302.328) (-1296.759) -- 0:01:10
592000 -- [-1296.525] (-1299.431) (-1301.636) (-1303.762) * (-1298.765) (-1305.403) (-1298.712) [-1294.886] -- 0:01:10
592500 -- (-1303.690) (-1304.270) (-1301.282) [-1290.760] * (-1300.494) (-1301.416) [-1303.139] (-1302.162) -- 0:01:10
593000 -- (-1303.577) [-1296.229] (-1297.547) (-1298.984) * (-1297.174) (-1302.321) (-1304.029) [-1293.949] -- 0:01:10
593500 -- (-1302.861) [-1298.828] (-1298.409) (-1299.849) * [-1295.141] (-1304.378) (-1298.826) (-1299.167) -- 0:01:10
594000 -- [-1290.791] (-1304.132) (-1299.563) (-1295.301) * (-1296.828) (-1301.723) [-1299.742] (-1294.194) -- 0:01:10
594500 -- (-1294.462) (-1305.986) (-1299.962) [-1293.180] * [-1298.746] (-1295.539) (-1302.989) (-1300.257) -- 0:01:10
595000 -- (-1298.378) (-1298.459) [-1300.655] (-1296.644) * (-1300.058) (-1298.292) (-1301.304) [-1297.709] -- 0:01:10
Average standard deviation of split frequencies: 0.000791
595500 -- [-1297.369] (-1307.045) (-1309.689) (-1302.932) * (-1304.006) (-1299.013) (-1303.444) [-1296.792] -- 0:01:09
596000 -- (-1303.174) [-1295.370] (-1300.229) (-1296.137) * (-1299.468) [-1299.307] (-1298.959) (-1293.411) -- 0:01:09
596500 -- (-1301.118) (-1298.135) [-1298.281] (-1303.666) * (-1307.228) (-1294.919) [-1295.525] (-1301.117) -- 0:01:09
597000 -- [-1295.822] (-1295.825) (-1296.847) (-1293.020) * (-1301.246) [-1291.962] (-1293.974) (-1299.386) -- 0:01:09
597500 -- (-1303.555) [-1297.042] (-1304.187) (-1297.563) * (-1306.412) (-1296.739) (-1299.254) [-1295.492] -- 0:01:09
598000 -- (-1299.193) [-1301.072] (-1298.734) (-1296.415) * (-1299.422) [-1297.615] (-1298.874) (-1300.597) -- 0:01:09
598500 -- [-1297.896] (-1303.420) (-1310.640) (-1297.710) * (-1301.967) [-1304.053] (-1294.416) (-1298.078) -- 0:01:09
599000 -- (-1305.473) (-1296.912) (-1303.302) [-1296.493] * (-1298.315) (-1309.371) (-1297.961) [-1298.104] -- 0:01:09
599500 -- (-1301.294) (-1302.924) (-1309.114) [-1295.997] * (-1297.300) (-1300.107) [-1298.757] (-1303.763) -- 0:01:09
600000 -- (-1300.063) (-1296.412) (-1299.899) [-1296.539] * (-1304.170) [-1297.995] (-1294.342) (-1301.232) -- 0:01:09
Average standard deviation of split frequencies: 0.000785
600500 -- (-1304.123) [-1300.629] (-1303.703) (-1294.948) * (-1300.700) (-1297.061) (-1298.933) [-1299.702] -- 0:01:09
601000 -- (-1303.534) (-1306.866) (-1307.276) [-1299.927] * (-1302.969) (-1298.623) [-1300.498] (-1298.887) -- 0:01:09
601500 -- (-1299.875) (-1298.459) (-1304.303) [-1296.232] * (-1299.036) (-1305.476) (-1304.743) [-1294.367] -- 0:01:08
602000 -- (-1301.590) (-1299.501) [-1295.734] (-1299.948) * (-1297.499) [-1295.781] (-1302.319) (-1299.699) -- 0:01:08
602500 -- [-1305.493] (-1300.373) (-1307.479) (-1305.248) * (-1300.165) [-1301.447] (-1298.796) (-1301.441) -- 0:01:08
603000 -- [-1293.402] (-1295.875) (-1300.346) (-1297.500) * (-1301.671) [-1292.237] (-1292.119) (-1298.426) -- 0:01:08
603500 -- (-1301.179) (-1298.088) [-1298.372] (-1304.063) * (-1304.027) [-1299.252] (-1301.715) (-1295.123) -- 0:01:08
604000 -- [-1300.922] (-1300.120) (-1298.690) (-1300.777) * (-1306.432) (-1299.751) (-1297.456) [-1294.298] -- 0:01:08
604500 -- [-1299.873] (-1301.447) (-1298.729) (-1299.879) * (-1306.080) (-1298.302) [-1295.742] (-1297.947) -- 0:01:08
605000 -- [-1297.317] (-1301.844) (-1301.465) (-1302.280) * [-1300.183] (-1302.434) (-1301.719) (-1304.142) -- 0:01:08
Average standard deviation of split frequencies: 0.000778
605500 -- (-1300.847) [-1306.685] (-1295.780) (-1304.751) * (-1295.578) [-1294.306] (-1294.847) (-1298.711) -- 0:01:08
606000 -- (-1295.364) [-1301.276] (-1304.131) (-1302.290) * (-1290.835) [-1298.777] (-1299.145) (-1293.500) -- 0:01:08
606500 -- (-1299.960) (-1302.496) [-1300.332] (-1298.633) * [-1293.096] (-1302.550) (-1294.723) (-1301.036) -- 0:01:08
607000 -- [-1295.144] (-1299.454) (-1299.224) (-1302.060) * [-1296.761] (-1298.015) (-1299.959) (-1301.495) -- 0:01:07
607500 -- (-1295.847) (-1302.392) [-1303.781] (-1299.275) * [-1295.646] (-1298.992) (-1296.965) (-1302.471) -- 0:01:07
608000 -- [-1297.205] (-1297.851) (-1300.402) (-1294.536) * [-1293.325] (-1297.614) (-1301.577) (-1303.139) -- 0:01:07
608500 -- (-1304.135) (-1300.138) [-1293.532] (-1302.603) * [-1293.807] (-1295.272) (-1301.273) (-1304.280) -- 0:01:07
609000 -- (-1301.684) (-1299.892) (-1299.978) [-1296.197] * (-1299.600) [-1294.679] (-1304.594) (-1302.885) -- 0:01:07
609500 -- (-1297.548) [-1303.154] (-1296.477) (-1300.608) * (-1297.113) (-1297.700) (-1302.307) [-1295.483] -- 0:01:07
610000 -- (-1300.097) (-1297.930) (-1302.764) [-1299.034] * (-1306.822) [-1296.950] (-1307.066) (-1295.917) -- 0:01:07
Average standard deviation of split frequencies: 0.000772
610500 -- [-1298.996] (-1304.262) (-1299.658) (-1296.338) * (-1300.827) (-1299.469) [-1300.358] (-1299.402) -- 0:01:07
611000 -- (-1293.030) (-1301.493) (-1300.368) [-1295.907] * (-1298.431) (-1295.112) (-1300.584) [-1298.535] -- 0:01:07
611500 -- (-1295.809) (-1302.529) (-1308.359) [-1298.724] * (-1295.887) (-1301.894) (-1304.653) [-1296.615] -- 0:01:07
612000 -- (-1297.216) (-1303.607) (-1293.787) [-1294.603] * (-1295.651) (-1296.290) (-1301.833) [-1297.706] -- 0:01:07
612500 -- (-1297.828) (-1300.278) (-1301.260) [-1301.965] * (-1295.625) (-1302.415) [-1294.861] (-1298.270) -- 0:01:07
613000 -- (-1297.611) (-1304.917) [-1294.674] (-1295.694) * [-1294.976] (-1295.963) (-1302.483) (-1300.582) -- 0:01:06
613500 -- [-1299.910] (-1298.654) (-1299.405) (-1302.007) * [-1293.193] (-1297.484) (-1306.931) (-1294.488) -- 0:01:06
614000 -- (-1296.994) (-1299.825) [-1298.725] (-1295.653) * (-1297.886) (-1295.894) [-1298.384] (-1303.918) -- 0:01:06
614500 -- (-1301.386) (-1308.385) (-1296.087) [-1292.004] * (-1293.695) [-1292.731] (-1298.853) (-1299.958) -- 0:01:06
615000 -- [-1305.371] (-1300.552) (-1310.780) (-1298.578) * [-1296.984] (-1299.218) (-1303.493) (-1293.662) -- 0:01:06
Average standard deviation of split frequencies: 0.000765
615500 -- (-1301.487) (-1301.014) [-1298.575] (-1301.419) * (-1298.828) (-1300.548) [-1294.020] (-1298.376) -- 0:01:06
616000 -- (-1298.584) [-1297.989] (-1301.081) (-1293.704) * (-1302.332) (-1305.943) [-1293.026] (-1298.871) -- 0:01:06
616500 -- (-1305.651) (-1300.377) (-1297.582) [-1292.463] * (-1297.452) (-1294.540) [-1293.244] (-1303.095) -- 0:01:06
617000 -- [-1301.014] (-1301.107) (-1299.324) (-1297.774) * (-1301.914) (-1295.533) [-1292.194] (-1302.856) -- 0:01:06
617500 -- (-1297.737) [-1299.825] (-1301.066) (-1299.964) * (-1300.093) (-1296.064) (-1297.176) [-1297.320] -- 0:01:06
618000 -- (-1302.376) (-1295.962) [-1299.676] (-1295.668) * (-1295.208) [-1295.704] (-1300.722) (-1296.782) -- 0:01:06
618500 -- (-1300.330) (-1299.191) (-1299.161) [-1304.811] * (-1294.069) (-1294.767) [-1295.739] (-1303.623) -- 0:01:05
619000 -- [-1308.286] (-1298.222) (-1303.757) (-1294.971) * (-1298.797) (-1296.290) [-1300.171] (-1307.866) -- 0:01:05
619500 -- (-1298.830) (-1295.616) (-1306.473) [-1301.698] * (-1294.578) (-1298.221) [-1298.580] (-1300.140) -- 0:01:05
620000 -- (-1299.848) [-1298.757] (-1296.627) (-1296.241) * (-1298.306) [-1296.140] (-1299.828) (-1299.705) -- 0:01:05
Average standard deviation of split frequencies: 0.000760
620500 -- [-1305.651] (-1298.293) (-1300.980) (-1296.349) * [-1306.975] (-1298.866) (-1299.083) (-1298.728) -- 0:01:05
621000 -- [-1299.627] (-1301.561) (-1300.694) (-1294.233) * (-1299.638) (-1293.454) [-1293.636] (-1299.020) -- 0:01:05
621500 -- [-1294.913] (-1296.947) (-1301.507) (-1296.345) * (-1297.884) [-1297.307] (-1297.535) (-1302.727) -- 0:01:05
622000 -- (-1301.021) (-1299.553) (-1300.552) [-1299.590] * (-1299.357) (-1303.012) (-1300.481) [-1299.614] -- 0:01:05
622500 -- (-1299.965) (-1302.361) (-1298.622) [-1297.470] * (-1297.118) (-1306.624) (-1293.636) [-1296.142] -- 0:01:05
623000 -- (-1299.877) (-1298.923) (-1298.489) [-1298.999] * (-1297.473) (-1295.333) (-1298.264) [-1300.494] -- 0:01:05
623500 -- (-1301.449) (-1296.346) [-1296.167] (-1303.928) * [-1296.437] (-1304.270) (-1295.933) (-1299.231) -- 0:01:05
624000 -- (-1302.286) [-1298.585] (-1298.529) (-1307.368) * (-1297.241) (-1299.345) [-1296.121] (-1299.110) -- 0:01:05
624500 -- (-1308.822) [-1297.761] (-1298.063) (-1308.983) * (-1302.203) [-1296.961] (-1303.822) (-1308.070) -- 0:01:04
625000 -- (-1294.679) [-1295.641] (-1292.941) (-1299.629) * (-1302.069) (-1302.519) [-1296.810] (-1295.406) -- 0:01:04
Average standard deviation of split frequencies: 0.000753
625500 -- (-1298.509) (-1297.741) [-1295.013] (-1302.258) * [-1301.208] (-1298.875) (-1298.163) (-1298.911) -- 0:01:04
626000 -- (-1297.480) (-1299.659) (-1293.840) [-1301.266] * (-1296.580) [-1296.684] (-1294.513) (-1296.609) -- 0:01:04
626500 -- (-1297.735) [-1296.173] (-1299.304) (-1302.006) * [-1296.597] (-1300.881) (-1299.514) (-1306.791) -- 0:01:04
627000 -- (-1295.791) (-1296.052) [-1298.335] (-1304.557) * (-1299.088) (-1300.105) (-1299.294) [-1296.370] -- 0:01:04
627500 -- (-1301.036) (-1300.095) [-1298.356] (-1300.491) * (-1296.982) (-1301.706) (-1302.069) [-1294.688] -- 0:01:04
628000 -- (-1300.222) (-1295.750) [-1292.990] (-1307.715) * (-1301.527) (-1297.230) (-1304.206) [-1298.487] -- 0:01:04
628500 -- [-1301.824] (-1301.215) (-1298.974) (-1297.186) * (-1300.012) [-1297.100] (-1302.232) (-1298.828) -- 0:01:04
629000 -- (-1298.720) (-1301.150) (-1296.498) [-1296.929] * (-1303.415) (-1302.876) (-1306.583) [-1292.712] -- 0:01:04
629500 -- [-1299.462] (-1300.660) (-1301.622) (-1298.218) * (-1305.742) (-1302.056) (-1299.853) [-1296.967] -- 0:01:04
630000 -- (-1296.570) [-1297.912] (-1295.040) (-1298.791) * (-1302.873) [-1296.634] (-1308.170) (-1296.076) -- 0:01:04
Average standard deviation of split frequencies: 0.000747
630500 -- [-1296.136] (-1301.666) (-1294.743) (-1298.048) * (-1298.661) (-1300.575) (-1302.205) [-1298.946] -- 0:01:03
631000 -- [-1298.855] (-1294.764) (-1299.025) (-1298.741) * (-1309.125) (-1295.028) (-1306.968) [-1296.224] -- 0:01:03
631500 -- (-1299.700) (-1300.285) (-1306.042) [-1295.504] * (-1299.537) (-1300.975) [-1298.375] (-1302.642) -- 0:01:03
632000 -- (-1303.248) [-1296.822] (-1311.301) (-1297.014) * (-1304.382) [-1302.363] (-1299.926) (-1300.041) -- 0:01:03
632500 -- (-1300.232) [-1294.145] (-1306.939) (-1297.996) * (-1293.591) (-1302.881) (-1299.680) [-1300.622] -- 0:01:03
633000 -- (-1296.281) [-1296.908] (-1304.064) (-1295.377) * (-1297.167) (-1308.772) [-1301.416] (-1297.350) -- 0:01:03
633500 -- (-1300.058) [-1302.420] (-1299.929) (-1295.587) * (-1297.299) (-1305.357) (-1299.092) [-1300.792] -- 0:01:03
634000 -- (-1300.829) (-1304.002) [-1298.343] (-1302.888) * (-1297.626) (-1297.146) [-1302.755] (-1302.649) -- 0:01:03
634500 -- (-1300.681) (-1297.388) [-1299.448] (-1297.066) * (-1303.643) (-1299.588) (-1296.433) [-1302.325] -- 0:01:03
635000 -- (-1296.449) (-1298.012) (-1296.938) [-1297.328] * (-1298.234) [-1296.064] (-1297.059) (-1305.845) -- 0:01:03
Average standard deviation of split frequencies: 0.000741
635500 -- (-1296.743) [-1295.636] (-1298.845) (-1306.009) * (-1296.766) [-1297.540] (-1296.071) (-1301.173) -- 0:01:03
636000 -- (-1302.709) (-1296.736) [-1297.232] (-1297.591) * (-1295.055) [-1295.453] (-1295.652) (-1297.708) -- 0:01:02
636500 -- [-1303.977] (-1303.365) (-1293.754) (-1298.933) * [-1297.836] (-1298.348) (-1300.307) (-1295.321) -- 0:01:02
637000 -- (-1295.414) (-1301.023) (-1298.497) [-1295.291] * (-1301.430) (-1308.777) [-1294.588] (-1296.058) -- 0:01:02
637500 -- [-1299.013] (-1303.096) (-1302.935) (-1301.022) * (-1296.704) (-1306.232) (-1295.165) [-1296.747] -- 0:01:02
638000 -- (-1295.287) [-1299.426] (-1301.496) (-1299.480) * (-1298.346) (-1295.767) [-1295.694] (-1302.393) -- 0:01:02
638500 -- (-1297.259) [-1295.883] (-1302.746) (-1301.922) * (-1293.714) (-1302.998) (-1300.344) [-1294.716] -- 0:01:02
639000 -- [-1311.134] (-1294.804) (-1298.152) (-1301.256) * [-1296.121] (-1298.709) (-1297.967) (-1297.948) -- 0:01:02
639500 -- (-1302.094) [-1301.249] (-1294.214) (-1304.234) * (-1298.893) (-1298.613) (-1301.660) [-1302.139] -- 0:01:02
640000 -- (-1316.753) (-1297.582) [-1295.498] (-1294.704) * [-1304.721] (-1300.481) (-1300.531) (-1301.808) -- 0:01:02
Average standard deviation of split frequencies: 0.000736
640500 -- (-1303.398) (-1293.304) [-1296.701] (-1303.198) * (-1296.888) (-1298.956) (-1300.256) [-1299.205] -- 0:01:02
641000 -- (-1292.481) [-1300.103] (-1299.782) (-1299.055) * [-1296.276] (-1297.582) (-1304.319) (-1305.238) -- 0:01:02
641500 -- [-1293.773] (-1297.883) (-1298.171) (-1301.887) * (-1299.556) (-1299.632) [-1297.181] (-1298.528) -- 0:01:02
642000 -- [-1294.660] (-1296.742) (-1305.400) (-1299.028) * (-1297.574) [-1294.080] (-1307.281) (-1297.572) -- 0:01:01
642500 -- (-1298.103) (-1299.591) (-1297.791) [-1296.977] * [-1296.483] (-1298.366) (-1301.422) (-1306.269) -- 0:01:01
643000 -- [-1298.134] (-1305.708) (-1296.690) (-1302.507) * (-1298.025) [-1296.335] (-1297.053) (-1306.475) -- 0:01:01
643500 -- [-1298.343] (-1297.230) (-1299.116) (-1301.919) * [-1296.013] (-1297.359) (-1300.367) (-1300.015) -- 0:01:01
644000 -- (-1294.728) (-1293.414) [-1294.694] (-1297.372) * (-1295.705) [-1298.630] (-1307.439) (-1300.322) -- 0:01:01
644500 -- (-1302.390) (-1299.515) (-1292.822) [-1302.121] * [-1297.666] (-1303.094) (-1311.044) (-1304.569) -- 0:01:01
645000 -- (-1300.109) (-1295.028) [-1300.177] (-1302.253) * (-1298.111) (-1298.862) [-1294.277] (-1303.676) -- 0:01:01
Average standard deviation of split frequencies: 0.000730
645500 -- (-1295.220) (-1299.019) (-1300.760) [-1296.969] * (-1305.925) (-1299.081) (-1298.727) [-1301.964] -- 0:01:01
646000 -- [-1297.856] (-1302.162) (-1299.583) (-1299.433) * (-1301.400) (-1302.189) [-1298.282] (-1300.509) -- 0:01:01
646500 -- (-1295.316) (-1306.341) (-1295.589) [-1295.261] * [-1299.221] (-1302.132) (-1294.269) (-1297.183) -- 0:01:01
647000 -- (-1306.921) (-1301.611) [-1298.788] (-1293.469) * (-1296.102) [-1302.882] (-1294.322) (-1296.380) -- 0:01:01
647500 -- (-1306.680) (-1302.150) [-1299.030] (-1298.852) * (-1299.687) (-1300.046) (-1295.549) [-1305.293] -- 0:01:00
648000 -- (-1301.205) (-1296.686) [-1297.089] (-1298.026) * [-1305.279] (-1301.620) (-1303.020) (-1294.676) -- 0:01:00
648500 -- (-1293.968) (-1299.094) (-1300.370) [-1298.830] * (-1303.040) (-1301.233) (-1297.070) [-1299.109] -- 0:01:00
649000 -- (-1292.986) (-1298.660) (-1296.912) [-1296.605] * (-1298.259) [-1296.176] (-1298.595) (-1299.542) -- 0:01:00
649500 -- (-1295.449) (-1299.923) (-1301.174) [-1298.971] * (-1303.933) (-1303.152) (-1301.351) [-1301.026] -- 0:01:00
650000 -- [-1296.269] (-1297.473) (-1304.738) (-1306.962) * (-1299.229) (-1299.191) [-1299.128] (-1298.103) -- 0:01:00
Average standard deviation of split frequencies: 0.000362
650500 -- [-1301.891] (-1300.805) (-1299.869) (-1302.539) * (-1296.601) [-1297.140] (-1296.956) (-1299.563) -- 0:01:00
651000 -- (-1299.682) [-1296.425] (-1295.897) (-1305.891) * (-1302.280) (-1295.761) [-1298.055] (-1305.406) -- 0:01:00
651500 -- (-1295.493) [-1303.091] (-1295.541) (-1301.601) * (-1295.881) (-1301.403) (-1296.097) [-1303.131] -- 0:01:00
652000 -- (-1300.630) [-1299.214] (-1299.696) (-1295.213) * (-1299.108) (-1310.906) [-1298.016] (-1303.625) -- 0:01:00
652500 -- (-1305.250) [-1299.608] (-1306.063) (-1294.743) * (-1301.477) (-1307.550) [-1301.104] (-1302.771) -- 0:01:00
653000 -- [-1299.253] (-1294.312) (-1298.545) (-1300.611) * [-1299.803] (-1308.228) (-1296.757) (-1297.671) -- 0:01:00
653500 -- (-1298.792) (-1300.582) [-1300.393] (-1299.320) * (-1307.071) (-1305.159) (-1297.452) [-1294.585] -- 0:00:59
654000 -- (-1302.405) [-1297.728] (-1304.612) (-1300.088) * (-1297.755) (-1302.879) [-1295.656] (-1295.917) -- 0:00:59
654500 -- [-1301.776] (-1297.927) (-1297.264) (-1297.700) * (-1298.855) (-1298.469) [-1293.520] (-1298.839) -- 0:00:59
655000 -- (-1299.445) [-1300.341] (-1296.884) (-1301.126) * (-1295.661) [-1296.571] (-1296.625) (-1300.327) -- 0:00:59
Average standard deviation of split frequencies: 0.000359
655500 -- (-1301.402) [-1292.502] (-1298.441) (-1299.435) * (-1296.345) [-1300.660] (-1299.108) (-1303.449) -- 0:00:59
656000 -- [-1301.451] (-1301.825) (-1301.485) (-1297.572) * (-1297.435) [-1295.670] (-1300.840) (-1297.654) -- 0:00:59
656500 -- (-1296.746) [-1295.619] (-1297.301) (-1295.336) * (-1296.640) [-1292.813] (-1297.982) (-1300.238) -- 0:00:59
657000 -- (-1299.910) [-1296.164] (-1300.308) (-1296.002) * (-1296.220) (-1293.621) [-1297.061] (-1297.938) -- 0:00:58
657500 -- (-1295.852) (-1297.404) (-1297.579) [-1296.798] * [-1297.377] (-1297.894) (-1296.678) (-1299.591) -- 0:00:59
658000 -- (-1297.829) [-1295.815] (-1297.250) (-1299.094) * (-1296.998) (-1299.992) [-1297.268] (-1302.261) -- 0:00:59
658500 -- (-1296.280) (-1302.054) (-1299.954) [-1301.519] * [-1296.696] (-1298.342) (-1292.729) (-1299.421) -- 0:00:59
659000 -- (-1302.010) [-1296.694] (-1298.276) (-1294.851) * (-1297.001) [-1295.263] (-1296.583) (-1294.542) -- 0:00:58
659500 -- (-1298.958) (-1296.926) (-1296.235) [-1296.098] * (-1297.505) (-1306.114) (-1293.812) [-1298.684] -- 0:00:58
660000 -- (-1298.149) (-1298.769) (-1296.331) [-1295.340] * [-1297.825] (-1306.163) (-1296.332) (-1294.401) -- 0:00:58
Average standard deviation of split frequencies: 0.000357
660500 -- (-1297.837) (-1296.721) (-1303.386) [-1296.391] * [-1301.113] (-1314.315) (-1294.953) (-1301.699) -- 0:00:58
661000 -- (-1296.251) [-1297.013] (-1296.623) (-1299.050) * (-1296.213) [-1303.572] (-1305.480) (-1300.418) -- 0:00:58
661500 -- (-1297.730) (-1294.972) [-1301.057] (-1299.793) * (-1296.064) (-1308.269) [-1296.248] (-1300.805) -- 0:00:58
662000 -- (-1303.046) (-1296.064) [-1297.304] (-1296.774) * (-1296.923) (-1296.411) [-1299.014] (-1301.796) -- 0:00:58
662500 -- (-1305.518) [-1295.798] (-1295.224) (-1299.148) * [-1295.677] (-1297.914) (-1298.154) (-1299.029) -- 0:00:58
663000 -- [-1303.376] (-1294.907) (-1300.183) (-1300.656) * (-1296.030) [-1298.999] (-1294.482) (-1302.855) -- 0:00:58
663500 -- (-1306.558) [-1298.190] (-1299.657) (-1299.432) * (-1297.382) (-1297.280) (-1297.795) [-1300.684] -- 0:00:58
664000 -- (-1309.412) (-1310.652) (-1301.379) [-1297.167] * (-1295.227) [-1302.934] (-1308.901) (-1301.968) -- 0:00:58
664500 -- (-1300.063) (-1304.148) [-1294.268] (-1295.626) * (-1301.065) (-1300.647) (-1309.720) [-1301.041] -- 0:00:58
665000 -- [-1301.861] (-1297.330) (-1308.951) (-1299.719) * (-1303.382) [-1300.589] (-1299.728) (-1302.004) -- 0:00:57
Average standard deviation of split frequencies: 0.000354
665500 -- (-1297.012) (-1296.552) [-1302.164] (-1294.139) * (-1300.902) [-1296.362] (-1302.265) (-1303.732) -- 0:00:57
666000 -- (-1319.008) [-1297.685] (-1294.092) (-1297.777) * (-1294.450) (-1304.662) [-1297.408] (-1299.083) -- 0:00:57
666500 -- (-1303.440) (-1294.463) (-1299.076) [-1301.127] * [-1295.564] (-1302.898) (-1299.437) (-1302.234) -- 0:00:57
667000 -- (-1301.045) [-1294.585] (-1293.738) (-1312.065) * (-1295.332) (-1301.599) [-1296.531] (-1299.384) -- 0:00:57
667500 -- (-1299.089) (-1293.574) [-1298.080] (-1302.879) * [-1298.888] (-1308.828) (-1296.032) (-1294.526) -- 0:00:57
668000 -- (-1302.443) (-1301.244) [-1294.621] (-1297.027) * (-1299.572) (-1300.434) [-1297.134] (-1305.787) -- 0:00:57
668500 -- (-1302.171) [-1294.543] (-1298.055) (-1304.913) * (-1298.451) [-1302.470] (-1297.605) (-1295.949) -- 0:00:57
669000 -- [-1298.268] (-1294.809) (-1297.115) (-1299.056) * (-1300.064) (-1305.806) (-1301.164) [-1297.823] -- 0:00:57
669500 -- [-1302.113] (-1305.889) (-1298.704) (-1295.894) * (-1302.995) (-1306.727) (-1305.818) [-1294.828] -- 0:00:57
670000 -- (-1294.847) [-1303.608] (-1298.557) (-1307.714) * (-1299.089) (-1298.506) (-1298.276) [-1297.454] -- 0:00:57
Average standard deviation of split frequencies: 0.000351
670500 -- (-1302.214) (-1300.881) [-1297.954] (-1295.659) * [-1301.949] (-1302.167) (-1301.754) (-1304.881) -- 0:00:57
671000 -- [-1297.210] (-1300.821) (-1298.272) (-1300.721) * (-1299.369) [-1308.054] (-1298.183) (-1299.954) -- 0:00:56
671500 -- [-1298.252] (-1300.826) (-1300.702) (-1295.062) * (-1299.193) (-1303.633) (-1303.360) [-1296.364] -- 0:00:56
672000 -- [-1299.391] (-1307.008) (-1296.828) (-1296.689) * (-1299.782) [-1304.533] (-1303.522) (-1297.362) -- 0:00:56
672500 -- [-1298.253] (-1294.056) (-1302.743) (-1301.157) * [-1292.416] (-1300.813) (-1299.188) (-1296.789) -- 0:00:56
673000 -- (-1295.982) (-1297.415) [-1302.015] (-1295.096) * (-1294.310) (-1292.193) [-1299.540] (-1298.787) -- 0:00:56
673500 -- (-1300.737) [-1296.963] (-1302.228) (-1298.953) * [-1298.154] (-1296.727) (-1295.120) (-1297.377) -- 0:00:56
674000 -- [-1305.912] (-1295.528) (-1303.314) (-1301.533) * (-1304.560) (-1307.538) [-1295.915] (-1298.719) -- 0:00:56
674500 -- [-1307.932] (-1298.062) (-1297.463) (-1305.236) * (-1303.212) [-1302.243] (-1298.171) (-1297.825) -- 0:00:55
675000 -- (-1301.033) (-1296.263) [-1297.682] (-1295.091) * (-1297.363) (-1300.743) [-1297.064] (-1296.701) -- 0:00:56
Average standard deviation of split frequencies: 0.000000
675500 -- (-1309.386) [-1299.056] (-1295.071) (-1297.613) * (-1301.925) [-1299.016] (-1298.872) (-1297.703) -- 0:00:56
676000 -- (-1296.762) (-1299.211) (-1298.411) [-1299.310] * (-1296.762) [-1304.046] (-1301.904) (-1299.454) -- 0:00:56
676500 -- (-1300.090) (-1295.056) (-1296.698) [-1306.696] * (-1297.241) (-1300.443) [-1295.158] (-1296.084) -- 0:00:55
677000 -- [-1302.000] (-1301.022) (-1300.235) (-1302.480) * (-1299.043) [-1296.250] (-1297.295) (-1299.826) -- 0:00:55
677500 -- (-1300.979) (-1299.414) [-1296.959] (-1295.378) * [-1294.989] (-1299.393) (-1302.113) (-1304.977) -- 0:00:55
678000 -- [-1300.152] (-1297.518) (-1297.788) (-1303.130) * (-1302.798) (-1297.256) (-1306.075) [-1294.207] -- 0:00:55
678500 -- [-1296.139] (-1299.760) (-1301.463) (-1294.258) * (-1297.577) (-1304.529) [-1298.489] (-1296.927) -- 0:00:55
679000 -- [-1297.223] (-1298.159) (-1306.381) (-1297.147) * (-1307.193) (-1304.431) (-1304.401) [-1295.259] -- 0:00:55
679500 -- [-1296.974] (-1295.583) (-1294.754) (-1308.337) * (-1298.096) (-1306.099) (-1295.695) [-1294.481] -- 0:00:55
680000 -- (-1299.409) (-1298.858) [-1299.478] (-1304.352) * [-1298.775] (-1300.291) (-1293.656) (-1299.277) -- 0:00:55
Average standard deviation of split frequencies: 0.000346
680500 -- [-1296.758] (-1299.080) (-1299.118) (-1306.447) * (-1299.138) (-1305.235) [-1294.145] (-1298.587) -- 0:00:55
681000 -- [-1301.876] (-1306.282) (-1296.206) (-1294.743) * (-1299.369) [-1298.101] (-1295.245) (-1300.216) -- 0:00:55
681500 -- [-1297.439] (-1300.216) (-1296.302) (-1296.525) * (-1298.260) [-1296.439] (-1300.043) (-1294.666) -- 0:00:55
682000 -- (-1295.264) [-1298.010] (-1294.864) (-1301.057) * (-1296.614) (-1297.368) [-1295.821] (-1295.979) -- 0:00:55
682500 -- (-1297.219) [-1293.667] (-1298.866) (-1296.263) * (-1302.305) (-1300.035) (-1302.152) [-1297.912] -- 0:00:54
683000 -- (-1304.325) (-1304.964) (-1303.511) [-1295.647] * (-1306.711) (-1297.449) [-1304.960] (-1296.373) -- 0:00:54
683500 -- [-1294.201] (-1296.466) (-1305.891) (-1297.126) * (-1299.514) (-1297.777) (-1294.748) [-1295.520] -- 0:00:54
684000 -- [-1293.897] (-1295.808) (-1304.988) (-1298.675) * (-1298.260) (-1298.626) [-1300.596] (-1298.037) -- 0:00:54
684500 -- (-1300.908) (-1300.551) [-1300.665] (-1302.027) * (-1303.159) (-1298.111) [-1297.425] (-1297.178) -- 0:00:54
685000 -- [-1295.515] (-1292.689) (-1297.179) (-1303.701) * (-1300.321) [-1295.244] (-1298.444) (-1297.547) -- 0:00:54
Average standard deviation of split frequencies: 0.000344
685500 -- [-1297.466] (-1297.376) (-1293.717) (-1301.338) * (-1298.698) [-1297.693] (-1297.127) (-1304.703) -- 0:00:54
686000 -- [-1296.141] (-1295.541) (-1295.904) (-1305.921) * (-1297.887) (-1303.257) (-1296.322) [-1301.121] -- 0:00:54
686500 -- (-1296.074) (-1304.347) (-1292.940) [-1302.248] * [-1299.928] (-1298.060) (-1306.919) (-1307.175) -- 0:00:54
687000 -- (-1295.905) (-1300.836) (-1293.866) [-1299.908] * (-1301.210) [-1300.669] (-1304.031) (-1305.022) -- 0:00:54
687500 -- (-1301.109) (-1295.066) [-1293.188] (-1301.668) * (-1294.334) (-1293.019) [-1295.269] (-1302.156) -- 0:00:54
688000 -- [-1292.940] (-1300.188) (-1297.087) (-1301.568) * (-1301.181) [-1296.088] (-1295.701) (-1302.338) -- 0:00:53
688500 -- [-1296.493] (-1299.554) (-1298.162) (-1300.454) * (-1304.484) (-1294.465) (-1301.734) [-1303.007] -- 0:00:53
689000 -- [-1297.760] (-1301.527) (-1295.672) (-1297.310) * [-1294.907] (-1294.948) (-1296.107) (-1294.067) -- 0:00:53
689500 -- [-1299.520] (-1300.218) (-1296.041) (-1298.272) * (-1299.569) (-1296.221) (-1297.237) [-1295.038] -- 0:00:53
690000 -- (-1294.752) [-1297.550] (-1303.590) (-1303.020) * [-1297.839] (-1302.742) (-1296.486) (-1295.413) -- 0:00:53
Average standard deviation of split frequencies: 0.000341
690500 -- [-1300.426] (-1293.163) (-1304.237) (-1296.135) * (-1304.078) (-1302.233) [-1299.891] (-1308.850) -- 0:00:53
691000 -- (-1298.980) [-1294.328] (-1298.229) (-1297.758) * (-1304.194) (-1294.752) (-1294.010) [-1297.623] -- 0:00:53
691500 -- (-1299.627) (-1302.107) (-1303.915) [-1298.822] * [-1300.443] (-1297.756) (-1300.060) (-1302.640) -- 0:00:53
692000 -- (-1297.409) (-1294.194) (-1300.175) [-1302.696] * (-1296.856) [-1300.943] (-1295.408) (-1295.110) -- 0:00:52
692500 -- (-1302.260) [-1293.065] (-1301.359) (-1299.065) * [-1295.245] (-1298.810) (-1301.361) (-1300.431) -- 0:00:53
693000 -- [-1296.926] (-1295.687) (-1301.077) (-1304.278) * (-1298.986) (-1297.969) (-1297.551) [-1299.152] -- 0:00:53
693500 -- [-1304.883] (-1300.810) (-1296.821) (-1298.296) * (-1298.936) (-1300.541) (-1293.276) [-1297.584] -- 0:00:53
694000 -- [-1296.790] (-1295.370) (-1294.537) (-1296.838) * (-1297.495) (-1299.265) (-1300.512) [-1293.614] -- 0:00:52
694500 -- (-1301.018) [-1298.726] (-1304.381) (-1297.461) * [-1300.223] (-1303.268) (-1299.450) (-1303.178) -- 0:00:52
695000 -- (-1306.376) (-1298.940) (-1300.627) [-1296.148] * [-1296.195] (-1306.582) (-1299.293) (-1297.275) -- 0:00:52
Average standard deviation of split frequencies: 0.000000
695500 -- (-1301.283) [-1293.937] (-1301.206) (-1302.347) * (-1303.824) [-1307.181] (-1302.156) (-1297.715) -- 0:00:52
696000 -- (-1298.566) (-1300.779) (-1298.638) [-1299.709] * (-1298.186) (-1304.721) (-1293.709) [-1301.507] -- 0:00:52
696500 -- [-1295.969] (-1303.488) (-1300.563) (-1299.844) * (-1301.175) (-1302.017) [-1297.317] (-1299.744) -- 0:00:52
697000 -- (-1299.302) (-1303.427) [-1297.356] (-1298.758) * (-1303.169) (-1298.369) (-1304.312) [-1298.102] -- 0:00:52
697500 -- (-1295.121) [-1297.078] (-1301.659) (-1297.799) * (-1300.577) (-1298.076) [-1298.873] (-1301.751) -- 0:00:52
698000 -- (-1296.947) (-1302.921) [-1297.196] (-1304.781) * (-1297.956) (-1296.023) (-1309.409) [-1298.426] -- 0:00:52
698500 -- [-1299.976] (-1308.977) (-1294.909) (-1304.956) * [-1293.304] (-1303.197) (-1302.830) (-1303.863) -- 0:00:52
699000 -- (-1303.208) (-1297.660) (-1299.230) [-1299.497] * (-1292.274) (-1297.129) (-1293.342) [-1294.346] -- 0:00:52
699500 -- (-1296.865) (-1299.623) (-1298.703) [-1297.970] * (-1294.128) [-1294.912] (-1297.382) (-1298.575) -- 0:00:51
700000 -- [-1297.368] (-1301.276) (-1297.275) (-1293.958) * [-1295.693] (-1295.975) (-1305.187) (-1298.485) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
700500 -- (-1303.546) (-1298.997) [-1296.475] (-1293.403) * (-1295.607) (-1297.557) [-1295.653] (-1294.788) -- 0:00:51
701000 -- [-1294.862] (-1307.483) (-1296.198) (-1299.881) * (-1292.858) (-1301.911) [-1296.527] (-1295.081) -- 0:00:51
701500 -- (-1295.180) (-1297.513) [-1298.361] (-1312.906) * [-1297.801] (-1301.252) (-1297.750) (-1298.627) -- 0:00:51
702000 -- [-1297.311] (-1295.895) (-1308.447) (-1309.480) * (-1297.863) [-1297.616] (-1295.391) (-1295.793) -- 0:00:51
702500 -- (-1297.114) (-1296.577) [-1298.097] (-1299.312) * [-1298.185] (-1306.215) (-1299.354) (-1297.820) -- 0:00:51
703000 -- (-1294.013) (-1295.107) [-1294.692] (-1300.247) * (-1304.319) (-1299.515) (-1300.563) [-1295.910] -- 0:00:51
703500 -- (-1304.024) (-1298.850) [-1296.138] (-1300.977) * (-1299.522) (-1301.614) (-1297.241) [-1297.388] -- 0:00:50
704000 -- (-1302.833) [-1293.679] (-1307.334) (-1298.352) * (-1302.831) (-1304.697) [-1301.389] (-1296.429) -- 0:00:51
704500 -- (-1296.710) [-1290.884] (-1302.780) (-1296.937) * [-1299.014] (-1298.231) (-1300.152) (-1307.134) -- 0:00:51
705000 -- (-1300.156) [-1300.163] (-1296.628) (-1310.643) * (-1301.231) (-1303.422) [-1302.957] (-1307.612) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
705500 -- [-1297.009] (-1297.995) (-1293.267) (-1303.339) * (-1308.298) (-1302.679) [-1299.836] (-1301.411) -- 0:00:50
706000 -- [-1296.568] (-1297.044) (-1305.383) (-1297.694) * (-1302.565) (-1296.279) [-1299.692] (-1299.592) -- 0:00:50
706500 -- [-1296.900] (-1298.936) (-1294.928) (-1298.979) * (-1300.490) [-1297.514] (-1298.248) (-1301.744) -- 0:00:50
707000 -- (-1296.943) [-1296.755] (-1301.160) (-1296.544) * [-1295.540] (-1299.788) (-1306.151) (-1296.449) -- 0:00:50
707500 -- (-1296.871) (-1295.673) (-1301.517) [-1296.590] * (-1301.364) (-1298.672) (-1295.690) [-1296.005] -- 0:00:50
708000 -- (-1297.502) (-1298.152) (-1296.161) [-1295.752] * (-1304.144) (-1304.831) (-1296.365) [-1297.208] -- 0:00:50
708500 -- [-1301.900] (-1301.082) (-1302.671) (-1296.406) * (-1304.370) (-1299.863) [-1294.388] (-1305.451) -- 0:00:50
709000 -- (-1302.193) (-1299.735) (-1296.873) [-1294.663] * (-1312.846) (-1298.751) [-1298.892] (-1299.813) -- 0:00:50
709500 -- (-1302.196) (-1299.243) [-1297.776] (-1296.387) * (-1311.086) [-1296.143] (-1299.042) (-1302.212) -- 0:00:49
710000 -- (-1297.114) [-1302.753] (-1300.221) (-1296.808) * (-1305.790) (-1295.067) [-1294.999] (-1301.708) -- 0:00:50
Average standard deviation of split frequencies: 0.000000
710500 -- [-1298.411] (-1300.326) (-1300.952) (-1294.336) * (-1299.758) [-1298.465] (-1303.537) (-1298.464) -- 0:00:50
711000 -- (-1300.567) (-1301.618) [-1299.378] (-1296.777) * (-1303.565) [-1294.956] (-1301.165) (-1301.028) -- 0:00:49
711500 -- [-1298.688] (-1303.287) (-1294.648) (-1299.939) * [-1300.417] (-1304.927) (-1303.176) (-1298.578) -- 0:00:49
712000 -- [-1293.331] (-1305.419) (-1295.400) (-1300.176) * [-1296.613] (-1297.656) (-1300.164) (-1301.427) -- 0:00:49
712500 -- (-1301.495) (-1299.647) (-1296.440) [-1297.004] * (-1295.896) [-1298.385] (-1304.429) (-1307.225) -- 0:00:49
713000 -- [-1297.106] (-1298.033) (-1300.795) (-1301.784) * (-1299.761) [-1295.406] (-1302.906) (-1297.830) -- 0:00:49
713500 -- [-1296.480] (-1304.102) (-1297.447) (-1292.195) * [-1299.096] (-1296.452) (-1301.501) (-1296.765) -- 0:00:49
714000 -- (-1302.418) [-1295.625] (-1301.721) (-1294.573) * (-1301.733) (-1300.800) [-1292.830] (-1298.367) -- 0:00:49
714500 -- [-1297.361] (-1301.992) (-1303.384) (-1297.117) * (-1300.389) [-1295.579] (-1300.150) (-1297.647) -- 0:00:49
715000 -- (-1298.571) [-1301.707] (-1303.521) (-1293.352) * (-1298.215) (-1300.144) [-1299.213] (-1296.965) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
715500 -- (-1295.301) [-1293.117] (-1302.186) (-1294.495) * (-1298.982) [-1300.550] (-1299.856) (-1305.368) -- 0:00:48
716000 -- [-1296.504] (-1297.390) (-1297.964) (-1296.821) * (-1296.285) (-1300.804) [-1296.918] (-1304.682) -- 0:00:49
716500 -- [-1301.511] (-1298.833) (-1308.201) (-1295.890) * (-1301.672) [-1297.528] (-1301.618) (-1304.777) -- 0:00:49
717000 -- (-1296.245) (-1299.015) [-1295.604] (-1293.457) * [-1294.694] (-1296.590) (-1298.541) (-1297.838) -- 0:00:48
717500 -- [-1295.324] (-1301.411) (-1297.494) (-1298.499) * [-1296.467] (-1302.547) (-1292.708) (-1307.613) -- 0:00:48
718000 -- (-1298.253) [-1300.377] (-1298.539) (-1298.299) * (-1296.560) (-1303.328) [-1295.642] (-1305.991) -- 0:00:48
718500 -- (-1298.806) (-1302.991) [-1293.157] (-1305.348) * (-1297.268) (-1301.684) (-1299.601) [-1292.797] -- 0:00:48
719000 -- (-1301.617) (-1299.383) [-1298.579] (-1300.622) * (-1303.762) (-1299.118) [-1296.540] (-1293.807) -- 0:00:48
719500 -- (-1300.612) (-1310.122) (-1295.131) [-1300.779] * [-1295.933] (-1299.811) (-1291.336) (-1302.936) -- 0:00:48
720000 -- (-1298.177) (-1298.182) [-1295.475] (-1296.838) * (-1297.902) (-1297.404) (-1296.766) [-1297.972] -- 0:00:48
Average standard deviation of split frequencies: 0.000000
720500 -- (-1294.560) [-1297.977] (-1297.322) (-1301.742) * [-1298.384] (-1299.836) (-1299.340) (-1294.885) -- 0:00:48
721000 -- (-1299.631) (-1297.286) [-1296.529] (-1295.682) * (-1304.755) [-1300.880] (-1304.179) (-1295.891) -- 0:00:47
721500 -- [-1295.557] (-1294.081) (-1300.622) (-1293.284) * (-1299.662) (-1297.220) [-1294.530] (-1295.245) -- 0:00:48
722000 -- (-1297.175) [-1295.435] (-1295.963) (-1294.385) * (-1297.647) (-1304.420) [-1294.358] (-1293.028) -- 0:00:48
722500 -- (-1302.722) (-1293.607) (-1294.458) [-1297.973] * [-1300.433] (-1302.892) (-1301.329) (-1296.893) -- 0:00:48
723000 -- [-1294.823] (-1301.266) (-1297.610) (-1301.867) * (-1295.656) (-1296.086) (-1294.524) [-1302.492] -- 0:00:47
723500 -- [-1293.901] (-1297.648) (-1297.401) (-1292.819) * (-1303.619) (-1294.886) [-1298.916] (-1296.575) -- 0:00:47
724000 -- (-1299.944) (-1299.883) [-1302.626] (-1298.074) * (-1301.286) (-1296.422) [-1301.544] (-1302.457) -- 0:00:47
724500 -- (-1296.679) [-1298.748] (-1297.478) (-1302.078) * (-1302.451) (-1295.256) (-1299.264) [-1297.146] -- 0:00:47
725000 -- (-1296.095) [-1296.972] (-1295.703) (-1294.353) * (-1304.123) [-1295.425] (-1306.874) (-1296.768) -- 0:00:47
Average standard deviation of split frequencies: 0.000000
725500 -- (-1296.474) [-1295.683] (-1301.016) (-1300.595) * (-1299.104) (-1298.509) [-1295.644] (-1302.690) -- 0:00:47
726000 -- [-1294.689] (-1302.114) (-1293.827) (-1299.214) * (-1303.367) (-1294.771) (-1301.729) [-1300.144] -- 0:00:47
726500 -- (-1299.291) (-1300.468) (-1294.358) [-1298.886] * (-1296.416) (-1301.764) (-1298.492) [-1299.187] -- 0:00:47
727000 -- (-1300.505) (-1302.423) (-1303.742) [-1301.374] * (-1300.438) (-1309.782) (-1301.839) [-1300.571] -- 0:00:46
727500 -- (-1305.869) (-1304.075) [-1297.602] (-1300.172) * (-1298.647) [-1294.687] (-1304.802) (-1307.209) -- 0:00:47
728000 -- (-1301.993) [-1301.488] (-1302.574) (-1303.672) * [-1294.208] (-1301.156) (-1306.257) (-1293.711) -- 0:00:47
728500 -- (-1303.619) [-1295.582] (-1296.894) (-1307.684) * (-1297.814) (-1297.995) [-1296.384] (-1301.710) -- 0:00:46
729000 -- (-1304.839) [-1295.537] (-1296.183) (-1299.099) * [-1298.426] (-1298.585) (-1296.591) (-1303.946) -- 0:00:46
729500 -- (-1298.744) (-1299.349) (-1301.004) [-1302.231] * [-1292.363] (-1294.571) (-1298.741) (-1299.223) -- 0:00:46
730000 -- (-1297.947) [-1294.572] (-1297.934) (-1295.920) * [-1295.557] (-1298.139) (-1294.148) (-1299.863) -- 0:00:46
Average standard deviation of split frequencies: 0.000323
730500 -- (-1304.538) [-1300.065] (-1295.143) (-1301.666) * [-1294.332] (-1304.735) (-1294.246) (-1292.703) -- 0:00:46
731000 -- [-1300.617] (-1299.014) (-1294.963) (-1298.640) * (-1297.680) (-1297.419) (-1300.371) [-1295.193] -- 0:00:46
731500 -- (-1300.007) (-1300.339) [-1297.079] (-1298.300) * [-1302.309] (-1300.370) (-1302.838) (-1297.885) -- 0:00:46
732000 -- (-1296.208) [-1294.918] (-1296.709) (-1304.492) * [-1294.840] (-1293.164) (-1298.067) (-1298.764) -- 0:00:46
732500 -- (-1296.674) [-1295.269] (-1296.904) (-1303.205) * (-1299.094) (-1297.528) (-1297.021) [-1300.290] -- 0:00:46
733000 -- [-1296.860] (-1303.836) (-1296.165) (-1306.640) * [-1294.300] (-1302.424) (-1297.901) (-1299.297) -- 0:00:45
733500 -- (-1294.857) (-1302.958) (-1300.037) [-1296.931] * (-1297.459) (-1297.792) [-1294.567] (-1306.278) -- 0:00:46
734000 -- (-1298.360) (-1306.085) (-1305.679) [-1302.704] * [-1298.999] (-1298.197) (-1298.929) (-1294.670) -- 0:00:46
734500 -- (-1299.668) [-1296.334] (-1299.560) (-1294.534) * (-1298.950) (-1293.958) [-1297.255] (-1294.882) -- 0:00:45
735000 -- (-1300.169) [-1296.744] (-1304.378) (-1305.681) * [-1298.209] (-1301.267) (-1294.982) (-1294.580) -- 0:00:45
Average standard deviation of split frequencies: 0.000320
735500 -- [-1296.148] (-1301.459) (-1303.744) (-1297.897) * (-1292.249) (-1297.486) (-1302.451) [-1293.387] -- 0:00:45
736000 -- (-1299.612) (-1301.755) [-1298.731] (-1299.900) * (-1300.957) (-1297.716) [-1297.049] (-1297.035) -- 0:00:45
736500 -- (-1299.283) (-1300.006) [-1297.627] (-1302.608) * (-1300.316) (-1293.913) (-1307.636) [-1295.471] -- 0:00:45
737000 -- (-1299.532) (-1301.397) [-1297.083] (-1299.232) * (-1300.754) (-1299.130) (-1294.784) [-1298.740] -- 0:00:45
737500 -- [-1298.634] (-1301.349) (-1301.588) (-1296.526) * (-1302.247) (-1300.094) (-1299.174) [-1294.606] -- 0:00:45
738000 -- (-1301.254) (-1297.260) (-1300.500) [-1296.431] * (-1299.372) (-1296.280) (-1297.710) [-1297.448] -- 0:00:45
738500 -- (-1295.401) (-1301.846) (-1299.202) [-1294.232] * [-1294.627] (-1292.741) (-1296.533) (-1298.994) -- 0:00:44
739000 -- (-1298.786) (-1300.556) (-1296.491) [-1300.525] * (-1296.853) [-1293.801] (-1297.430) (-1300.759) -- 0:00:44
739500 -- (-1301.293) (-1302.830) [-1299.030] (-1302.385) * (-1297.917) (-1298.533) [-1299.222] (-1297.476) -- 0:00:45
740000 -- (-1297.391) (-1304.343) [-1296.034] (-1295.639) * (-1295.540) [-1307.453] (-1300.151) (-1298.324) -- 0:00:44
Average standard deviation of split frequencies: 0.000318
740500 -- (-1308.906) (-1300.135) (-1293.954) [-1296.396] * [-1299.216] (-1305.801) (-1299.998) (-1304.156) -- 0:00:44
741000 -- (-1299.217) (-1293.995) [-1296.682] (-1299.130) * (-1305.063) (-1302.085) (-1298.363) [-1299.354] -- 0:00:44
741500 -- (-1300.743) (-1299.670) (-1302.259) [-1300.007] * (-1298.753) (-1302.377) [-1298.656] (-1305.887) -- 0:00:44
742000 -- (-1301.675) [-1294.653] (-1293.487) (-1298.317) * (-1297.899) (-1307.031) (-1295.996) [-1298.819] -- 0:00:44
742500 -- (-1298.655) (-1296.978) [-1296.498] (-1295.229) * (-1301.729) (-1299.526) (-1297.111) [-1300.790] -- 0:00:44
743000 -- (-1295.681) (-1302.106) [-1301.307] (-1293.895) * (-1298.694) (-1300.254) [-1302.540] (-1301.634) -- 0:00:44
743500 -- (-1302.914) (-1302.380) (-1301.344) [-1297.112] * (-1303.272) [-1293.800] (-1299.863) (-1294.369) -- 0:00:44
744000 -- (-1298.749) (-1297.632) [-1296.610] (-1300.448) * (-1295.333) (-1299.698) (-1296.335) [-1298.266] -- 0:00:44
744500 -- (-1301.734) (-1299.112) (-1299.902) [-1300.868] * [-1299.665] (-1295.917) (-1297.896) (-1298.043) -- 0:00:43
745000 -- [-1295.655] (-1296.018) (-1300.941) (-1298.819) * (-1300.189) [-1299.721] (-1304.621) (-1298.214) -- 0:00:44
Average standard deviation of split frequencies: 0.000316
745500 -- (-1305.275) [-1300.606] (-1304.696) (-1299.697) * (-1295.765) (-1296.632) (-1303.813) [-1301.069] -- 0:00:44
746000 -- (-1300.347) (-1301.263) [-1293.695] (-1302.838) * (-1296.645) (-1297.806) [-1295.821] (-1295.525) -- 0:00:43
746500 -- (-1293.594) [-1298.418] (-1297.268) (-1293.974) * (-1301.113) (-1299.615) (-1296.975) [-1304.973] -- 0:00:43
747000 -- (-1300.294) (-1298.105) [-1298.462] (-1302.447) * (-1300.255) (-1301.818) (-1301.163) [-1299.435] -- 0:00:43
747500 -- [-1300.073] (-1299.751) (-1301.885) (-1303.001) * (-1301.446) (-1301.931) [-1301.036] (-1298.662) -- 0:00:43
748000 -- (-1296.339) [-1304.560] (-1296.211) (-1305.323) * [-1300.074] (-1306.003) (-1298.844) (-1299.240) -- 0:00:43
748500 -- (-1298.191) [-1298.606] (-1302.937) (-1303.416) * (-1295.196) (-1299.966) [-1298.646] (-1307.184) -- 0:00:43
749000 -- (-1298.671) [-1295.628] (-1299.263) (-1306.365) * (-1304.948) (-1294.312) (-1299.963) [-1303.876] -- 0:00:43
749500 -- [-1301.247] (-1301.180) (-1299.332) (-1305.418) * (-1302.043) (-1297.779) (-1295.060) [-1304.147] -- 0:00:43
750000 -- (-1297.309) (-1296.164) [-1302.977] (-1301.207) * (-1296.261) (-1301.550) [-1296.209] (-1307.342) -- 0:00:43
Average standard deviation of split frequencies: 0.000628
750500 -- (-1298.700) (-1302.665) (-1306.071) [-1301.484] * (-1296.452) (-1301.603) [-1305.007] (-1301.467) -- 0:00:42
751000 -- (-1297.849) (-1310.379) (-1296.761) [-1305.119] * (-1297.122) (-1298.005) [-1300.609] (-1300.298) -- 0:00:43
751500 -- [-1296.498] (-1299.197) (-1297.238) (-1293.685) * [-1297.693] (-1300.900) (-1302.085) (-1296.793) -- 0:00:42
752000 -- (-1293.365) (-1299.600) [-1296.331] (-1300.603) * (-1293.911) [-1297.928] (-1301.984) (-1296.663) -- 0:00:42
752500 -- (-1298.484) [-1297.307] (-1299.690) (-1296.714) * (-1302.632) (-1298.327) (-1293.681) [-1293.457] -- 0:00:42
753000 -- (-1296.278) (-1294.884) [-1295.872] (-1303.959) * [-1299.808] (-1294.900) (-1309.933) (-1299.404) -- 0:00:42
753500 -- (-1298.709) [-1297.627] (-1297.394) (-1299.779) * (-1292.679) (-1298.324) [-1298.488] (-1300.764) -- 0:00:42
754000 -- [-1298.346] (-1301.546) (-1299.589) (-1300.298) * [-1294.638] (-1302.389) (-1296.361) (-1297.086) -- 0:00:42
754500 -- (-1310.783) (-1301.784) [-1298.810] (-1298.963) * [-1292.562] (-1306.095) (-1296.755) (-1295.890) -- 0:00:42
755000 -- (-1300.025) [-1296.680] (-1296.234) (-1299.334) * [-1296.805] (-1297.432) (-1293.266) (-1298.354) -- 0:00:42
Average standard deviation of split frequencies: 0.000624
755500 -- (-1302.893) (-1299.730) (-1295.065) [-1301.692] * (-1301.384) [-1298.817] (-1299.974) (-1311.685) -- 0:00:42
756000 -- (-1304.258) [-1295.208] (-1295.387) (-1302.132) * (-1300.547) (-1294.676) (-1296.748) [-1297.533] -- 0:00:41
756500 -- [-1298.465] (-1298.927) (-1297.646) (-1294.511) * (-1301.161) [-1300.233] (-1298.943) (-1298.030) -- 0:00:41
757000 -- [-1297.815] (-1297.008) (-1295.069) (-1304.644) * (-1296.884) (-1298.363) (-1303.629) [-1296.684] -- 0:00:42
757500 -- (-1296.243) [-1299.377] (-1302.488) (-1297.065) * (-1297.146) (-1303.290) [-1298.261] (-1297.399) -- 0:00:41
758000 -- (-1294.946) (-1297.957) (-1307.914) [-1296.008] * (-1306.551) [-1299.778] (-1296.758) (-1294.871) -- 0:00:41
758500 -- (-1299.635) [-1300.009] (-1297.887) (-1302.860) * (-1297.297) (-1298.740) (-1295.244) [-1292.398] -- 0:00:41
759000 -- (-1297.847) (-1304.120) [-1305.175] (-1297.822) * (-1301.596) (-1299.009) (-1296.423) [-1296.369] -- 0:00:41
759500 -- (-1297.768) [-1295.359] (-1295.958) (-1296.355) * (-1298.480) [-1293.330] (-1303.832) (-1304.343) -- 0:00:41
760000 -- (-1295.709) (-1299.817) [-1297.897] (-1299.194) * (-1302.108) (-1294.284) (-1299.054) [-1297.587] -- 0:00:41
Average standard deviation of split frequencies: 0.000620
760500 -- (-1299.149) (-1299.533) (-1296.021) [-1295.876] * (-1300.416) (-1306.632) (-1299.662) [-1297.516] -- 0:00:41
761000 -- [-1304.576] (-1296.228) (-1294.936) (-1299.983) * (-1304.910) (-1304.293) (-1293.957) [-1295.414] -- 0:00:41
761500 -- (-1301.465) (-1301.961) (-1295.301) [-1295.607] * (-1303.142) [-1293.987] (-1297.230) (-1297.320) -- 0:00:41
762000 -- (-1296.466) (-1298.923) (-1296.892) [-1299.860] * (-1294.491) [-1294.042] (-1294.929) (-1295.461) -- 0:00:40
762500 -- (-1294.153) (-1301.387) [-1299.040] (-1293.332) * (-1299.661) (-1301.439) [-1297.315] (-1295.007) -- 0:00:40
763000 -- (-1293.703) (-1306.808) [-1294.081] (-1298.860) * (-1300.248) (-1297.827) [-1292.654] (-1298.702) -- 0:00:41
763500 -- [-1293.044] (-1298.271) (-1294.777) (-1295.214) * [-1295.827] (-1304.548) (-1301.838) (-1302.824) -- 0:00:40
764000 -- (-1293.941) (-1300.210) (-1308.481) [-1295.622] * [-1299.654] (-1301.597) (-1297.020) (-1297.053) -- 0:00:40
764500 -- [-1295.365] (-1298.414) (-1300.571) (-1296.142) * [-1297.256] (-1297.361) (-1298.251) (-1303.114) -- 0:00:40
765000 -- (-1294.131) [-1299.950] (-1299.483) (-1295.187) * [-1295.930] (-1297.172) (-1304.142) (-1297.323) -- 0:00:40
Average standard deviation of split frequencies: 0.000615
765500 -- (-1306.149) (-1299.767) [-1301.309] (-1296.051) * (-1299.880) [-1300.583] (-1296.893) (-1299.304) -- 0:00:40
766000 -- (-1304.474) [-1296.880] (-1300.550) (-1296.721) * (-1302.927) (-1299.133) [-1297.391] (-1303.016) -- 0:00:40
766500 -- (-1294.133) (-1295.590) (-1300.142) [-1297.959] * (-1296.702) (-1297.058) [-1296.248] (-1299.486) -- 0:00:40
767000 -- (-1295.629) (-1298.300) [-1299.780] (-1301.045) * [-1294.907] (-1296.820) (-1302.546) (-1299.408) -- 0:00:40
767500 -- (-1296.259) [-1306.805] (-1296.452) (-1298.340) * (-1295.660) (-1297.944) (-1293.799) [-1292.672] -- 0:00:39
768000 -- (-1299.341) (-1309.723) [-1298.741] (-1295.385) * (-1301.286) [-1295.598] (-1304.952) (-1294.281) -- 0:00:39
768500 -- (-1306.090) [-1302.535] (-1294.445) (-1297.527) * (-1299.419) [-1305.265] (-1296.568) (-1296.182) -- 0:00:40
769000 -- (-1294.000) (-1301.134) [-1292.139] (-1296.024) * (-1293.827) (-1301.951) (-1298.334) [-1298.801] -- 0:00:39
769500 -- (-1302.745) (-1304.358) [-1293.333] (-1295.590) * (-1299.642) (-1295.997) (-1297.649) [-1301.421] -- 0:00:39
770000 -- (-1302.413) (-1295.448) (-1298.527) [-1297.958] * [-1293.742] (-1297.394) (-1298.644) (-1302.316) -- 0:00:39
Average standard deviation of split frequencies: 0.000612
770500 -- (-1303.058) (-1297.801) (-1297.249) [-1293.734] * [-1296.863] (-1298.490) (-1298.036) (-1295.580) -- 0:00:39
771000 -- (-1298.648) (-1301.220) [-1299.567] (-1301.469) * (-1294.768) (-1297.916) [-1299.550] (-1300.571) -- 0:00:39
771500 -- (-1295.327) (-1301.854) (-1298.352) [-1309.186] * [-1302.331] (-1294.899) (-1301.694) (-1300.418) -- 0:00:39
772000 -- (-1296.366) [-1300.532] (-1296.399) (-1304.918) * (-1302.357) (-1299.112) (-1302.517) [-1298.579] -- 0:00:39
772500 -- (-1297.546) (-1300.654) [-1297.114] (-1306.552) * (-1299.942) (-1298.554) (-1298.113) [-1294.587] -- 0:00:39
773000 -- (-1301.674) [-1303.888] (-1302.007) (-1298.801) * [-1299.420] (-1299.495) (-1302.822) (-1298.671) -- 0:00:39
773500 -- (-1298.612) [-1298.986] (-1306.518) (-1299.704) * (-1296.579) (-1301.304) [-1296.674] (-1305.159) -- 0:00:38
774000 -- (-1304.715) (-1298.504) (-1304.871) [-1293.905] * [-1292.203] (-1294.171) (-1300.246) (-1299.610) -- 0:00:38
774500 -- [-1300.226] (-1301.815) (-1297.836) (-1296.380) * (-1297.963) [-1296.620] (-1300.170) (-1294.787) -- 0:00:39
775000 -- (-1304.577) (-1300.839) [-1300.273] (-1300.808) * (-1296.937) (-1298.086) [-1297.433] (-1303.592) -- 0:00:38
Average standard deviation of split frequencies: 0.000911
775500 -- (-1298.753) [-1298.391] (-1297.085) (-1302.509) * (-1301.819) (-1304.216) (-1303.629) [-1299.284] -- 0:00:38
776000 -- (-1301.256) (-1297.431) (-1299.379) [-1297.477] * [-1294.979] (-1299.236) (-1301.336) (-1301.476) -- 0:00:38
776500 -- (-1300.289) [-1299.132] (-1301.073) (-1297.950) * [-1299.364] (-1308.027) (-1290.746) (-1300.007) -- 0:00:38
777000 -- (-1307.548) (-1305.855) [-1299.274] (-1299.552) * [-1299.102] (-1295.320) (-1299.939) (-1294.389) -- 0:00:38
777500 -- (-1306.479) (-1300.673) [-1296.783] (-1297.432) * (-1302.215) [-1297.942] (-1302.296) (-1297.509) -- 0:00:38
778000 -- (-1307.802) [-1297.539] (-1298.722) (-1296.220) * (-1303.675) (-1298.255) (-1301.715) [-1298.049] -- 0:00:38
778500 -- [-1301.752] (-1294.989) (-1295.189) (-1294.565) * (-1303.868) (-1298.104) (-1304.282) [-1298.716] -- 0:00:38
779000 -- (-1298.789) [-1300.374] (-1297.858) (-1296.876) * (-1302.255) [-1303.363] (-1303.229) (-1300.740) -- 0:00:38
779500 -- (-1300.045) (-1300.860) (-1307.390) [-1294.367] * (-1300.243) [-1298.900] (-1295.803) (-1299.617) -- 0:00:37
780000 -- (-1303.882) [-1303.657] (-1295.592) (-1296.195) * (-1294.433) (-1303.531) (-1299.894) [-1297.210] -- 0:00:38
Average standard deviation of split frequencies: 0.000906
780500 -- (-1303.345) (-1302.041) [-1297.736] (-1302.623) * [-1302.182] (-1296.855) (-1297.510) (-1305.771) -- 0:00:37
781000 -- [-1299.811] (-1297.660) (-1297.924) (-1297.945) * (-1301.779) [-1298.947] (-1298.251) (-1299.639) -- 0:00:37
781500 -- [-1293.383] (-1300.274) (-1301.233) (-1298.836) * (-1296.004) [-1299.738] (-1300.009) (-1303.109) -- 0:00:37
782000 -- [-1292.638] (-1300.474) (-1300.995) (-1297.367) * (-1303.792) (-1297.836) [-1300.100] (-1294.768) -- 0:00:37
782500 -- (-1296.631) (-1304.555) (-1306.099) [-1303.749] * (-1296.547) (-1296.534) [-1300.218] (-1299.052) -- 0:00:37
783000 -- (-1299.849) [-1300.186] (-1310.513) (-1305.368) * [-1294.771] (-1300.174) (-1292.838) (-1293.841) -- 0:00:37
783500 -- (-1299.787) (-1302.271) (-1300.494) [-1308.822] * (-1301.048) (-1299.941) [-1294.686] (-1295.691) -- 0:00:37
784000 -- [-1294.544] (-1300.827) (-1305.456) (-1302.782) * (-1303.291) [-1299.167] (-1300.503) (-1296.418) -- 0:00:37
784500 -- [-1295.852] (-1300.101) (-1300.073) (-1300.431) * (-1294.095) (-1302.601) (-1299.392) [-1294.288] -- 0:00:37
785000 -- (-1303.706) (-1305.573) [-1298.850] (-1298.282) * (-1296.845) (-1299.405) (-1294.792) [-1299.627] -- 0:00:36
Average standard deviation of split frequencies: 0.000900
785500 -- (-1297.665) (-1306.162) [-1300.169] (-1300.248) * (-1296.013) (-1294.750) (-1296.254) [-1299.477] -- 0:00:36
786000 -- [-1298.980] (-1295.397) (-1308.519) (-1302.572) * (-1302.535) (-1298.901) [-1299.032] (-1295.741) -- 0:00:37
786500 -- (-1301.237) (-1294.328) [-1296.382] (-1301.642) * (-1302.551) (-1298.240) [-1295.743] (-1298.472) -- 0:00:36
787000 -- (-1296.166) (-1303.268) [-1300.030] (-1301.967) * (-1299.928) [-1297.006] (-1291.597) (-1298.665) -- 0:00:36
787500 -- [-1298.500] (-1294.705) (-1304.094) (-1302.020) * (-1299.986) (-1297.517) (-1298.695) [-1297.191] -- 0:00:36
788000 -- (-1304.427) [-1296.104] (-1302.152) (-1300.290) * [-1301.803] (-1295.078) (-1295.168) (-1297.394) -- 0:00:36
788500 -- (-1297.462) (-1297.762) (-1303.773) [-1300.473] * (-1297.211) (-1296.361) [-1297.477] (-1298.471) -- 0:00:36
789000 -- (-1298.815) (-1299.257) [-1300.845] (-1303.225) * [-1294.375] (-1298.221) (-1302.610) (-1294.984) -- 0:00:36
789500 -- (-1298.966) (-1299.344) (-1302.796) [-1303.166] * [-1303.637] (-1292.497) (-1301.889) (-1300.937) -- 0:00:36
790000 -- (-1294.390) (-1293.907) [-1300.561] (-1303.399) * [-1302.094] (-1300.359) (-1299.783) (-1298.023) -- 0:00:36
Average standard deviation of split frequencies: 0.000894
790500 -- [-1297.276] (-1298.391) (-1300.989) (-1300.116) * (-1313.602) (-1295.327) [-1301.775] (-1300.195) -- 0:00:36
791000 -- (-1300.971) (-1295.550) [-1296.424] (-1304.570) * (-1303.642) (-1296.524) [-1296.242] (-1301.852) -- 0:00:35
791500 -- [-1301.838] (-1304.006) (-1301.176) (-1296.669) * [-1296.130] (-1295.322) (-1304.609) (-1296.431) -- 0:00:35
792000 -- (-1297.807) [-1295.692] (-1300.722) (-1303.074) * (-1299.473) (-1301.718) (-1297.516) [-1302.003] -- 0:00:35
792500 -- (-1302.712) [-1293.225] (-1301.603) (-1294.233) * (-1299.988) (-1301.700) (-1297.413) [-1292.915] -- 0:00:35
793000 -- (-1294.175) [-1295.386] (-1298.754) (-1296.520) * (-1300.756) (-1303.564) (-1303.648) [-1298.109] -- 0:00:35
793500 -- (-1293.173) (-1295.030) (-1303.409) [-1294.946] * [-1298.318] (-1300.027) (-1300.130) (-1304.076) -- 0:00:35
794000 -- (-1298.418) (-1296.999) [-1297.682] (-1296.056) * [-1295.685] (-1298.601) (-1303.619) (-1301.852) -- 0:00:35
794500 -- (-1298.964) (-1296.234) [-1295.782] (-1301.758) * (-1296.446) (-1298.584) (-1303.364) [-1298.499] -- 0:00:35
795000 -- (-1298.749) (-1303.567) [-1298.837] (-1296.585) * (-1295.050) (-1297.647) (-1304.951) [-1294.448] -- 0:00:35
Average standard deviation of split frequencies: 0.000888
795500 -- (-1298.194) [-1296.848] (-1296.641) (-1291.972) * (-1301.296) (-1299.895) (-1311.076) [-1298.885] -- 0:00:35
796000 -- (-1297.971) [-1294.639] (-1296.282) (-1300.763) * [-1291.194] (-1302.036) (-1300.029) (-1298.767) -- 0:00:35
796500 -- (-1299.870) (-1304.355) [-1299.496] (-1306.975) * (-1302.549) (-1299.464) [-1295.213] (-1296.106) -- 0:00:35
797000 -- [-1294.907] (-1297.026) (-1293.842) (-1307.067) * (-1308.892) (-1305.483) (-1300.066) [-1296.913] -- 0:00:34
797500 -- (-1295.817) [-1295.645] (-1290.812) (-1298.974) * (-1300.692) [-1297.898] (-1299.057) (-1298.051) -- 0:00:35
798000 -- (-1300.301) [-1302.913] (-1294.202) (-1299.828) * (-1298.080) [-1301.554] (-1293.125) (-1298.533) -- 0:00:34
798500 -- (-1300.823) (-1302.578) (-1300.770) [-1295.695] * (-1303.167) [-1295.040] (-1297.375) (-1293.590) -- 0:00:34
799000 -- (-1299.342) (-1295.674) [-1293.926] (-1294.155) * (-1299.544) (-1297.893) [-1297.608] (-1300.437) -- 0:00:34
799500 -- (-1300.231) (-1297.318) (-1300.688) [-1297.003] * [-1296.726] (-1293.946) (-1295.629) (-1298.392) -- 0:00:34
800000 -- (-1295.972) [-1298.780] (-1300.856) (-1302.215) * (-1300.540) (-1298.071) (-1292.175) [-1298.667] -- 0:00:34
Average standard deviation of split frequencies: 0.000883
800500 -- (-1296.732) (-1307.637) [-1302.336] (-1299.632) * (-1295.744) (-1294.904) [-1299.128] (-1295.766) -- 0:00:34
801000 -- (-1299.616) (-1298.229) [-1301.329] (-1299.270) * (-1299.100) (-1297.664) (-1299.221) [-1297.119] -- 0:00:34
801500 -- (-1295.557) (-1312.382) [-1300.180] (-1293.846) * (-1296.257) (-1307.147) (-1294.951) [-1297.316] -- 0:00:34
802000 -- (-1296.289) [-1296.813] (-1301.122) (-1295.704) * (-1303.684) (-1300.293) [-1299.091] (-1298.353) -- 0:00:34
802500 -- [-1304.812] (-1298.542) (-1301.684) (-1298.621) * (-1296.945) (-1303.472) [-1294.119] (-1300.498) -- 0:00:33
803000 -- (-1301.450) (-1299.452) [-1298.191] (-1300.144) * [-1300.373] (-1296.895) (-1306.825) (-1301.221) -- 0:00:33
803500 -- (-1297.337) (-1299.328) (-1296.400) [-1297.061] * (-1294.024) [-1295.317] (-1298.036) (-1305.089) -- 0:00:33
804000 -- (-1299.581) (-1296.343) [-1292.157] (-1292.987) * (-1303.432) (-1295.679) [-1297.400] (-1299.366) -- 0:00:33
804500 -- (-1296.395) (-1299.221) (-1301.798) [-1296.930] * (-1300.644) (-1297.415) (-1296.043) [-1295.288] -- 0:00:33
805000 -- (-1294.202) [-1295.156] (-1304.789) (-1296.175) * (-1303.330) (-1295.416) [-1294.676] (-1300.853) -- 0:00:33
Average standard deviation of split frequencies: 0.000877
805500 -- (-1300.051) (-1300.733) [-1297.396] (-1300.729) * [-1297.541] (-1302.392) (-1299.267) (-1297.915) -- 0:00:33
806000 -- [-1298.754] (-1305.531) (-1294.791) (-1305.320) * (-1296.045) (-1297.074) (-1299.815) [-1299.440] -- 0:00:33
806500 -- (-1298.950) (-1302.565) (-1295.975) [-1300.528] * [-1297.420] (-1297.675) (-1298.563) (-1309.548) -- 0:00:33
807000 -- (-1296.191) (-1300.159) [-1300.678] (-1295.014) * (-1294.426) [-1298.808] (-1302.049) (-1306.984) -- 0:00:33
807500 -- (-1299.075) (-1295.497) (-1297.193) [-1292.550] * [-1299.516] (-1303.828) (-1297.210) (-1304.874) -- 0:00:33
808000 -- (-1297.457) [-1299.543] (-1296.304) (-1295.420) * [-1298.838] (-1299.345) (-1298.412) (-1302.260) -- 0:00:33
808500 -- (-1302.525) [-1302.126] (-1297.025) (-1296.632) * (-1305.548) (-1300.833) [-1296.312] (-1300.248) -- 0:00:32
809000 -- [-1296.827] (-1295.951) (-1299.393) (-1306.651) * (-1301.748) (-1297.686) (-1303.209) [-1300.254] -- 0:00:32
809500 -- (-1303.128) (-1300.725) [-1296.684] (-1299.557) * (-1304.510) (-1293.726) (-1299.390) [-1302.016] -- 0:00:32
810000 -- [-1293.998] (-1310.271) (-1303.792) (-1306.592) * (-1303.376) (-1300.943) (-1294.980) [-1305.134] -- 0:00:32
Average standard deviation of split frequencies: 0.000872
810500 -- [-1293.172] (-1304.646) (-1303.878) (-1298.910) * (-1297.616) (-1294.609) (-1295.931) [-1301.989] -- 0:00:32
811000 -- (-1294.207) [-1298.682] (-1298.291) (-1297.081) * [-1297.435] (-1299.440) (-1298.494) (-1297.524) -- 0:00:32
811500 -- [-1295.749] (-1296.276) (-1297.571) (-1298.182) * [-1293.049] (-1298.254) (-1299.856) (-1296.540) -- 0:00:32
812000 -- (-1293.689) (-1299.543) (-1300.852) [-1300.702] * (-1292.537) (-1302.640) (-1299.369) [-1296.779] -- 0:00:32
812500 -- [-1302.488] (-1296.756) (-1308.737) (-1297.844) * [-1298.212] (-1297.626) (-1301.004) (-1299.396) -- 0:00:32
813000 -- [-1297.116] (-1307.711) (-1302.297) (-1296.465) * (-1299.156) [-1304.539] (-1307.596) (-1304.687) -- 0:00:32
813500 -- (-1297.818) (-1297.455) [-1299.308] (-1303.296) * [-1293.851] (-1298.008) (-1304.926) (-1300.691) -- 0:00:32
814000 -- (-1301.478) (-1298.981) (-1305.414) [-1295.163] * [-1296.133] (-1304.550) (-1293.458) (-1302.207) -- 0:00:31
814500 -- [-1294.004] (-1294.754) (-1306.331) (-1301.220) * (-1297.076) (-1304.787) [-1299.281] (-1299.669) -- 0:00:31
815000 -- (-1297.451) (-1298.989) (-1297.034) [-1295.230] * [-1292.865] (-1298.005) (-1294.417) (-1303.764) -- 0:00:32
Average standard deviation of split frequencies: 0.000867
815500 -- (-1297.508) [-1295.215] (-1299.749) (-1298.744) * (-1297.215) (-1299.287) (-1296.612) [-1301.411] -- 0:00:31
816000 -- [-1298.730] (-1299.465) (-1299.317) (-1302.474) * (-1293.357) (-1294.713) (-1298.308) [-1296.418] -- 0:00:31
816500 -- (-1298.368) [-1294.694] (-1305.736) (-1297.921) * (-1301.392) [-1296.322] (-1303.300) (-1294.744) -- 0:00:31
817000 -- (-1302.266) (-1297.330) [-1294.564] (-1297.756) * (-1304.111) (-1293.618) [-1303.530] (-1300.842) -- 0:00:31
817500 -- (-1299.676) (-1297.000) (-1299.458) [-1299.317] * (-1304.095) (-1301.991) (-1299.363) [-1302.554] -- 0:00:31
818000 -- (-1303.624) [-1295.756] (-1296.497) (-1303.920) * [-1295.201] (-1300.117) (-1294.957) (-1301.826) -- 0:00:31
818500 -- (-1296.101) (-1301.395) (-1299.753) [-1298.535] * (-1297.062) [-1303.433] (-1299.254) (-1302.089) -- 0:00:31
819000 -- (-1301.359) (-1302.397) [-1296.917] (-1298.898) * (-1298.472) [-1302.198] (-1301.595) (-1303.843) -- 0:00:31
819500 -- (-1301.131) [-1298.075] (-1294.955) (-1308.850) * (-1304.002) (-1297.211) (-1299.607) [-1300.095] -- 0:00:31
820000 -- [-1294.299] (-1296.664) (-1299.465) (-1303.919) * (-1300.794) (-1298.144) (-1298.490) [-1299.552] -- 0:00:30
Average standard deviation of split frequencies: 0.000862
820500 -- (-1300.109) (-1300.826) (-1298.953) [-1294.889] * (-1300.248) [-1297.084] (-1297.788) (-1297.878) -- 0:00:30
821000 -- (-1298.570) (-1296.211) [-1295.939] (-1305.381) * [-1299.807] (-1297.376) (-1298.834) (-1295.953) -- 0:00:30
821500 -- [-1293.077] (-1295.642) (-1301.804) (-1296.506) * (-1296.420) (-1298.832) [-1300.320] (-1299.590) -- 0:00:30
822000 -- (-1298.701) (-1295.622) (-1297.500) [-1293.626] * (-1296.842) (-1302.904) (-1305.795) [-1305.110] -- 0:00:30
822500 -- (-1300.917) (-1301.630) [-1294.146] (-1293.901) * (-1299.258) (-1299.136) [-1296.563] (-1308.036) -- 0:00:30
823000 -- [-1299.077] (-1295.754) (-1293.763) (-1309.440) * (-1298.040) [-1298.200] (-1296.538) (-1302.263) -- 0:00:30
823500 -- (-1296.606) (-1297.647) [-1300.575] (-1296.198) * (-1307.937) (-1298.938) (-1298.487) [-1295.857] -- 0:00:30
824000 -- (-1303.315) (-1298.545) (-1303.457) [-1299.171] * (-1298.971) (-1304.359) (-1297.615) [-1296.200] -- 0:00:30
824500 -- (-1298.647) (-1302.125) [-1298.671] (-1300.914) * [-1303.276] (-1302.831) (-1300.151) (-1296.078) -- 0:00:30
825000 -- [-1292.314] (-1296.838) (-1300.898) (-1296.396) * (-1296.641) [-1296.855] (-1303.924) (-1297.382) -- 0:00:30
Average standard deviation of split frequencies: 0.000856
825500 -- [-1297.239] (-1294.857) (-1297.826) (-1297.189) * (-1294.584) (-1300.807) [-1298.768] (-1301.026) -- 0:00:30
826000 -- (-1295.384) [-1295.264] (-1296.323) (-1304.645) * [-1300.743] (-1296.106) (-1305.411) (-1302.896) -- 0:00:29
826500 -- (-1300.047) (-1297.386) [-1300.210] (-1297.608) * (-1299.029) (-1303.613) (-1300.475) [-1296.834] -- 0:00:29
827000 -- [-1294.915] (-1295.701) (-1295.611) (-1298.231) * (-1303.399) [-1295.869] (-1305.783) (-1296.760) -- 0:00:29
827500 -- (-1300.337) [-1294.772] (-1296.317) (-1301.344) * [-1296.992] (-1293.867) (-1294.699) (-1298.840) -- 0:00:29
828000 -- [-1292.803] (-1294.328) (-1296.457) (-1300.190) * (-1303.360) (-1301.805) [-1291.946] (-1296.948) -- 0:00:29
828500 -- (-1297.244) (-1293.485) (-1300.197) [-1295.431] * [-1303.676] (-1299.214) (-1297.692) (-1300.260) -- 0:00:29
829000 -- [-1294.402] (-1302.696) (-1302.390) (-1297.503) * (-1297.608) [-1300.276] (-1301.838) (-1298.300) -- 0:00:29
829500 -- (-1297.769) (-1302.957) [-1301.915] (-1296.607) * (-1299.750) [-1295.127] (-1298.565) (-1300.505) -- 0:00:29
830000 -- (-1299.831) (-1295.617) (-1293.291) [-1295.993] * (-1295.587) (-1298.450) [-1299.577] (-1293.918) -- 0:00:29
Average standard deviation of split frequencies: 0.000851
830500 -- (-1299.390) [-1298.646] (-1298.429) (-1306.615) * (-1300.884) (-1305.522) [-1295.052] (-1297.379) -- 0:00:29
831000 -- (-1301.498) (-1298.431) (-1298.726) [-1295.252] * (-1294.138) [-1299.914] (-1296.040) (-1303.500) -- 0:00:29
831500 -- (-1299.988) (-1296.840) [-1304.725] (-1295.732) * (-1297.954) [-1295.629] (-1305.849) (-1308.604) -- 0:00:28
832000 -- (-1302.363) (-1297.102) (-1308.435) [-1294.748] * [-1293.450] (-1301.477) (-1299.116) (-1301.242) -- 0:00:28
832500 -- [-1297.679] (-1297.361) (-1294.193) (-1298.984) * (-1296.136) (-1295.692) (-1298.337) [-1296.767] -- 0:00:28
833000 -- (-1303.534) (-1303.235) [-1302.913] (-1296.505) * (-1298.881) (-1298.810) [-1297.366] (-1302.478) -- 0:00:28
833500 -- (-1300.634) (-1299.459) (-1298.777) [-1299.598] * (-1298.422) [-1293.338] (-1302.447) (-1298.434) -- 0:00:28
834000 -- (-1297.155) (-1294.809) (-1293.958) [-1298.496] * (-1295.893) (-1311.860) (-1300.987) [-1297.287] -- 0:00:28
834500 -- (-1293.447) (-1297.659) [-1297.885] (-1298.785) * (-1294.836) (-1305.955) [-1302.699] (-1296.948) -- 0:00:28
835000 -- (-1298.205) (-1298.941) (-1299.542) [-1297.260] * [-1302.912] (-1300.626) (-1297.900) (-1294.182) -- 0:00:28
Average standard deviation of split frequencies: 0.000846
835500 -- (-1299.959) [-1299.948] (-1295.084) (-1301.743) * (-1297.457) (-1292.155) [-1294.749] (-1297.181) -- 0:00:28
836000 -- (-1300.004) (-1296.345) (-1312.077) [-1299.751] * (-1297.856) [-1293.363] (-1298.342) (-1299.028) -- 0:00:28
836500 -- (-1300.519) [-1296.673] (-1297.504) (-1302.180) * (-1296.828) (-1292.456) [-1296.681] (-1302.624) -- 0:00:28
837000 -- (-1301.377) (-1297.522) [-1294.373] (-1302.734) * [-1296.385] (-1297.137) (-1299.340) (-1298.079) -- 0:00:28
837500 -- (-1297.817) (-1297.512) [-1296.359] (-1298.392) * (-1296.469) (-1302.858) [-1292.294] (-1299.288) -- 0:00:27
838000 -- (-1298.932) (-1300.629) (-1299.007) [-1296.847] * (-1304.842) (-1299.262) [-1294.367] (-1300.002) -- 0:00:27
838500 -- [-1298.744] (-1296.449) (-1304.389) (-1298.803) * (-1294.722) (-1297.133) (-1297.898) [-1299.163] -- 0:00:27
839000 -- [-1294.101] (-1300.479) (-1296.645) (-1298.350) * [-1298.091] (-1299.923) (-1300.844) (-1296.722) -- 0:00:27
839500 -- (-1298.708) (-1301.047) [-1296.644] (-1294.810) * (-1297.163) (-1294.657) (-1299.232) [-1297.554] -- 0:00:27
840000 -- [-1297.934] (-1312.377) (-1296.578) (-1301.237) * [-1294.839] (-1296.859) (-1299.926) (-1295.626) -- 0:00:27
Average standard deviation of split frequencies: 0.000841
840500 -- [-1299.367] (-1301.266) (-1303.875) (-1296.251) * (-1298.760) [-1297.415] (-1302.092) (-1302.182) -- 0:00:27
841000 -- (-1301.846) (-1297.715) (-1300.802) [-1297.822] * [-1298.370] (-1302.182) (-1299.786) (-1298.860) -- 0:00:27
841500 -- (-1299.379) (-1294.203) (-1301.527) [-1301.762] * [-1292.787] (-1298.488) (-1295.071) (-1300.016) -- 0:00:27
842000 -- [-1302.028] (-1304.121) (-1297.298) (-1297.737) * (-1304.995) (-1299.100) (-1296.631) [-1298.199] -- 0:00:27
842500 -- (-1305.290) [-1300.496] (-1297.705) (-1304.022) * (-1298.015) (-1294.542) (-1297.606) [-1298.439] -- 0:00:27
843000 -- (-1305.672) (-1298.909) (-1301.541) [-1303.453] * (-1300.227) (-1301.591) [-1300.885] (-1297.215) -- 0:00:27
843500 -- (-1302.157) (-1306.185) (-1296.651) [-1297.348] * (-1296.606) [-1307.916] (-1298.023) (-1313.784) -- 0:00:26
844000 -- (-1303.990) (-1304.501) (-1305.759) [-1295.520] * (-1298.597) (-1309.691) (-1294.724) [-1300.113] -- 0:00:26
844500 -- (-1299.936) (-1304.268) (-1295.884) [-1294.577] * (-1304.075) [-1298.506] (-1301.977) (-1304.169) -- 0:00:26
845000 -- (-1295.240) (-1303.238) (-1300.866) [-1294.374] * (-1298.367) (-1300.582) (-1296.592) [-1294.648] -- 0:00:26
Average standard deviation of split frequencies: 0.000557
845500 -- (-1295.824) [-1293.450] (-1301.862) (-1294.694) * (-1300.400) [-1294.481] (-1293.271) (-1299.532) -- 0:00:26
846000 -- [-1301.026] (-1297.398) (-1303.516) (-1303.115) * [-1294.486] (-1300.030) (-1296.151) (-1298.799) -- 0:00:26
846500 -- (-1294.905) (-1294.421) (-1301.900) [-1300.712] * (-1302.854) (-1298.458) [-1292.674] (-1293.313) -- 0:00:26
847000 -- (-1302.433) (-1299.030) [-1294.423] (-1300.709) * (-1307.910) (-1300.968) (-1298.148) [-1298.726] -- 0:00:26
847500 -- [-1297.576] (-1295.553) (-1302.050) (-1298.456) * [-1295.575] (-1297.783) (-1302.445) (-1299.398) -- 0:00:26
848000 -- [-1293.692] (-1299.833) (-1295.181) (-1298.510) * (-1298.166) [-1294.977] (-1298.343) (-1300.378) -- 0:00:26
848500 -- (-1304.418) (-1303.179) (-1298.058) [-1306.264] * [-1294.900] (-1298.912) (-1300.320) (-1299.452) -- 0:00:26
849000 -- [-1296.866] (-1298.266) (-1296.400) (-1302.390) * [-1300.998] (-1295.509) (-1293.034) (-1304.745) -- 0:00:25
849500 -- [-1297.906] (-1303.192) (-1301.533) (-1301.531) * (-1311.115) [-1297.506] (-1294.378) (-1310.481) -- 0:00:25
850000 -- (-1303.980) (-1297.745) [-1298.530] (-1302.233) * (-1299.875) (-1296.799) [-1299.359] (-1299.175) -- 0:00:25
Average standard deviation of split frequencies: 0.000554
850500 -- (-1309.052) [-1300.457] (-1294.220) (-1296.481) * (-1300.920) [-1292.003] (-1294.611) (-1299.134) -- 0:00:25
851000 -- (-1299.133) [-1300.225] (-1303.047) (-1297.049) * (-1300.108) (-1291.438) [-1298.989] (-1299.833) -- 0:00:25
851500 -- [-1302.138] (-1298.191) (-1298.503) (-1301.913) * (-1297.570) (-1303.389) [-1302.201] (-1300.259) -- 0:00:25
852000 -- (-1302.324) (-1303.069) [-1297.519] (-1294.564) * (-1297.478) (-1299.567) (-1295.561) [-1296.982] -- 0:00:25
852500 -- (-1297.428) (-1297.416) [-1303.176] (-1298.846) * [-1298.506] (-1302.613) (-1300.626) (-1297.369) -- 0:00:25
853000 -- [-1294.148] (-1296.948) (-1303.556) (-1303.382) * (-1300.935) [-1300.521] (-1306.083) (-1296.967) -- 0:00:25
853500 -- (-1297.810) [-1304.945] (-1296.980) (-1300.681) * (-1304.631) (-1303.212) [-1298.274] (-1303.183) -- 0:00:25
854000 -- [-1298.649] (-1302.132) (-1294.792) (-1293.328) * (-1301.359) [-1294.803] (-1301.304) (-1296.444) -- 0:00:25
854500 -- (-1297.257) (-1302.816) [-1292.643] (-1295.939) * [-1299.045] (-1294.160) (-1300.040) (-1295.452) -- 0:00:25
855000 -- (-1301.832) [-1301.183] (-1293.877) (-1297.953) * [-1299.713] (-1302.378) (-1299.902) (-1302.985) -- 0:00:24
Average standard deviation of split frequencies: 0.000551
855500 -- [-1296.709] (-1307.839) (-1295.844) (-1298.197) * (-1300.536) [-1294.582] (-1301.937) (-1307.923) -- 0:00:24
856000 -- (-1302.398) (-1300.393) [-1299.711] (-1297.681) * (-1293.162) (-1301.984) (-1305.520) [-1304.916] -- 0:00:24
856500 -- (-1301.122) (-1299.008) (-1297.041) [-1295.935] * [-1301.094] (-1298.341) (-1303.122) (-1298.382) -- 0:00:24
857000 -- [-1297.214] (-1300.483) (-1295.422) (-1302.482) * (-1296.908) [-1293.160] (-1295.445) (-1298.039) -- 0:00:24
857500 -- (-1306.865) [-1298.219] (-1299.733) (-1298.963) * (-1299.525) [-1295.196] (-1303.294) (-1303.596) -- 0:00:24
858000 -- (-1306.158) (-1301.236) (-1297.368) [-1295.813] * (-1298.278) [-1298.159] (-1312.674) (-1297.525) -- 0:00:24
858500 -- (-1299.673) (-1295.898) (-1295.643) [-1298.039] * (-1298.676) (-1305.408) [-1297.125] (-1300.894) -- 0:00:24
859000 -- (-1299.294) (-1300.605) (-1297.054) [-1301.434] * (-1297.872) (-1304.428) (-1307.302) [-1300.764] -- 0:00:24
859500 -- (-1295.709) (-1296.133) [-1299.878] (-1295.461) * [-1297.624] (-1309.207) (-1301.785) (-1302.374) -- 0:00:24
860000 -- (-1301.412) [-1293.996] (-1297.214) (-1295.430) * (-1303.820) [-1299.278] (-1296.898) (-1304.988) -- 0:00:24
Average standard deviation of split frequencies: 0.000548
860500 -- (-1298.221) (-1302.854) (-1295.896) [-1293.556] * (-1303.513) (-1299.105) [-1293.988] (-1295.544) -- 0:00:23
861000 -- [-1295.864] (-1301.804) (-1307.271) (-1296.519) * (-1300.098) [-1298.166] (-1298.909) (-1300.499) -- 0:00:23
861500 -- [-1294.404] (-1300.911) (-1299.050) (-1298.157) * [-1296.859] (-1301.090) (-1297.349) (-1294.676) -- 0:00:23
862000 -- (-1297.431) (-1296.167) [-1299.240] (-1297.553) * (-1300.203) (-1299.358) (-1303.324) [-1292.989] -- 0:00:23
862500 -- (-1299.922) [-1304.148] (-1304.602) (-1298.388) * [-1301.075] (-1299.061) (-1301.664) (-1303.861) -- 0:00:23
863000 -- [-1296.197] (-1297.385) (-1300.784) (-1301.860) * (-1305.024) [-1298.133] (-1298.971) (-1301.042) -- 0:00:23
863500 -- (-1300.930) [-1296.716] (-1304.876) (-1299.294) * (-1296.940) (-1300.259) (-1297.394) [-1294.776] -- 0:00:23
864000 -- [-1293.872] (-1297.705) (-1302.150) (-1302.724) * (-1294.746) (-1306.651) (-1297.962) [-1305.742] -- 0:00:23
864500 -- (-1306.753) (-1295.415) [-1301.054] (-1303.145) * [-1300.487] (-1299.719) (-1299.871) (-1296.134) -- 0:00:23
865000 -- (-1298.879) [-1294.169] (-1305.923) (-1302.280) * (-1301.945) (-1300.027) [-1296.083] (-1294.910) -- 0:00:23
Average standard deviation of split frequencies: 0.000544
865500 -- (-1299.115) (-1298.459) [-1296.949] (-1298.663) * [-1298.949] (-1303.555) (-1294.447) (-1299.242) -- 0:00:23
866000 -- (-1300.784) [-1294.617] (-1303.813) (-1299.632) * (-1302.839) (-1296.693) [-1297.813] (-1297.031) -- 0:00:23
866500 -- (-1297.181) (-1304.630) (-1301.329) [-1297.715] * (-1307.865) (-1294.314) [-1295.841] (-1302.759) -- 0:00:22
867000 -- (-1295.044) (-1296.555) [-1295.617] (-1296.923) * (-1300.603) (-1300.085) (-1297.559) [-1299.252] -- 0:00:22
867500 -- (-1298.840) (-1298.380) [-1295.848] (-1293.358) * [-1304.105] (-1297.029) (-1300.210) (-1303.234) -- 0:00:22
868000 -- (-1298.912) [-1295.853] (-1296.512) (-1305.997) * (-1307.377) (-1292.976) (-1297.703) [-1297.092] -- 0:00:22
868500 -- (-1301.571) (-1302.415) (-1299.137) [-1301.588] * (-1300.440) (-1299.956) (-1297.321) [-1298.923] -- 0:00:22
869000 -- (-1297.350) [-1297.343] (-1303.982) (-1305.670) * (-1303.316) (-1298.277) (-1301.802) [-1296.123] -- 0:00:22
869500 -- (-1303.063) [-1293.377] (-1296.651) (-1303.856) * (-1300.047) (-1298.015) [-1296.581] (-1298.806) -- 0:00:22
870000 -- (-1293.819) (-1301.937) [-1298.888] (-1305.578) * [-1297.745] (-1300.432) (-1300.636) (-1297.248) -- 0:00:22
Average standard deviation of split frequencies: 0.000541
870500 -- (-1293.680) (-1299.739) (-1295.738) [-1305.233] * [-1298.567] (-1302.107) (-1301.805) (-1297.182) -- 0:00:22
871000 -- (-1298.289) (-1300.032) [-1295.436] (-1298.214) * [-1296.010] (-1303.447) (-1304.816) (-1296.666) -- 0:00:22
871500 -- (-1296.890) (-1297.180) [-1299.929] (-1298.043) * (-1299.389) (-1297.434) (-1301.906) [-1302.839] -- 0:00:22
872000 -- (-1300.679) (-1299.919) [-1299.802] (-1302.031) * [-1298.793] (-1299.659) (-1301.290) (-1299.745) -- 0:00:22
872500 -- (-1298.925) [-1296.136] (-1300.098) (-1294.676) * [-1299.326] (-1308.567) (-1304.197) (-1296.482) -- 0:00:21
873000 -- [-1292.589] (-1300.057) (-1296.972) (-1293.638) * [-1300.179] (-1302.169) (-1297.860) (-1298.686) -- 0:00:21
873500 -- (-1300.191) (-1304.614) [-1295.038] (-1299.478) * (-1304.709) (-1295.875) (-1307.980) [-1296.112] -- 0:00:21
874000 -- [-1299.629] (-1300.880) (-1296.400) (-1298.190) * [-1298.833] (-1305.798) (-1297.915) (-1299.386) -- 0:00:21
874500 -- (-1299.340) (-1301.484) [-1294.489] (-1299.261) * (-1301.300) (-1299.448) (-1304.658) [-1295.014] -- 0:00:21
875000 -- (-1305.555) (-1297.470) [-1295.415] (-1300.704) * (-1293.264) (-1303.044) (-1302.347) [-1296.220] -- 0:00:21
Average standard deviation of split frequencies: 0.000269
875500 -- (-1301.588) [-1295.108] (-1304.623) (-1302.945) * (-1300.283) (-1299.078) (-1306.845) [-1294.394] -- 0:00:21
876000 -- [-1302.958] (-1294.065) (-1299.386) (-1294.843) * [-1297.213] (-1304.449) (-1302.717) (-1296.708) -- 0:00:21
876500 -- (-1301.133) [-1300.431] (-1305.360) (-1302.554) * (-1296.134) (-1296.232) (-1315.608) [-1303.143] -- 0:00:21
877000 -- (-1302.961) [-1296.447] (-1298.471) (-1299.184) * [-1293.564] (-1293.199) (-1299.592) (-1298.774) -- 0:00:21
877500 -- (-1297.687) (-1294.298) (-1299.156) [-1295.987] * (-1298.091) (-1291.371) (-1301.565) [-1297.327] -- 0:00:21
878000 -- [-1299.989] (-1303.568) (-1297.898) (-1303.684) * (-1297.378) [-1296.853] (-1300.066) (-1300.325) -- 0:00:20
878500 -- (-1298.085) [-1300.137] (-1301.531) (-1293.429) * [-1297.721] (-1300.859) (-1295.342) (-1297.160) -- 0:00:20
879000 -- (-1298.280) (-1297.699) (-1297.009) [-1292.264] * (-1299.104) (-1297.689) [-1298.960] (-1301.510) -- 0:00:20
879500 -- [-1297.056] (-1294.872) (-1302.181) (-1298.453) * (-1298.039) [-1298.830] (-1292.259) (-1298.369) -- 0:00:20
880000 -- [-1297.131] (-1297.032) (-1300.218) (-1296.371) * [-1294.851] (-1306.130) (-1297.893) (-1293.323) -- 0:00:20
Average standard deviation of split frequencies: 0.000268
880500 -- (-1300.187) (-1295.183) (-1293.978) [-1301.664] * (-1300.342) [-1293.200] (-1301.197) (-1297.187) -- 0:00:20
881000 -- (-1295.671) [-1301.667] (-1304.429) (-1299.352) * (-1297.241) (-1299.671) [-1302.155] (-1298.240) -- 0:00:20
881500 -- [-1296.474] (-1295.767) (-1302.233) (-1293.586) * (-1302.494) [-1297.405] (-1300.887) (-1298.844) -- 0:00:20
882000 -- (-1295.797) [-1293.542] (-1297.535) (-1295.798) * [-1293.046] (-1298.931) (-1296.474) (-1302.672) -- 0:00:20
882500 -- (-1299.036) (-1296.363) [-1302.986] (-1300.694) * (-1295.368) [-1305.472] (-1294.500) (-1305.034) -- 0:00:20
883000 -- (-1295.097) [-1293.589] (-1301.973) (-1299.026) * (-1297.548) (-1297.320) [-1294.301] (-1297.503) -- 0:00:20
883500 -- [-1296.482] (-1302.250) (-1304.983) (-1301.605) * [-1296.898] (-1296.136) (-1297.961) (-1298.130) -- 0:00:20
884000 -- (-1307.958) (-1298.778) (-1299.401) [-1299.968] * [-1296.584] (-1301.517) (-1298.480) (-1297.700) -- 0:00:19
884500 -- [-1297.379] (-1297.427) (-1297.324) (-1303.020) * (-1304.145) (-1296.041) [-1303.430] (-1295.407) -- 0:00:19
885000 -- [-1303.112] (-1301.017) (-1298.678) (-1301.721) * [-1302.016] (-1296.750) (-1305.858) (-1295.755) -- 0:00:19
Average standard deviation of split frequencies: 0.000266
885500 -- (-1303.189) (-1300.125) (-1297.974) [-1297.132] * (-1296.206) (-1299.493) (-1311.688) [-1298.502] -- 0:00:19
886000 -- (-1301.964) [-1297.914] (-1302.036) (-1298.530) * [-1293.831] (-1298.229) (-1308.970) (-1300.060) -- 0:00:19
886500 -- [-1300.645] (-1305.361) (-1300.554) (-1294.585) * (-1295.117) (-1301.611) [-1296.084] (-1299.043) -- 0:00:19
887000 -- (-1298.002) (-1298.723) (-1301.854) [-1294.225] * (-1299.782) (-1297.820) (-1300.283) [-1302.752] -- 0:00:19
887500 -- (-1301.223) (-1304.715) (-1300.096) [-1296.342] * (-1297.963) (-1294.188) (-1297.871) [-1301.164] -- 0:00:19
888000 -- (-1302.922) (-1294.536) (-1299.408) [-1298.275] * (-1293.465) (-1298.204) [-1300.739] (-1303.908) -- 0:00:19
888500 -- (-1298.991) (-1302.440) [-1295.387] (-1303.549) * (-1300.525) (-1296.915) (-1298.408) [-1293.061] -- 0:00:19
889000 -- (-1300.113) [-1298.861] (-1294.596) (-1299.974) * (-1297.500) [-1295.366] (-1307.381) (-1300.545) -- 0:00:19
889500 -- (-1295.216) [-1299.412] (-1302.830) (-1297.015) * (-1301.585) (-1298.165) [-1304.023] (-1301.130) -- 0:00:19
890000 -- (-1295.752) [-1300.553] (-1304.892) (-1298.960) * (-1304.046) [-1295.240] (-1296.138) (-1304.295) -- 0:00:18
Average standard deviation of split frequencies: 0.000265
890500 -- [-1296.459] (-1297.406) (-1298.915) (-1300.150) * (-1301.812) (-1303.523) [-1296.464] (-1298.753) -- 0:00:18
891000 -- (-1305.625) (-1294.357) (-1301.119) [-1300.248] * (-1299.500) (-1300.436) [-1300.728] (-1300.256) -- 0:00:18
891500 -- (-1301.915) (-1299.319) (-1297.403) [-1297.385] * (-1304.473) (-1298.844) (-1307.628) [-1297.260] -- 0:00:18
892000 -- [-1300.501] (-1295.212) (-1298.291) (-1301.988) * (-1299.764) (-1305.957) [-1295.513] (-1308.320) -- 0:00:18
892500 -- (-1301.201) [-1294.772] (-1293.139) (-1304.255) * [-1291.267] (-1295.797) (-1301.166) (-1306.232) -- 0:00:18
893000 -- [-1302.090] (-1296.410) (-1302.127) (-1299.370) * (-1301.958) (-1293.094) (-1300.625) [-1299.021] -- 0:00:18
893500 -- [-1306.066] (-1299.503) (-1302.614) (-1304.879) * (-1293.021) (-1293.962) (-1302.755) [-1294.945] -- 0:00:18
894000 -- (-1301.848) (-1300.473) [-1295.744] (-1306.524) * [-1295.284] (-1296.478) (-1296.172) (-1298.675) -- 0:00:18
894500 -- (-1294.716) [-1299.938] (-1295.035) (-1305.553) * [-1301.560] (-1299.304) (-1294.789) (-1298.785) -- 0:00:18
895000 -- [-1304.457] (-1297.393) (-1298.853) (-1303.461) * (-1296.445) (-1299.547) [-1295.941] (-1297.606) -- 0:00:18
Average standard deviation of split frequencies: 0.000263
895500 -- (-1301.737) (-1294.562) (-1300.589) [-1296.869] * (-1298.108) (-1302.306) [-1299.007] (-1299.327) -- 0:00:17
896000 -- [-1298.120] (-1292.354) (-1293.534) (-1299.513) * (-1299.652) [-1298.424] (-1301.352) (-1298.491) -- 0:00:17
896500 -- (-1299.188) [-1294.040] (-1294.809) (-1300.017) * (-1301.687) [-1294.419] (-1296.357) (-1297.296) -- 0:00:17
897000 -- (-1295.103) (-1302.331) [-1295.714] (-1300.682) * (-1298.341) (-1304.776) [-1299.245] (-1305.756) -- 0:00:17
897500 -- (-1296.916) [-1296.009] (-1293.304) (-1306.693) * (-1301.199) [-1298.460] (-1301.699) (-1300.518) -- 0:00:17
898000 -- (-1295.953) (-1305.545) [-1299.789] (-1298.389) * (-1300.431) [-1301.836] (-1295.693) (-1296.676) -- 0:00:17
898500 -- [-1296.546] (-1296.202) (-1295.772) (-1303.974) * [-1295.434] (-1300.344) (-1299.299) (-1300.789) -- 0:00:17
899000 -- [-1293.984] (-1294.864) (-1295.393) (-1298.225) * (-1296.625) [-1304.266] (-1293.644) (-1302.427) -- 0:00:17
899500 -- (-1295.242) (-1300.729) [-1300.466] (-1300.542) * [-1299.874] (-1296.901) (-1300.115) (-1296.419) -- 0:00:17
900000 -- (-1301.068) [-1297.815] (-1303.377) (-1298.959) * [-1304.686] (-1294.447) (-1296.510) (-1298.516) -- 0:00:17
Average standard deviation of split frequencies: 0.000523
900500 -- (-1305.494) [-1302.052] (-1297.654) (-1295.806) * [-1293.114] (-1301.311) (-1299.487) (-1300.883) -- 0:00:17
901000 -- (-1302.264) (-1301.228) [-1301.398] (-1300.307) * (-1294.357) [-1295.071] (-1299.656) (-1298.374) -- 0:00:17
901500 -- (-1298.891) (-1295.451) [-1294.759] (-1294.698) * (-1295.702) (-1303.278) (-1295.205) [-1292.342] -- 0:00:16
902000 -- (-1297.436) (-1293.643) [-1298.264] (-1293.147) * (-1296.423) (-1298.445) [-1298.103] (-1300.071) -- 0:00:16
902500 -- [-1296.443] (-1297.026) (-1306.814) (-1296.179) * (-1294.870) (-1303.349) [-1295.602] (-1295.808) -- 0:00:16
903000 -- (-1303.055) [-1297.627] (-1295.633) (-1302.853) * (-1299.628) (-1295.973) [-1298.274] (-1300.700) -- 0:00:16
903500 -- [-1297.154] (-1302.723) (-1302.724) (-1298.137) * (-1298.431) [-1296.843] (-1303.114) (-1301.500) -- 0:00:16
904000 -- [-1300.000] (-1300.343) (-1299.612) (-1298.561) * (-1308.075) [-1304.688] (-1300.289) (-1304.392) -- 0:00:16
904500 -- (-1298.076) (-1294.518) [-1296.136] (-1298.721) * (-1298.456) (-1304.071) [-1292.800] (-1301.582) -- 0:00:16
905000 -- (-1297.311) (-1307.812) (-1298.447) [-1300.158] * [-1297.209] (-1303.830) (-1313.016) (-1302.163) -- 0:00:16
Average standard deviation of split frequencies: 0.000520
905500 -- (-1302.449) [-1300.722] (-1296.294) (-1297.796) * (-1299.514) [-1299.922] (-1302.244) (-1298.221) -- 0:00:16
906000 -- (-1297.312) (-1296.137) (-1303.606) [-1292.637] * [-1293.672] (-1298.364) (-1297.160) (-1299.500) -- 0:00:16
906500 -- [-1299.894] (-1296.231) (-1303.240) (-1295.363) * (-1297.768) [-1299.725] (-1295.638) (-1297.234) -- 0:00:16
907000 -- [-1291.986] (-1309.766) (-1304.817) (-1296.844) * (-1298.003) (-1299.782) (-1295.815) [-1297.540] -- 0:00:15
907500 -- [-1296.459] (-1300.069) (-1301.152) (-1296.554) * (-1302.766) [-1300.043] (-1307.513) (-1305.194) -- 0:00:15
908000 -- [-1299.979] (-1297.540) (-1296.813) (-1298.890) * (-1297.130) (-1295.616) (-1297.941) [-1295.632] -- 0:00:15
908500 -- (-1297.660) [-1299.830] (-1295.766) (-1303.571) * [-1299.346] (-1298.446) (-1298.776) (-1302.725) -- 0:00:15
909000 -- [-1297.615] (-1300.230) (-1298.023) (-1297.384) * (-1300.650) (-1301.061) (-1304.047) [-1300.309] -- 0:00:15
909500 -- (-1306.367) (-1300.274) [-1301.296] (-1302.360) * [-1295.235] (-1298.843) (-1300.216) (-1298.916) -- 0:00:15
910000 -- [-1298.256] (-1299.785) (-1299.553) (-1302.771) * (-1297.074) [-1293.320] (-1290.837) (-1294.207) -- 0:00:15
Average standard deviation of split frequencies: 0.000518
910500 -- (-1304.661) (-1305.310) (-1303.638) [-1295.416] * [-1298.141] (-1296.326) (-1292.154) (-1293.665) -- 0:00:15
911000 -- (-1302.837) (-1301.729) (-1299.983) [-1296.676] * (-1296.901) (-1299.862) (-1295.475) [-1291.362] -- 0:00:15
911500 -- (-1300.722) (-1295.781) [-1300.582] (-1300.181) * (-1303.554) (-1299.881) (-1296.578) [-1298.211] -- 0:00:15
912000 -- [-1300.657] (-1297.060) (-1300.371) (-1292.560) * (-1305.045) (-1294.585) [-1297.534] (-1296.247) -- 0:00:15
912500 -- [-1296.009] (-1293.410) (-1298.965) (-1297.479) * [-1298.851] (-1295.683) (-1299.562) (-1300.409) -- 0:00:15
913000 -- (-1299.852) [-1293.743] (-1297.802) (-1297.965) * [-1292.328] (-1297.348) (-1301.258) (-1301.818) -- 0:00:14
913500 -- [-1304.795] (-1293.096) (-1300.376) (-1296.469) * (-1300.154) (-1295.622) (-1299.152) [-1294.642] -- 0:00:14
914000 -- (-1304.475) [-1294.508] (-1294.818) (-1299.999) * (-1304.577) [-1296.432] (-1298.746) (-1304.801) -- 0:00:14
914500 -- [-1301.155] (-1297.836) (-1296.442) (-1297.059) * (-1304.678) [-1296.869] (-1299.345) (-1300.887) -- 0:00:14
915000 -- (-1299.559) (-1295.371) (-1300.562) [-1299.640] * [-1299.313] (-1300.123) (-1298.898) (-1300.104) -- 0:00:14
Average standard deviation of split frequencies: 0.000515
915500 -- (-1296.498) (-1296.354) (-1297.925) [-1301.234] * [-1294.948] (-1303.039) (-1293.120) (-1299.011) -- 0:00:14
916000 -- (-1301.955) [-1294.648] (-1299.597) (-1302.090) * (-1298.179) [-1295.869] (-1295.168) (-1297.167) -- 0:00:14
916500 -- (-1298.393) (-1296.554) (-1304.668) [-1298.111] * (-1296.390) (-1299.849) (-1295.328) [-1304.067] -- 0:00:14
917000 -- (-1302.139) (-1299.487) (-1300.193) [-1299.475] * (-1301.876) (-1299.531) [-1302.211] (-1301.327) -- 0:00:14
917500 -- [-1298.499] (-1296.545) (-1296.484) (-1300.152) * [-1294.548] (-1295.944) (-1298.062) (-1295.468) -- 0:00:14
918000 -- [-1297.180] (-1295.045) (-1296.437) (-1298.714) * [-1296.994] (-1297.919) (-1302.064) (-1300.033) -- 0:00:14
918500 -- (-1299.865) [-1296.081] (-1294.825) (-1299.207) * [-1296.062] (-1297.797) (-1305.570) (-1304.158) -- 0:00:14
919000 -- (-1297.936) (-1298.083) [-1297.585] (-1298.485) * (-1303.331) (-1300.811) [-1306.342] (-1299.623) -- 0:00:13
919500 -- (-1298.783) (-1297.942) (-1304.217) [-1298.831] * (-1300.648) (-1304.303) (-1298.118) [-1296.044] -- 0:00:13
920000 -- [-1291.523] (-1296.524) (-1305.433) (-1314.875) * (-1303.971) (-1298.395) [-1295.954] (-1294.427) -- 0:00:13
Average standard deviation of split frequencies: 0.000512
920500 -- (-1304.355) (-1301.629) [-1295.712] (-1302.275) * (-1297.674) [-1298.553] (-1297.015) (-1296.090) -- 0:00:13
921000 -- [-1296.883] (-1293.230) (-1293.035) (-1309.160) * (-1298.246) (-1302.988) [-1295.740] (-1298.830) -- 0:00:13
921500 -- [-1300.034] (-1291.682) (-1297.967) (-1303.295) * (-1296.744) (-1301.757) [-1294.743] (-1297.852) -- 0:00:13
922000 -- [-1293.141] (-1295.491) (-1297.763) (-1305.031) * (-1296.986) (-1302.687) [-1297.930] (-1293.755) -- 0:00:13
922500 -- (-1297.345) [-1293.866] (-1302.069) (-1306.282) * [-1292.111] (-1303.877) (-1298.209) (-1296.156) -- 0:00:13
923000 -- (-1300.366) [-1302.614] (-1295.093) (-1307.415) * (-1296.861) [-1302.497] (-1302.068) (-1307.973) -- 0:00:13
923500 -- (-1300.177) (-1300.609) (-1300.043) [-1299.525] * [-1300.093] (-1299.351) (-1295.381) (-1305.334) -- 0:00:13
924000 -- [-1298.670] (-1299.006) (-1295.832) (-1297.777) * [-1294.553] (-1303.556) (-1295.967) (-1303.292) -- 0:00:13
924500 -- (-1301.617) (-1295.937) (-1300.105) [-1300.916] * (-1299.285) [-1295.662] (-1302.540) (-1300.399) -- 0:00:12
925000 -- (-1299.539) (-1304.794) [-1295.449] (-1303.613) * (-1303.638) (-1296.976) (-1294.807) [-1301.440] -- 0:00:12
Average standard deviation of split frequencies: 0.000255
925500 -- (-1298.178) (-1294.889) (-1294.411) [-1299.396] * (-1294.050) (-1295.713) [-1295.844] (-1297.945) -- 0:00:12
926000 -- (-1297.835) [-1295.470] (-1296.229) (-1300.052) * (-1295.314) (-1301.215) [-1300.450] (-1297.463) -- 0:00:12
926500 -- (-1300.948) (-1297.666) (-1300.206) [-1300.855] * [-1301.353] (-1299.367) (-1302.213) (-1297.672) -- 0:00:12
927000 -- (-1300.769) [-1298.406] (-1297.164) (-1301.192) * (-1300.244) (-1306.220) (-1308.432) [-1295.043] -- 0:00:12
927500 -- (-1306.228) (-1304.582) (-1296.120) [-1292.941] * (-1296.273) [-1302.933] (-1298.663) (-1304.247) -- 0:00:12
928000 -- (-1299.786) (-1300.324) [-1293.749] (-1299.007) * (-1295.933) (-1294.446) (-1306.803) [-1296.717] -- 0:00:12
928500 -- [-1296.925] (-1303.719) (-1298.337) (-1296.454) * (-1298.541) (-1305.293) [-1293.899] (-1299.521) -- 0:00:12
929000 -- (-1294.656) (-1303.262) (-1293.613) [-1295.244] * [-1299.711] (-1299.841) (-1298.704) (-1305.179) -- 0:00:12
929500 -- (-1301.854) (-1297.755) (-1302.950) [-1297.722] * (-1301.490) [-1301.044] (-1295.087) (-1297.803) -- 0:00:12
930000 -- (-1301.246) (-1303.019) [-1294.345] (-1298.203) * (-1299.201) [-1297.429] (-1300.726) (-1296.737) -- 0:00:12
Average standard deviation of split frequencies: 0.000253
930500 -- (-1299.240) (-1299.286) [-1298.136] (-1295.690) * (-1304.579) (-1305.700) (-1294.955) [-1294.705] -- 0:00:11
931000 -- [-1295.438] (-1299.853) (-1293.560) (-1299.364) * (-1307.680) (-1304.562) [-1294.313] (-1300.410) -- 0:00:11
931500 -- (-1298.882) [-1295.159] (-1295.027) (-1299.564) * (-1294.192) (-1299.978) [-1296.271] (-1296.464) -- 0:00:11
932000 -- (-1294.430) [-1295.845] (-1297.490) (-1295.505) * (-1297.774) (-1299.108) [-1295.446] (-1299.522) -- 0:00:11
932500 -- (-1300.517) [-1299.201] (-1300.457) (-1297.085) * (-1304.424) (-1302.462) [-1295.756] (-1303.622) -- 0:00:11
933000 -- (-1300.168) [-1301.000] (-1304.980) (-1298.356) * (-1298.737) (-1295.416) [-1297.590] (-1299.110) -- 0:00:11
933500 -- (-1303.334) (-1301.328) [-1295.954] (-1299.874) * (-1295.903) (-1296.029) (-1302.691) [-1299.286] -- 0:00:11
934000 -- [-1296.170] (-1299.970) (-1299.944) (-1296.222) * [-1297.059] (-1303.751) (-1303.254) (-1294.783) -- 0:00:11
934500 -- [-1295.705] (-1303.564) (-1300.365) (-1299.748) * (-1296.721) (-1299.102) (-1305.920) [-1297.569] -- 0:00:11
935000 -- [-1297.679] (-1303.493) (-1298.164) (-1301.708) * (-1295.876) [-1299.122] (-1298.236) (-1295.937) -- 0:00:11
Average standard deviation of split frequencies: 0.000252
935500 -- (-1299.744) (-1302.937) (-1294.822) [-1301.764] * (-1305.919) [-1295.738] (-1297.728) (-1304.210) -- 0:00:11
936000 -- [-1302.451] (-1299.627) (-1294.965) (-1294.422) * (-1300.388) (-1302.519) (-1299.489) [-1297.038] -- 0:00:11
936500 -- [-1297.167] (-1299.382) (-1295.599) (-1301.464) * (-1297.441) [-1300.048] (-1297.632) (-1299.069) -- 0:00:10
937000 -- (-1297.545) [-1295.296] (-1298.577) (-1296.783) * (-1297.529) (-1303.681) (-1301.743) [-1298.078] -- 0:00:10
937500 -- (-1294.739) [-1295.874] (-1293.722) (-1298.616) * (-1301.192) (-1296.291) (-1297.388) [-1296.338] -- 0:00:10
938000 -- [-1293.898] (-1302.947) (-1297.966) (-1303.333) * (-1293.368) (-1298.284) (-1302.152) [-1297.584] -- 0:00:10
938500 -- (-1308.890) (-1293.499) [-1300.134] (-1298.569) * (-1302.406) (-1295.052) (-1299.093) [-1295.743] -- 0:00:10
939000 -- [-1298.512] (-1295.659) (-1297.946) (-1297.059) * [-1297.256] (-1296.070) (-1295.621) (-1299.881) -- 0:00:10
939500 -- (-1300.770) [-1296.683] (-1302.616) (-1302.254) * (-1296.368) [-1296.253] (-1298.540) (-1298.888) -- 0:00:10
940000 -- (-1305.400) (-1301.744) (-1292.697) [-1292.415] * [-1296.770] (-1302.608) (-1299.807) (-1306.730) -- 0:00:10
Average standard deviation of split frequencies: 0.000251
940500 -- [-1294.380] (-1301.120) (-1296.210) (-1299.320) * (-1294.667) [-1296.291] (-1294.139) (-1300.193) -- 0:00:10
941000 -- (-1301.726) (-1294.782) [-1295.936] (-1298.952) * (-1301.363) (-1306.805) [-1299.201] (-1301.015) -- 0:00:10
941500 -- (-1300.325) (-1297.118) [-1299.202] (-1299.408) * (-1294.411) [-1297.700] (-1296.424) (-1294.493) -- 0:00:10
942000 -- (-1296.666) (-1295.342) [-1297.682] (-1303.515) * (-1299.570) [-1302.404] (-1302.195) (-1298.596) -- 0:00:09
942500 -- (-1297.067) (-1299.365) (-1299.351) [-1298.502] * (-1309.103) [-1295.801] (-1301.654) (-1298.804) -- 0:00:09
943000 -- (-1301.394) (-1297.629) (-1300.084) [-1299.794] * (-1300.686) (-1296.646) [-1297.673] (-1300.167) -- 0:00:09
943500 -- (-1306.098) (-1299.435) [-1297.416] (-1292.179) * (-1306.693) [-1295.503] (-1296.555) (-1300.701) -- 0:00:09
944000 -- (-1294.019) (-1308.343) (-1300.090) [-1297.548] * (-1300.484) (-1300.277) (-1302.832) [-1301.162] -- 0:00:09
944500 -- (-1301.115) (-1297.014) (-1297.849) [-1298.699] * [-1297.873] (-1293.612) (-1305.361) (-1309.437) -- 0:00:09
945000 -- (-1301.322) (-1299.918) (-1298.331) [-1297.856] * (-1298.395) (-1293.865) (-1298.900) [-1298.236] -- 0:00:09
Average standard deviation of split frequencies: 0.000249
945500 -- (-1298.304) (-1300.181) [-1295.473] (-1305.110) * (-1297.629) (-1298.657) (-1300.531) [-1298.900] -- 0:00:09
946000 -- (-1299.285) [-1298.316] (-1301.301) (-1302.997) * [-1297.304] (-1293.903) (-1297.250) (-1295.128) -- 0:00:09
946500 -- (-1306.653) (-1300.214) (-1306.787) [-1301.036] * [-1299.373] (-1299.210) (-1300.007) (-1296.597) -- 0:00:09
947000 -- (-1299.943) [-1298.562] (-1294.650) (-1294.083) * (-1300.418) [-1293.528] (-1301.106) (-1297.166) -- 0:00:09
947500 -- (-1294.018) (-1297.688) [-1299.476] (-1299.938) * (-1302.279) [-1298.182] (-1308.561) (-1298.073) -- 0:00:09
948000 -- (-1301.569) (-1300.898) (-1299.901) [-1296.913] * (-1302.795) (-1299.665) (-1302.730) [-1298.895] -- 0:00:08
948500 -- [-1297.414] (-1308.207) (-1294.339) (-1298.462) * (-1297.419) (-1299.933) [-1298.890] (-1299.147) -- 0:00:08
949000 -- (-1297.486) (-1306.468) [-1303.879] (-1294.823) * (-1299.348) [-1304.652] (-1295.125) (-1301.399) -- 0:00:08
949500 -- (-1302.844) (-1301.469) [-1294.132] (-1300.059) * (-1302.021) [-1303.986] (-1294.156) (-1301.153) -- 0:00:08
950000 -- (-1300.406) (-1296.118) [-1293.977] (-1295.943) * (-1296.000) [-1296.662] (-1294.941) (-1300.896) -- 0:00:08
Average standard deviation of split frequencies: 0.000496
950500 -- (-1305.783) [-1297.360] (-1301.650) (-1301.694) * (-1300.666) (-1296.286) (-1297.980) [-1298.044] -- 0:00:08
951000 -- (-1297.787) (-1296.378) (-1296.593) [-1297.443] * [-1296.244] (-1304.223) (-1299.888) (-1299.288) -- 0:00:08
951500 -- (-1295.553) (-1298.186) [-1294.497] (-1301.314) * (-1299.973) [-1298.230] (-1296.810) (-1305.114) -- 0:00:08
952000 -- (-1301.548) (-1298.804) [-1304.569] (-1299.642) * [-1296.411] (-1296.323) (-1303.943) (-1296.262) -- 0:00:08
952500 -- (-1296.889) (-1296.324) [-1297.788] (-1299.858) * (-1293.704) (-1302.026) [-1298.256] (-1300.889) -- 0:00:08
953000 -- [-1297.271] (-1300.314) (-1301.093) (-1298.498) * [-1293.334] (-1302.945) (-1296.344) (-1295.187) -- 0:00:08
953500 -- (-1299.833) (-1296.392) (-1301.094) [-1303.249] * [-1295.931] (-1294.829) (-1302.352) (-1296.896) -- 0:00:07
954000 -- (-1302.999) (-1300.340) (-1303.695) [-1296.809] * [-1297.776] (-1297.175) (-1296.982) (-1298.936) -- 0:00:07
954500 -- (-1299.329) (-1298.620) (-1304.670) [-1302.228] * (-1300.009) [-1299.423] (-1297.695) (-1306.048) -- 0:00:07
955000 -- (-1297.889) [-1308.130] (-1296.945) (-1299.356) * (-1293.670) (-1301.120) [-1298.750] (-1300.552) -- 0:00:07
Average standard deviation of split frequencies: 0.000493
955500 -- (-1300.226) (-1302.840) (-1304.282) [-1297.429] * (-1297.022) (-1304.249) [-1299.522] (-1300.893) -- 0:00:07
956000 -- (-1296.666) [-1307.485] (-1302.369) (-1295.400) * (-1299.841) (-1299.574) (-1295.004) [-1295.603] -- 0:00:07
956500 -- [-1299.177] (-1306.692) (-1296.319) (-1293.974) * (-1297.536) (-1294.215) (-1302.994) [-1290.824] -- 0:00:07
957000 -- (-1302.036) (-1301.848) [-1301.585] (-1294.844) * (-1295.258) [-1296.996] (-1302.517) (-1298.024) -- 0:00:07
957500 -- (-1302.732) (-1295.428) [-1299.548] (-1296.654) * (-1303.530) (-1302.996) (-1299.570) [-1302.387] -- 0:00:07
958000 -- (-1299.388) [-1299.762] (-1303.245) (-1294.398) * (-1302.529) (-1295.636) (-1297.847) [-1296.354] -- 0:00:07
958500 -- (-1294.776) [-1299.006] (-1299.864) (-1307.399) * (-1301.197) (-1302.695) [-1295.671] (-1298.976) -- 0:00:07
959000 -- (-1299.001) (-1296.202) [-1296.620] (-1300.219) * [-1297.697] (-1296.199) (-1300.751) (-1300.264) -- 0:00:07
959500 -- (-1302.984) (-1293.569) [-1296.212] (-1296.626) * [-1294.705] (-1297.587) (-1297.935) (-1296.045) -- 0:00:06
960000 -- (-1301.403) (-1304.534) (-1297.149) [-1299.203] * (-1301.687) [-1295.448] (-1297.637) (-1295.664) -- 0:00:06
Average standard deviation of split frequencies: 0.000491
960500 -- (-1301.402) (-1296.472) (-1298.849) [-1297.640] * (-1297.454) [-1296.648] (-1303.672) (-1305.903) -- 0:00:06
961000 -- [-1295.586] (-1296.149) (-1298.468) (-1301.722) * (-1294.509) [-1295.410] (-1300.504) (-1297.701) -- 0:00:06
961500 -- (-1294.824) [-1299.246] (-1299.255) (-1294.280) * (-1306.678) (-1296.583) [-1294.290] (-1297.567) -- 0:00:06
962000 -- (-1302.854) (-1296.002) (-1299.896) [-1295.101] * (-1297.552) (-1306.915) (-1299.903) [-1296.257] -- 0:00:06
962500 -- [-1295.402] (-1298.760) (-1297.639) (-1304.655) * (-1297.931) (-1301.414) (-1297.710) [-1297.333] -- 0:00:06
963000 -- [-1298.423] (-1296.272) (-1299.011) (-1294.350) * (-1293.174) [-1309.876] (-1301.084) (-1305.585) -- 0:00:06
963500 -- (-1299.640) (-1295.863) (-1299.272) [-1293.250] * (-1294.813) (-1308.015) [-1295.735] (-1296.734) -- 0:00:06
964000 -- (-1304.892) [-1295.296] (-1303.000) (-1307.579) * (-1301.497) [-1302.510] (-1293.816) (-1298.629) -- 0:00:06
964500 -- (-1297.331) [-1302.489] (-1297.168) (-1303.089) * (-1300.200) (-1302.897) [-1293.193] (-1298.595) -- 0:00:06
965000 -- (-1300.934) (-1297.011) (-1306.031) [-1299.361] * [-1300.802] (-1297.237) (-1298.787) (-1300.291) -- 0:00:06
Average standard deviation of split frequencies: 0.000488
965500 -- [-1299.768] (-1295.062) (-1300.942) (-1300.223) * [-1294.994] (-1301.082) (-1301.648) (-1298.677) -- 0:00:05
966000 -- (-1297.313) [-1300.894] (-1299.797) (-1297.547) * (-1299.483) (-1301.609) (-1296.394) [-1301.582] -- 0:00:05
966500 -- (-1304.749) [-1294.798] (-1298.054) (-1295.103) * (-1305.494) (-1302.000) (-1301.740) [-1299.996] -- 0:00:05
967000 -- (-1302.999) [-1299.571] (-1302.157) (-1298.525) * [-1298.979] (-1311.028) (-1299.979) (-1300.174) -- 0:00:05
967500 -- (-1303.676) [-1295.920] (-1297.204) (-1297.272) * [-1297.219] (-1311.612) (-1296.561) (-1303.909) -- 0:00:05
968000 -- [-1303.168] (-1301.683) (-1296.437) (-1297.425) * [-1296.106] (-1303.992) (-1296.824) (-1298.081) -- 0:00:05
968500 -- (-1310.926) [-1296.966] (-1301.741) (-1309.036) * (-1299.083) (-1296.401) [-1301.393] (-1300.472) -- 0:00:05
969000 -- (-1300.963) (-1302.529) [-1297.978] (-1306.293) * (-1297.688) (-1300.854) (-1306.927) [-1295.641] -- 0:00:05
969500 -- (-1295.845) (-1296.855) [-1297.551] (-1308.148) * (-1300.399) [-1298.265] (-1300.377) (-1300.482) -- 0:00:05
970000 -- (-1299.131) [-1299.042] (-1296.036) (-1300.401) * (-1300.232) (-1304.141) (-1293.577) [-1304.793] -- 0:00:05
Average standard deviation of split frequencies: 0.000486
970500 -- [-1297.666] (-1293.859) (-1302.276) (-1298.386) * (-1295.636) [-1297.901] (-1299.340) (-1301.832) -- 0:00:05
971000 -- (-1299.032) [-1297.703] (-1306.852) (-1295.932) * [-1298.539] (-1298.898) (-1301.518) (-1295.992) -- 0:00:04
971500 -- (-1302.624) (-1301.433) [-1297.406] (-1296.716) * (-1297.651) (-1308.547) [-1300.392] (-1292.752) -- 0:00:04
972000 -- [-1299.367] (-1296.705) (-1298.916) (-1297.428) * (-1298.683) (-1298.874) (-1300.308) [-1294.366] -- 0:00:04
972500 -- (-1304.407) (-1302.800) [-1298.547] (-1298.010) * (-1297.109) (-1294.923) [-1296.489] (-1300.913) -- 0:00:04
973000 -- (-1303.372) (-1297.147) (-1302.802) [-1296.151] * (-1295.924) [-1304.616] (-1299.464) (-1304.096) -- 0:00:04
973500 -- (-1296.900) (-1304.770) [-1301.888] (-1295.061) * [-1298.365] (-1299.381) (-1298.949) (-1303.951) -- 0:00:04
974000 -- [-1294.979] (-1301.905) (-1301.062) (-1299.061) * [-1298.026] (-1303.721) (-1301.389) (-1303.981) -- 0:00:04
974500 -- (-1297.322) [-1300.450] (-1296.556) (-1304.086) * [-1297.663] (-1300.693) (-1301.455) (-1312.228) -- 0:00:04
975000 -- (-1307.774) (-1303.487) (-1295.068) [-1295.004] * [-1298.224] (-1302.134) (-1300.990) (-1296.896) -- 0:00:04
Average standard deviation of split frequencies: 0.000483
975500 -- (-1296.439) (-1299.794) [-1295.337] (-1297.483) * (-1297.529) [-1300.653] (-1309.742) (-1296.212) -- 0:00:04
976000 -- (-1295.529) (-1301.818) (-1301.630) [-1295.976] * (-1301.009) (-1297.083) (-1295.854) [-1297.823] -- 0:00:04
976500 -- [-1295.467] (-1298.189) (-1310.215) (-1300.584) * [-1297.133] (-1298.325) (-1297.447) (-1301.665) -- 0:00:04
977000 -- [-1296.997] (-1296.851) (-1304.696) (-1300.307) * (-1304.283) [-1295.715] (-1294.612) (-1300.569) -- 0:00:03
977500 -- (-1302.977) (-1303.083) [-1302.516] (-1304.163) * (-1302.973) (-1298.996) [-1297.603] (-1296.358) -- 0:00:03
978000 -- (-1301.708) (-1303.403) [-1301.075] (-1296.372) * (-1297.428) (-1303.374) [-1298.418] (-1300.139) -- 0:00:03
978500 -- (-1298.839) [-1296.358] (-1302.866) (-1293.893) * [-1293.902] (-1296.182) (-1299.443) (-1299.549) -- 0:00:03
979000 -- (-1297.327) (-1297.844) [-1295.737] (-1293.223) * (-1299.731) (-1297.838) [-1298.068] (-1296.706) -- 0:00:03
979500 -- (-1301.896) (-1293.448) (-1299.135) [-1293.841] * (-1298.442) (-1302.157) (-1298.613) [-1296.748] -- 0:00:03
980000 -- [-1299.615] (-1297.233) (-1297.522) (-1302.129) * (-1298.167) (-1303.135) (-1295.615) [-1298.460] -- 0:00:03
Average standard deviation of split frequencies: 0.000481
980500 -- (-1301.597) (-1301.606) [-1297.022] (-1308.385) * (-1294.116) (-1298.043) (-1297.403) [-1298.648] -- 0:00:03
981000 -- [-1299.927] (-1294.820) (-1303.358) (-1301.134) * (-1307.619) (-1299.498) [-1296.596] (-1301.336) -- 0:00:03
981500 -- [-1298.854] (-1300.615) (-1298.160) (-1300.541) * [-1300.835] (-1298.580) (-1300.959) (-1303.888) -- 0:00:03
982000 -- (-1301.676) (-1299.186) [-1299.814] (-1299.104) * [-1303.728] (-1300.097) (-1297.433) (-1290.889) -- 0:00:03
982500 -- (-1296.193) (-1297.454) (-1301.067) [-1293.400] * [-1302.632] (-1299.564) (-1296.053) (-1294.940) -- 0:00:03
983000 -- (-1301.266) (-1304.245) [-1299.957] (-1299.225) * (-1307.739) (-1301.454) [-1296.292] (-1297.977) -- 0:00:02
983500 -- (-1294.569) [-1302.991] (-1302.150) (-1305.211) * (-1301.003) (-1300.042) (-1296.617) [-1303.007] -- 0:00:02
984000 -- (-1296.095) [-1298.338] (-1307.058) (-1300.718) * (-1306.228) (-1295.631) (-1304.530) [-1300.780] -- 0:00:02
984500 -- [-1294.766] (-1303.593) (-1301.084) (-1298.876) * [-1299.104] (-1297.040) (-1301.063) (-1302.865) -- 0:00:02
985000 -- [-1297.717] (-1302.330) (-1298.478) (-1297.888) * (-1297.821) (-1299.518) (-1295.844) [-1300.059] -- 0:00:02
Average standard deviation of split frequencies: 0.000478
985500 -- (-1297.038) (-1302.626) (-1308.115) [-1301.497] * (-1299.071) (-1300.634) (-1303.521) [-1296.367] -- 0:00:02
986000 -- (-1309.500) (-1303.152) (-1300.527) [-1300.217] * (-1293.879) (-1305.406) (-1300.509) [-1296.361] -- 0:00:02
986500 -- (-1298.149) (-1299.999) (-1298.854) [-1294.807] * (-1300.910) (-1301.247) (-1297.581) [-1292.203] -- 0:00:02
987000 -- (-1300.830) (-1302.795) (-1307.855) [-1296.262] * (-1303.266) [-1300.506] (-1297.888) (-1294.938) -- 0:00:02
987500 -- (-1297.189) (-1303.580) (-1306.557) [-1298.628] * (-1298.000) (-1297.922) (-1303.236) [-1299.734] -- 0:00:02
988000 -- (-1296.798) (-1294.970) (-1301.818) [-1300.336] * (-1304.299) [-1297.885] (-1298.124) (-1302.246) -- 0:00:02
988500 -- (-1298.966) (-1296.701) (-1298.247) [-1294.385] * (-1299.091) [-1294.704] (-1297.219) (-1302.460) -- 0:00:01
989000 -- (-1302.031) (-1295.560) (-1308.226) [-1297.737] * (-1305.960) [-1295.651] (-1297.179) (-1298.755) -- 0:00:01
989500 -- (-1300.340) (-1300.474) (-1298.529) [-1295.386] * (-1300.386) [-1295.872] (-1298.784) (-1292.378) -- 0:00:01
990000 -- [-1296.717] (-1301.599) (-1301.204) (-1293.102) * [-1301.120] (-1300.908) (-1307.363) (-1298.848) -- 0:00:01
Average standard deviation of split frequencies: 0.000476
990500 -- (-1300.204) (-1296.739) (-1304.963) [-1296.461] * (-1301.528) (-1294.996) [-1298.560] (-1308.087) -- 0:00:01
991000 -- (-1303.001) [-1295.752] (-1303.416) (-1300.508) * (-1296.113) [-1293.402] (-1298.950) (-1299.401) -- 0:00:01
991500 -- (-1304.930) [-1302.473] (-1302.033) (-1302.491) * (-1304.460) [-1297.432] (-1306.472) (-1294.150) -- 0:00:01
992000 -- [-1301.437] (-1304.349) (-1298.166) (-1294.719) * [-1303.876] (-1299.970) (-1311.059) (-1304.329) -- 0:00:01
992500 -- (-1296.274) (-1298.376) (-1300.607) [-1296.833] * [-1300.779] (-1300.334) (-1301.414) (-1305.688) -- 0:00:01
993000 -- (-1299.949) [-1295.968] (-1297.466) (-1298.780) * (-1298.276) [-1295.691] (-1301.925) (-1303.990) -- 0:00:01
993500 -- (-1298.335) [-1295.011] (-1302.949) (-1305.349) * (-1304.130) (-1299.343) (-1292.950) [-1298.908] -- 0:00:01
994000 -- (-1299.194) [-1297.876] (-1299.985) (-1300.002) * [-1293.439] (-1300.679) (-1304.167) (-1295.154) -- 0:00:01
994500 -- (-1305.973) (-1297.251) (-1299.422) [-1297.468] * (-1292.426) (-1298.139) (-1303.259) [-1294.796] -- 0:00:00
995000 -- (-1301.441) (-1296.618) [-1299.080] (-1300.186) * (-1299.786) [-1296.266] (-1304.936) (-1293.749) -- 0:00:00
Average standard deviation of split frequencies: 0.000473
995500 -- [-1297.142] (-1300.436) (-1297.106) (-1303.273) * (-1302.634) (-1298.704) (-1301.326) [-1297.380] -- 0:00:00
996000 -- (-1296.699) (-1296.593) [-1302.528] (-1295.113) * (-1303.128) [-1296.454] (-1309.933) (-1296.153) -- 0:00:00
996500 -- [-1300.577] (-1307.159) (-1298.604) (-1303.673) * (-1300.363) (-1297.366) [-1303.440] (-1299.613) -- 0:00:00
997000 -- (-1298.518) [-1294.205] (-1296.405) (-1305.388) * (-1298.029) (-1295.810) [-1305.182] (-1303.996) -- 0:00:00
997500 -- (-1300.870) (-1295.568) [-1301.151] (-1306.183) * [-1295.016] (-1300.708) (-1296.591) (-1303.386) -- 0:00:00
998000 -- (-1297.392) (-1301.615) (-1301.807) [-1301.925] * (-1295.177) [-1300.704] (-1300.361) (-1308.763) -- 0:00:00
998500 -- [-1295.273] (-1301.101) (-1302.813) (-1300.344) * [-1295.148] (-1297.158) (-1299.570) (-1299.140) -- 0:00:00
999000 -- (-1295.851) [-1297.591] (-1296.086) (-1308.158) * (-1299.557) (-1296.182) [-1300.726] (-1307.330) -- 0:00:00
999500 -- [-1297.052] (-1292.499) (-1303.059) (-1298.769) * [-1296.745] (-1296.501) (-1306.336) (-1307.212) -- 0:00:00
1000000 -- (-1293.648) [-1302.287] (-1295.473) (-1299.158) * (-1303.774) (-1293.967) [-1297.606] (-1300.736) -- 0:00:00
Average standard deviation of split frequencies: 0.000471
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1293.647665 -- 14.083239
Chain 1 -- -1293.647665 -- 14.083239
Chain 2 -- -1302.287144 -- 17.266918
Chain 2 -- -1302.287144 -- 17.266918
Chain 3 -- -1295.473023 -- 14.090501
Chain 3 -- -1295.473023 -- 14.090501
Chain 4 -- -1299.157731 -- 14.960748
Chain 4 -- -1299.157731 -- 14.960748
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1303.773707 -- 16.744564
Chain 1 -- -1303.773707 -- 16.744564
Chain 2 -- -1293.967110 -- 14.054847
Chain 2 -- -1293.967109 -- 14.054847
Chain 3 -- -1297.606307 -- 14.062025
Chain 3 -- -1297.606307 -- 14.062025
Chain 4 -- -1300.736187 -- 14.674280
Chain 4 -- -1300.736187 -- 14.674280
Analysis completed in 2 mins 52 seconds
Analysis used 172.13 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1289.27
Likelihood of best state for "cold" chain of run 2 was -1289.28
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
61.3 % ( 59 %) Dirichlet(Revmat{all})
75.5 % ( 70 %) Slider(Revmat{all})
27.9 % ( 32 %) Dirichlet(Pi{all})
30.1 % ( 23 %) Slider(Pi{all})
67.6 % ( 37 %) Multiplier(Alpha{1,2})
50.4 % ( 28 %) Multiplier(Alpha{3})
68.0 % ( 46 %) Slider(Pinvar{all})
0.4 % ( 0 %) ExtSPR(Tau{all},V{all})
0.4 % ( 0 %) ExtTBR(Tau{all},V{all})
0.4 % ( 0 %) NNI(Tau{all},V{all})
0.5 % ( 0 %) ParsSPR(Tau{all},V{all})
26.5 % ( 26 %) Multiplier(V{all})
31.9 % ( 31 %) Nodeslider(V{all})
26.2 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.4 % ( 48 %) Dirichlet(Revmat{all})
75.4 % ( 55 %) Slider(Revmat{all})
28.8 % ( 22 %) Dirichlet(Pi{all})
30.3 % ( 26 %) Slider(Pi{all})
67.6 % ( 43 %) Multiplier(Alpha{1,2})
50.9 % ( 32 %) Multiplier(Alpha{3})
67.5 % ( 43 %) Slider(Pinvar{all})
0.4 % ( 0 %) ExtSPR(Tau{all},V{all})
0.4 % ( 3 %) ExtTBR(Tau{all},V{all})
0.3 % ( 0 %) NNI(Tau{all},V{all})
0.5 % ( 1 %) ParsSPR(Tau{all},V{all})
26.4 % ( 29 %) Multiplier(V{all})
31.9 % ( 33 %) Nodeslider(V{all})
26.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.56
2 | 166606 0.85 0.71
3 | 166811 166392 0.86
4 | 166564 166755 166872
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.56
2 | 167108 0.84 0.71
3 | 166419 166938 0.86
4 | 166725 166531 166279
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1296.44
| 2 |
| 2 * 2 2 1 2 |
| 2 1 1 2 2 1 |
| 1 1 1 2 * 1 22 |
| 21 2 2 1 122 1 |
| 1 1 2 1 12 1 2 1 2 1 2 2 2 121 1 |
| 1 2 2 1 2 2 2 1 1 12 2|
| 1* 2 1 2 1211 1 1 1 2 1 1 2 1 1|
|2 2 11 22 * 1 12 1 2 |
|1 1 2 2 2 2 |
| 2 2 1 2 1 2 1 1 |
| 1 2 12 |
| 2 2 1 1 1 |
| 1 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1299.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1295.12 -1304.58
2 -1295.03 -1303.97
--------------------------------------
TOTAL -1295.07 -1304.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.297719 0.003618 0.199934 0.423979 0.290921 1026.77 1061.17 1.000
r(A<->C){all} 0.047299 0.000950 0.000143 0.102876 0.042430 428.51 647.53 1.000
r(A<->G){all} 0.200959 0.003074 0.097556 0.305210 0.196925 420.49 517.88 1.000
r(A<->T){all} 0.127565 0.001420 0.060654 0.201857 0.124383 881.45 951.96 1.000
r(C<->G){all} 0.086777 0.001632 0.020755 0.170239 0.081863 793.70 846.63 1.000
r(C<->T){all} 0.463522 0.006016 0.315705 0.617108 0.463273 573.90 634.31 1.000
r(G<->T){all} 0.073878 0.001112 0.013002 0.139985 0.070200 683.94 817.56 1.000
pi(A){all} 0.291690 0.000325 0.258985 0.328770 0.291633 1348.36 1402.75 1.000
pi(C){all} 0.189153 0.000218 0.160937 0.218724 0.188776 1366.36 1387.27 1.000
pi(G){all} 0.221292 0.000255 0.192169 0.254741 0.221193 1237.29 1369.15 1.000
pi(T){all} 0.297866 0.000313 0.261829 0.331793 0.297472 1215.58 1308.40 1.000
alpha{1,2} 0.062092 0.002363 0.000135 0.153387 0.052750 1402.60 1406.33 1.000
alpha{3} 1.792035 0.578672 0.590664 3.339903 1.656158 1198.90 1275.82 1.001
pinvar{all} 0.388731 0.014175 0.129530 0.593832 0.402546 1141.46 1257.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2986 0.994670 0.000942 0.994004 0.995336 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.020406 0.000094 0.004392 0.039598 0.018872 1.000 2
length{all}[2] 0.006412 0.000016 0.000338 0.014366 0.005598 1.000 2
length{all}[3] 0.004393 0.000011 0.000006 0.010665 0.003576 1.001 2
length{all}[4] 0.073201 0.000578 0.032936 0.120192 0.069637 1.000 2
length{all}[5] 0.064831 0.000493 0.028886 0.109894 0.061804 1.000 2
length{all}[6] 0.104540 0.001142 0.048759 0.173918 0.098678 1.000 2
length{all}[7] 0.024041 0.000101 0.006112 0.043894 0.022986 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000471
Maximum standard deviation of split frequencies = 0.000942
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------99----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
| /------------------------------ C4 (4)
|-----------------------------------------+
+ \--------------------------- C5 (5)
|
| /-- C2 (2)
\---------+
\- C3 (3)
|-------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 606
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
2 sites are removed. 162 202
Sequences read..
Counting site patterns.. 0:00
117 patterns at 200 / 200 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
114192 bytes for conP
15912 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 85
171288 bytes for conP, adjusted
0.036548 0.153582 0.125080 0.112977 0.048309 0.005932 0.009276 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1334.790041
Iterating by ming2
Initial: fx= 1334.790041
x= 0.03655 0.15358 0.12508 0.11298 0.04831 0.00593 0.00928 0.30000 1.30000
1 h-m-p 0.0000 0.0002 158.8866 +YCYYCCC 1333.332266 6 0.0001 25 | 0/9
2 h-m-p 0.0001 0.0012 326.1194 +YCCC 1326.619402 3 0.0005 43 | 0/9
3 h-m-p 0.0001 0.0007 608.8184 +CYYCCC 1299.934779 5 0.0006 65 | 0/9
4 h-m-p 0.0002 0.0010 193.4664 YCYCCC 1295.318149 5 0.0005 85 | 0/9
5 h-m-p 0.0001 0.0003 160.6335 +YYCCCC 1293.964952 5 0.0002 106 | 0/9
6 h-m-p 0.0001 0.0055 240.2138 YCCC 1292.410469 3 0.0003 123 | 0/9
7 h-m-p 0.0004 0.0068 146.4365 +CYYCYYYYYY 1236.936069 10 0.0062 148 | 0/9
8 h-m-p 0.0000 0.0002 428.9047 YYYC 1236.554334 3 0.0000 163 | 0/9
9 h-m-p 0.0146 0.2298 1.0952 +YC 1235.747917 1 0.0365 177 | 0/9
10 h-m-p 0.0028 0.0301 14.5151 +YCCC 1229.837494 3 0.0069 195 | 0/9
11 h-m-p 0.2264 1.1321 0.0842 YCYCCC 1227.823984 5 0.5736 215 | 0/9
12 h-m-p 0.4700 8.0000 0.1028 +CCCCC 1225.728294 4 2.0665 245 | 0/9
13 h-m-p 1.3775 6.8874 0.1062 YCC 1224.266148 2 3.1030 269 | 0/9
14 h-m-p 1.6000 8.0000 0.0902 CYC 1223.895007 2 1.6714 293 | 0/9
15 h-m-p 1.6000 8.0000 0.0841 CY 1223.724031 1 1.5872 316 | 0/9
16 h-m-p 1.6000 8.0000 0.0260 YCC 1223.707450 2 1.0424 340 | 0/9
17 h-m-p 1.6000 8.0000 0.0081 YC 1223.700032 1 2.6504 362 | 0/9
18 h-m-p 1.6000 8.0000 0.0012 CC 1223.694990 1 2.1606 385 | 0/9
19 h-m-p 0.9549 8.0000 0.0027 CC 1223.692879 1 1.2493 408 | 0/9
20 h-m-p 1.6000 8.0000 0.0004 C 1223.692777 0 1.4336 429 | 0/9
21 h-m-p 0.5890 8.0000 0.0009 Y 1223.692770 0 1.4213 450 | 0/9
22 h-m-p 1.6000 8.0000 0.0001 Y 1223.692769 0 1.0708 471 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 C 1223.692769 0 1.4857 492 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 -C 1223.692769 0 0.1000 514 | 0/9
25 h-m-p 0.0747 8.0000 0.0000 Y 1223.692769 0 0.0747 535 | 0/9
26 h-m-p 0.1157 8.0000 0.0000 ---------------.. | 0/9
27 h-m-p 0.0160 8.0000 0.0005 --C 1223.692769 0 0.0003 592 | 0/9
28 h-m-p 0.0160 8.0000 0.0007 ----C 1223.692769 0 0.0000 617
Out..
lnL = -1223.692769
618 lfun, 618 eigenQcodon, 4326 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 85
0.036548 0.153582 0.125080 0.112977 0.048309 0.005932 0.009276 1.933354 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.855892
np = 10
lnL0 = -1263.028684
Iterating by ming2
Initial: fx= 1263.028684
x= 0.03655 0.15358 0.12508 0.11298 0.04831 0.00593 0.00928 1.93335 0.57321 0.49224
1 h-m-p 0.0000 0.0002 116.5466 +CCC 1262.664073 2 0.0001 20 | 0/10
2 h-m-p 0.0001 0.0003 63.9419 YCYCCC 1262.409648 5 0.0001 41 | 0/10
3 h-m-p 0.0000 0.0017 363.3563 +++YYYYYCC 1239.291918 6 0.0014 64 | 0/10
4 h-m-p 0.0000 0.0000 2095.8630 CYCCC 1238.176138 4 0.0000 84 | 0/10
5 h-m-p 0.0019 0.0094 10.7998 CYC 1238.057418 2 0.0017 100 | 0/10
6 h-m-p 0.0003 0.0015 53.5734 YCCCC 1237.851972 4 0.0006 120 | 0/10
7 h-m-p 0.0007 0.0033 19.6160 CC 1237.784609 1 0.0007 135 | 0/10
8 h-m-p 0.0024 0.1433 5.3177 ++YCC 1237.018613 2 0.0243 153 | 0/10
9 h-m-p 0.0006 0.0109 208.5089 +YCCCC 1230.627144 4 0.0055 174 | 0/10
10 h-m-p 0.0003 0.0013 277.3624 CCCC 1230.179605 3 0.0003 193 | 0/10
11 h-m-p 0.0490 0.8696 1.5242 +++ 1225.516792 m 0.8696 207 | 0/10
12 h-m-p 0.3819 1.9093 1.0609 YCCC 1224.526523 3 0.2460 225 | 0/10
13 h-m-p 0.5707 8.0000 0.4573 YCCC 1223.879968 3 0.9458 243 | 0/10
14 h-m-p 1.1264 5.6320 0.2063 YYC 1223.472099 2 0.8678 268 | 0/10
15 h-m-p 1.1573 5.7866 0.0887 YCC 1223.371622 2 0.8438 294 | 0/10
16 h-m-p 1.6000 8.0000 0.0113 CC 1223.338517 1 2.3439 319 | 0/10
17 h-m-p 1.6000 8.0000 0.0100 YC 1223.327587 1 0.9504 343 | 0/10
18 h-m-p 0.8887 8.0000 0.0107 YC 1223.323308 1 1.5101 367 | 0/10
19 h-m-p 1.6000 8.0000 0.0024 C 1223.323125 0 1.3090 390 | 0/10
20 h-m-p 1.6000 8.0000 0.0004 C 1223.323120 0 1.4169 413 | 0/10
21 h-m-p 1.6000 8.0000 0.0001 C 1223.323119 0 1.4243 436 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 C 1223.323119 0 1.4804 459 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 C 1223.323119 0 1.7909 482 | 0/10
24 h-m-p 1.6000 8.0000 0.0000 -------------C 1223.323119 0 0.0000 518
Out..
lnL = -1223.323119
519 lfun, 1557 eigenQcodon, 7266 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 85
initial w for M2:NSpselection reset.
0.036548 0.153582 0.125080 0.112977 0.048309 0.005932 0.009276 1.955570 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.578793
np = 12
lnL0 = -1273.735905
Iterating by ming2
Initial: fx= 1273.735905
x= 0.03655 0.15358 0.12508 0.11298 0.04831 0.00593 0.00928 1.95557 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0002 122.7737 +YYCC 1273.374438 3 0.0001 22 | 0/12
2 h-m-p 0.0001 0.0003 57.7314 CYCCC 1273.183908 4 0.0001 44 | 0/12
3 h-m-p 0.0000 0.0031 189.7868 ++++ 1267.910298 m 0.0031 61 | 1/12
4 h-m-p 0.0060 0.0302 37.9398 CCC 1265.900043 2 0.0057 80 | 1/12
5 h-m-p 0.0056 0.0282 28.4439 YCCC 1263.373576 3 0.0115 100 | 0/12
6 h-m-p 0.0004 0.0021 225.3544 YCCC 1263.102383 3 0.0003 120 | 0/12
7 h-m-p 0.0023 0.0117 26.0914 +YCCC 1261.971793 3 0.0073 141 | 0/12
8 h-m-p 0.0066 0.0329 18.3728 CCCCC 1261.130545 4 0.0080 164 | 0/12
9 h-m-p 0.0085 0.0566 17.1110 ++ 1255.552088 m 0.0566 179 | 1/12
10 h-m-p 0.0005 0.0023 207.1880 ++ 1251.516103 m 0.0023 194 | 2/12
11 h-m-p 0.0419 0.2093 5.2005 +YYYCCC 1238.433993 5 0.1583 217 | 2/12
12 h-m-p 0.0186 0.0928 1.6533 CYCCC 1237.109657 4 0.0336 239 | 2/12
13 h-m-p 0.0165 0.9376 3.3801 ++CCCCC 1230.726121 4 0.3283 264 | 1/12
14 h-m-p 0.0088 0.0441 57.3469 -YCCC 1230.644254 3 0.0010 285 | 1/12
15 h-m-p 0.0109 0.5014 5.3549 ++YYYCC 1226.695608 4 0.1525 307 | 1/12
16 h-m-p 0.5244 8.0000 1.5574 CYCCC 1225.491740 4 0.3853 329 | 1/12
17 h-m-p 0.6400 3.2001 0.2479 YCCCC 1224.333237 4 1.6007 351 | 1/12
18 h-m-p 0.8297 8.0000 0.4783 YCCC 1224.061202 3 0.3935 382 | 1/12
19 h-m-p 0.5468 5.2949 0.3442 CCC 1223.827236 2 0.6912 412 | 1/12
20 h-m-p 0.6976 6.7016 0.3410 CCC 1223.588296 2 0.7148 442 | 1/12
21 h-m-p 1.3478 8.0000 0.1809 YCC 1223.408538 2 1.0973 471 | 1/12
22 h-m-p 1.1528 6.0055 0.1721 CYC 1223.348687 2 1.0022 500 | 1/12
23 h-m-p 1.6000 8.0000 0.1004 CCC 1223.325963 2 1.2545 530 | 1/12
24 h-m-p 1.6000 8.0000 0.0332 C 1223.323432 0 1.5506 556 | 1/12
25 h-m-p 1.6000 8.0000 0.0066 C 1223.323123 0 1.4973 582 | 1/12
26 h-m-p 1.6000 8.0000 0.0003 Y 1223.323119 0 1.1695 608 | 1/12
27 h-m-p 1.6000 8.0000 0.0001 Y 1223.323119 0 1.2045 634 | 1/12
28 h-m-p 1.6000 8.0000 0.0000 C 1223.323119 0 1.4798 660 | 1/12
29 h-m-p 1.6000 8.0000 0.0000 Y 1223.323119 0 0.7468 686 | 1/12
30 h-m-p 1.6000 8.0000 0.0000 C 1223.323119 0 0.5526 712 | 1/12
31 h-m-p 1.2170 8.0000 0.0000 ---------------Y 1223.323119 0 0.0000 753
Out..
lnL = -1223.323119
754 lfun, 3016 eigenQcodon, 15834 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1233.429453 S = -1181.595349 -42.980301
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 117 patterns 0:10
did 20 / 117 patterns 0:10
did 30 / 117 patterns 0:10
did 40 / 117 patterns 0:10
did 50 / 117 patterns 0:10
did 60 / 117 patterns 0:10
did 70 / 117 patterns 0:10
did 80 / 117 patterns 0:10
did 90 / 117 patterns 0:10
did 100 / 117 patterns 0:10
did 110 / 117 patterns 0:10
did 117 / 117 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 85
0.036548 0.153582 0.125080 0.112977 0.048309 0.005932 0.009276 1.955567 0.331355 0.382499 0.045702 0.114091 0.191033
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 13.583446
np = 13
lnL0 = -1223.955608
Iterating by ming2
Initial: fx= 1223.955608
x= 0.03655 0.15358 0.12508 0.11298 0.04831 0.00593 0.00928 1.95557 0.33136 0.38250 0.04570 0.11409 0.19103
1 h-m-p 0.0000 0.0002 106.0906 +CC 1223.696140 1 0.0001 21 | 0/13
2 h-m-p 0.0000 0.0002 36.5756 YCCC 1223.662792 3 0.0001 42 | 0/13
3 h-m-p 0.0001 0.0021 30.7667 ++CCC 1223.392120 2 0.0009 64 | 0/13
4 h-m-p 0.0002 0.0010 33.6294 YCCC 1223.282470 3 0.0004 85 | 0/13
5 h-m-p 0.0003 0.0016 12.5940 YC 1223.253909 1 0.0005 102 | 0/13
6 h-m-p 0.0003 0.0013 9.8630 ++ 1223.205956 m 0.0013 118 | 1/13
7 h-m-p 0.0004 0.0482 23.3321 +YCC 1223.146118 2 0.0009 138 | 1/13
8 h-m-p 0.0079 0.0807 2.6461 YC 1223.133629 1 0.0044 155 | 1/13
9 h-m-p 0.0012 0.0181 9.5856 +CCCC 1223.050289 3 0.0073 178 | 1/13
10 h-m-p 0.0036 0.0180 7.2371 CC 1223.043370 1 0.0011 196 | 1/13
11 h-m-p 0.0935 8.0000 0.0864 +YC 1223.029033 1 0.7438 214 | 1/13
12 h-m-p 0.5575 8.0000 0.1152 YC 1223.026365 1 0.2643 243 | 1/13
13 h-m-p 1.6000 8.0000 0.0106 YC 1223.025651 1 0.8100 272 | 1/13
14 h-m-p 0.5356 8.0000 0.0160 +CC 1223.024814 1 2.4855 303 | 1/13
15 h-m-p 0.6156 8.0000 0.0645 ++ 1223.019903 m 8.0000 331 | 1/13
16 h-m-p 1.4451 7.2256 0.1737 YYY 1223.011960 2 1.3945 361 | 1/13
17 h-m-p 0.3280 1.6399 0.2670 +YC 1223.004706 1 1.4158 391 | 1/13
18 h-m-p 0.0620 0.3098 0.0932 ++ 1223.002938 m 0.3098 419 | 2/13
19 h-m-p 0.0674 5.6265 0.4246 C 1223.002918 0 0.0169 447 | 2/13
20 h-m-p 0.2160 8.0000 0.0332 ------------Y 1223.002918 0 0.0000 486 | 2/13
21 h-m-p 0.0088 4.3952 2.4701 YC 1223.001313 1 0.0176 514 | 2/13
22 h-m-p 1.0660 8.0000 0.0407 C 1222.999850 0 1.0202 530 | 2/13
23 h-m-p 1.6000 8.0000 0.0087 C 1222.999807 0 2.0962 557 | 2/13
24 h-m-p 1.5926 8.0000 0.0114 +Y 1222.999666 0 5.3712 585 | 2/13
25 h-m-p 1.6000 8.0000 0.0098 Y 1222.999648 0 1.2241 612 | 2/13
26 h-m-p 1.6000 8.0000 0.0015 Y 1222.999648 0 1.0902 639 | 2/13
27 h-m-p 1.6000 8.0000 0.0003 Y 1222.999647 0 0.8633 666 | 2/13
28 h-m-p 1.6000 8.0000 0.0000 C 1222.999647 0 0.4200 693 | 2/13
29 h-m-p 0.8689 8.0000 0.0000 Y 1222.999647 0 0.4643 720 | 2/13
30 h-m-p 0.7758 8.0000 0.0000 --Y 1222.999647 0 0.0121 749 | 2/13
31 h-m-p 0.0160 8.0000 0.0001 -------------.. | 2/13
32 h-m-p 0.0160 8.0000 0.0002 ------------- | 2/13
33 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1222.999647
864 lfun, 3456 eigenQcodon, 18144 P(t)
Time used: 0:17
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 85
0.036548 0.153582 0.125080 0.112977 0.048309 0.005932 0.009276 1.939749 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.599315
np = 10
lnL0 = -1234.778355
Iterating by ming2
Initial: fx= 1234.778355
x= 0.03655 0.15358 0.12508 0.11298 0.04831 0.00593 0.00928 1.93975 0.66567 1.54913
1 h-m-p 0.0000 0.0002 111.6535 +CCCC 1234.491769 3 0.0001 32 | 0/10
2 h-m-p 0.0001 0.0003 43.3675 CYCCC 1234.427199 4 0.0001 62 | 0/10
3 h-m-p 0.0000 0.0118 65.9641 ++YCCC 1233.271178 3 0.0014 92 | 0/10
4 h-m-p 0.0004 0.0031 207.5961 +YYYYYCC 1226.998123 6 0.0017 123 | 0/10
5 h-m-p 0.0002 0.0011 246.5168 CCCCC 1226.006914 4 0.0003 154 | 0/10
6 h-m-p 0.0014 0.0071 23.3280 YCC 1225.844782 2 0.0009 180 | 0/10
7 h-m-p 0.0035 0.2054 6.0865 +YCCC 1225.395002 3 0.0229 209 | 0/10
8 h-m-p 0.0022 0.0265 64.7023 +YYCCC 1224.057795 4 0.0064 239 | 0/10
9 h-m-p 0.0495 0.2476 1.0431 -CC 1224.050593 1 0.0049 265 | 0/10
10 h-m-p 0.0022 0.5789 2.2948 +++YYCCCCC 1223.289772 6 0.1524 301 | 0/10
11 h-m-p 0.3724 1.8621 0.7626 YCC 1223.135235 2 0.2262 327 | 0/10
12 h-m-p 1.6000 8.0000 0.0244 YCC 1223.104035 2 0.8587 353 | 0/10
13 h-m-p 0.7566 8.0000 0.0277 +YC 1223.099791 1 2.2979 378 | 0/10
14 h-m-p 0.8746 8.0000 0.0728 ++ 1223.079486 m 8.0000 401 | 0/10
15 h-m-p 1.6000 8.0000 0.1769 CCC 1223.053798 2 1.4511 428 | 0/10
16 h-m-p 1.4097 8.0000 0.1821 CC 1223.047649 1 1.8814 453 | 0/10
17 h-m-p 1.6000 8.0000 0.1129 CC 1223.046515 1 1.3987 478 | 0/10
18 h-m-p 1.6000 8.0000 0.0308 C 1223.046428 0 1.4097 501 | 0/10
19 h-m-p 1.6000 8.0000 0.0002 Y 1223.046416 0 2.6597 524 | 0/10
20 h-m-p 0.1444 8.0000 0.0045 +Y 1223.046414 0 1.2252 548 | 0/10
21 h-m-p 1.6000 8.0000 0.0009 Y 1223.046413 0 0.8788 571 | 0/10
22 h-m-p 1.6000 8.0000 0.0001 Y 1223.046413 0 1.1956 594 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 ----Y 1223.046413 0 0.0016 621
Out..
lnL = -1223.046413
622 lfun, 6842 eigenQcodon, 43540 P(t)
Time used: 0:32
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 85
initial w for M8:NSbetaw>1 reset.
0.036548 0.153582 0.125080 0.112977 0.048309 0.005932 0.009276 1.941239 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.278232
np = 12
lnL0 = -1238.866100
Iterating by ming2
Initial: fx= 1238.866100
x= 0.03655 0.15358 0.12508 0.11298 0.04831 0.00593 0.00928 1.94124 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0003 165.7822 ++CCCC 1237.214621 3 0.0002 37 | 0/12
2 h-m-p 0.0001 0.0004 227.1660 ++ 1232.073869 m 0.0004 64 | 1/12
3 h-m-p 0.0003 0.0016 89.0743 +YCCCC 1230.404801 4 0.0008 99 | 1/12
4 h-m-p 0.0006 0.0032 78.3571 YCCCCC 1228.462637 5 0.0013 134 | 1/12
5 h-m-p 0.0006 0.0029 82.9494 CCCCC 1227.604932 4 0.0007 168 | 1/12
6 h-m-p 0.0023 0.0114 12.5758 YCC 1227.532502 2 0.0010 197 | 1/12
7 h-m-p 0.0021 0.0993 6.0426 ++CCCCC 1226.624572 4 0.0354 233 | 1/12
8 h-m-p 0.0009 0.0047 84.6453 +YYCCCC 1225.418023 5 0.0030 268 | 1/12
9 h-m-p 0.0495 0.2475 4.0554 YYYC 1224.981402 3 0.0450 297 | 1/12
10 h-m-p 0.0018 0.0090 92.2141 +YCCC 1223.863896 3 0.0050 329 | 1/12
11 h-m-p 0.0314 0.1570 1.6536 ++ 1223.392311 m 0.1570 355 | 2/12
12 h-m-p 0.2736 2.4721 0.4110 CCC 1223.183791 2 0.3010 385 | 2/12
13 h-m-p 0.4491 3.0461 0.2754 YCC 1223.149255 2 0.2860 413 | 2/12
14 h-m-p 0.8428 4.9564 0.0935 YYC 1223.131464 2 0.6817 440 | 2/12
15 h-m-p 0.9295 8.0000 0.0685 +YC 1223.104147 1 5.3249 467 | 2/12
16 h-m-p 1.2538 8.0000 0.2911 YCC 1223.063658 2 1.9465 495 | 2/12
17 h-m-p 1.6000 8.0000 0.2577 YC 1223.050467 1 1.2243 521 | 2/12
18 h-m-p 1.6000 8.0000 0.1810 YC 1223.047505 1 1.1220 547 | 2/12
19 h-m-p 1.6000 8.0000 0.1262 YC 1223.046572 1 1.1493 573 | 2/12
20 h-m-p 1.6000 8.0000 0.0373 YC 1223.046490 1 1.0501 599 | 2/12
21 h-m-p 1.6000 8.0000 0.0075 Y 1223.046485 0 1.0984 624 | 2/12
22 h-m-p 1.6000 8.0000 0.0003 Y 1223.046483 0 2.8334 649 | 2/12
23 h-m-p 0.5090 8.0000 0.0016 Y 1223.046482 0 1.1956 674 | 2/12
24 h-m-p 1.6000 8.0000 0.0003 Y 1223.046482 0 0.9117 699 | 2/12
25 h-m-p 1.6000 8.0000 0.0000 Y 1223.046482 0 1.2015 724 | 2/12
26 h-m-p 1.6000 8.0000 0.0000 -Y 1223.046482 0 0.1000 750 | 2/12
27 h-m-p 0.0676 8.0000 0.0000 --------------.. | 2/12
28 h-m-p 0.0160 8.0000 0.0011 ---------Y 1223.046482 0 0.0000 821 | 2/12
29 h-m-p 0.0160 8.0000 0.0004 -------------.. | 2/12
30 h-m-p 0.0160 8.0000 0.0011 -------------
Out..
lnL = -1223.046482
894 lfun, 10728 eigenQcodon, 68838 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1233.134112 S = -1181.675009 -43.557872
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 117 patterns 0:57
did 20 / 117 patterns 0:57
did 30 / 117 patterns 0:57
did 40 / 117 patterns 0:58
did 50 / 117 patterns 0:58
did 60 / 117 patterns 0:58
did 70 / 117 patterns 0:58
did 80 / 117 patterns 0:58
did 90 / 117 patterns 0:58
did 100 / 117 patterns 0:59
did 110 / 117 patterns 0:59
did 117 / 117 patterns 0:59
Time used: 0:59
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=202
D_melanogaster_Zip102B-PD MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
D_sechellia_Zip102B-PD MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
D_simulans_Zip102B-PD MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
D_yakuba_Zip102B-PD MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
D_erecta_Zip102B-PD MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
******.***:*.* ***********************************
D_melanogaster_Zip102B-PD IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
D_sechellia_Zip102B-PD IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
D_simulans_Zip102B-PD IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
D_yakuba_Zip102B-PD IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
D_erecta_Zip102B-PD IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
*********************************************:****
D_melanogaster_Zip102B-PD YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
D_sechellia_Zip102B-PD YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
D_simulans_Zip102B-PD YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
D_yakuba_Zip102B-PD YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
D_erecta_Zip102B-PD YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
*********************************************::***
D_melanogaster_Zip102B-PD QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
D_sechellia_Zip102B-PD QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
D_simulans_Zip102B-PD QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
D_yakuba_Zip102B-PD QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
D_erecta_Zip102B-PD QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
**:* ****** **:*: *.****:******.*:***********:**:
D_melanogaster_Zip102B-PD H-
D_sechellia_Zip102B-PD H-
D_simulans_Zip102B-PD H-
D_yakuba_Zip102B-PD Ho
D_erecta_Zip102B-PD Ho
*
>D_melanogaster_Zip102B-PD ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT CAC--- >D_sechellia_Zip102B-PD ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT CAC--- >D_simulans_Zip102B-PD ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT CAC--- >D_yakuba_Zip102B-PD ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG CAC--- >D_erecta_Zip102B-PD ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG CAC---
>D_melanogaster_Zip102B-PD MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN H >D_sechellia_Zip102B-PD MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN H >D_simulans_Zip102B-PD MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN H >D_yakuba_Zip102B-PD MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK H >D_erecta_Zip102B-PD MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK H
#NEXUS
[ID: 1250857571]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_Zip102B-PD
D_sechellia_Zip102B-PD
D_simulans_Zip102B-PD
D_yakuba_Zip102B-PD
D_erecta_Zip102B-PD
;
end;
begin trees;
translate
1 D_melanogaster_Zip102B-PD,
2 D_sechellia_Zip102B-PD,
3 D_simulans_Zip102B-PD,
4 D_yakuba_Zip102B-PD,
5 D_erecta_Zip102B-PD
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01887195,(4:0.0696373,5:0.06180425)1.000:0.09867807,(2:0.005597566,3:0.00357637)0.995:0.02298571);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01887195,(4:0.0696373,5:0.06180425):0.09867807,(2:0.005597566,3:0.00357637):0.02298571);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1295.12 -1304.58
2 -1295.03 -1303.97
--------------------------------------
TOTAL -1295.07 -1304.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.297719 0.003618 0.199934 0.423979 0.290921 1026.77 1061.17 1.000
r(A<->C){all} 0.047299 0.000950 0.000143 0.102876 0.042430 428.51 647.53 1.000
r(A<->G){all} 0.200959 0.003074 0.097556 0.305210 0.196925 420.49 517.88 1.000
r(A<->T){all} 0.127565 0.001420 0.060654 0.201857 0.124383 881.45 951.96 1.000
r(C<->G){all} 0.086777 0.001632 0.020755 0.170239 0.081863 793.70 846.63 1.000
r(C<->T){all} 0.463522 0.006016 0.315705 0.617108 0.463273 573.90 634.31 1.000
r(G<->T){all} 0.073878 0.001112 0.013002 0.139985 0.070200 683.94 817.56 1.000
pi(A){all} 0.291690 0.000325 0.258985 0.328770 0.291633 1348.36 1402.75 1.000
pi(C){all} 0.189153 0.000218 0.160937 0.218724 0.188776 1366.36 1387.27 1.000
pi(G){all} 0.221292 0.000255 0.192169 0.254741 0.221193 1237.29 1369.15 1.000
pi(T){all} 0.297866 0.000313 0.261829 0.331793 0.297472 1215.58 1308.40 1.000
alpha{1,2} 0.062092 0.002363 0.000135 0.153387 0.052750 1402.60 1406.33 1.000
alpha{3} 1.792035 0.578672 0.590664 3.339903 1.656158 1198.90 1275.82 1.001
pinvar{all} 0.388731 0.014175 0.129530 0.593832 0.402546 1141.46 1257.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 200
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 7 5 5 7 8 | Ser TCT 2 2 2 1 2 | Tyr TAT 3 3 3 3 3 | Cys TGT 1 1 1 1 1
TTC 2 3 3 0 1 | TCC 3 3 3 3 2 | TAC 1 1 1 1 1 | TGC 1 1 1 1 1
Leu TTA 7 8 8 6 3 | TCA 0 0 0 0 2 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 6 7 7 9 9 | TCG 1 1 1 2 1 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 4 5 5 6 5 | Pro CCT 0 0 0 0 0 | His CAT 7 7 7 7 8 | Arg CGT 0 0 0 1 0
CTC 0 0 0 0 0 | CCC 2 2 2 1 1 | CAC 3 3 3 5 3 | CGC 1 1 1 1 2
CTA 7 6 6 4 8 | CCA 2 2 2 2 2 | Gln CAA 4 4 4 4 3 | CGA 1 1 1 1 1
CTG 4 4 4 5 4 | CCG 0 0 0 1 1 | CAG 4 4 4 4 5 | CGG 1 1 1 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 7 6 8 6 8 | Thr ACT 5 6 6 7 9 | Asn AAT 9 9 9 7 7 | Ser AGT 4 4 4 3 2
ATC 2 2 1 2 2 | ACC 2 2 2 0 1 | AAC 1 1 1 2 1 | AGC 3 2 2 3 3
ATA 5 5 4 6 5 | ACA 4 4 4 4 2 | Lys AAA 5 4 4 5 5 | Arg AGA 2 2 2 2 2
Met ATG 5 5 5 5 5 | ACG 4 4 4 3 3 | AAG 3 4 4 4 4 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 6 7 7 7 6 | Ala GCT 7 8 8 8 7 | Asp GAT 4 6 6 5 5 | Gly GGT 1 1 1 2 2
GTC 1 2 1 0 2 | GCC 4 3 3 3 4 | GAC 4 2 2 3 4 | GGC 1 1 1 2 2
GTA 4 5 5 5 3 | GCA 9 9 9 9 7 | Glu GAA 3 3 3 3 3 | GGA 10 11 11 9 9
GTG 5 2 3 2 3 | GCG 0 0 0 1 1 | GAG 4 4 4 4 4 | GGG 2 1 1 2 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Zip102B-PD
position 1: T:0.17000 C:0.20000 A:0.30500 G:0.32500
position 2: T:0.36000 C:0.22500 A:0.27500 G:0.14000
position 3: T:0.33500 C:0.15500 A:0.31500 G:0.19500
Average T:0.28833 C:0.19333 A:0.29833 G:0.22000
#2: D_sechellia_Zip102B-PD
position 1: T:0.17500 C:0.20000 A:0.30000 G:0.32500
position 2: T:0.36000 C:0.23000 A:0.27500 G:0.13500
position 3: T:0.35000 C:0.14500 A:0.32000 G:0.18500
Average T:0.29500 C:0.19167 A:0.29833 G:0.21500
#3: D_simulans_Zip102B-PD
position 1: T:0.17500 C:0.20000 A:0.30000 G:0.32500
position 2: T:0.36000 C:0.23000 A:0.27500 G:0.13500
position 3: T:0.36000 C:0.13500 A:0.31500 G:0.19000
Average T:0.29833 C:0.18833 A:0.29667 G:0.21667
#4: D_yakuba_Zip102B-PD
position 1: T:0.17000 C:0.21000 A:0.29500 G:0.32500
position 2: T:0.35000 C:0.22500 A:0.28500 G:0.14000
position 3: T:0.35500 C:0.13500 A:0.30000 G:0.21000
Average T:0.29167 C:0.19000 A:0.29333 G:0.22500
#5: D_erecta_Zip102B-PD
position 1: T:0.17000 C:0.21500 A:0.29500 G:0.32000
position 2: T:0.36000 C:0.22500 A:0.28000 G:0.13500
position 3: T:0.36500 C:0.15000 A:0.27500 G:0.21000
Average T:0.29833 C:0.19667 A:0.28333 G:0.22167
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 32 | Ser S TCT 9 | Tyr Y TAT 15 | Cys C TGT 5
TTC 9 | TCC 14 | TAC 5 | TGC 5
Leu L TTA 32 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 38 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 25 | Pro P CCT 0 | His H CAT 36 | Arg R CGT 1
CTC 0 | CCC 8 | CAC 17 | CGC 6
CTA 31 | CCA 10 | Gln Q CAA 19 | CGA 5
CTG 21 | CCG 2 | CAG 21 | CGG 3
------------------------------------------------------------------------------
Ile I ATT 35 | Thr T ACT 33 | Asn N AAT 41 | Ser S AGT 17
ATC 9 | ACC 7 | AAC 6 | AGC 13
ATA 25 | ACA 18 | Lys K AAA 23 | Arg R AGA 10
Met M ATG 25 | ACG 18 | AAG 19 | AGG 0
------------------------------------------------------------------------------
Val V GTT 33 | Ala A GCT 38 | Asp D GAT 26 | Gly G GGT 7
GTC 6 | GCC 17 | GAC 15 | GGC 7
GTA 22 | GCA 43 | Glu E GAA 15 | GGA 50
GTG 15 | GCG 2 | GAG 20 | GGG 8
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17200 C:0.20500 A:0.29900 G:0.32400
position 2: T:0.35800 C:0.22700 A:0.27800 G:0.13700
position 3: T:0.35300 C:0.14400 A:0.30500 G:0.19800
Average T:0.29433 C:0.19200 A:0.29400 G:0.21967
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Zip102B-PD
D_sechellia_Zip102B-PD 0.0734 (0.0078 0.1058)
D_simulans_Zip102B-PD 0.0793 (0.0078 0.0980)-1.0000 (0.0000 0.0206)
D_yakuba_Zip102B-PD 0.0954 (0.0315 0.3302) 0.1015 (0.0350 0.3448) 0.0984 (0.0350 0.3557)
D_erecta_Zip102B-PD 0.0941 (0.0304 0.3228) 0.1037 (0.0339 0.3267) 0.1005 (0.0339 0.3372) 0.0990 (0.0246 0.2490)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 85
lnL(ntime: 7 np: 9): -1223.692769 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.036778 0.160923 0.127262 0.117587 0.051044 0.009853 0.005785 1.933354 0.091404
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50923
(1: 0.036778, (4: 0.127262, 5: 0.117587): 0.160923, (2: 0.009853, 3: 0.005785): 0.051044);
(D_melanogaster_Zip102B-PD: 0.036778, (D_yakuba_Zip102B-PD: 0.127262, D_erecta_Zip102B-PD: 0.117587): 0.160923, (D_sechellia_Zip102B-PD: 0.009853, D_simulans_Zip102B-PD: 0.005785): 0.051044);
Detailed output identifying parameters
kappa (ts/tv) = 1.93335
omega (dN/dS) = 0.09140
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.037 447.8 152.2 0.0914 0.0035 0.0381 1.6 5.8
6..7 0.161 447.8 152.2 0.0914 0.0152 0.1666 6.8 25.4
7..4 0.127 447.8 152.2 0.0914 0.0120 0.1318 5.4 20.1
7..5 0.118 447.8 152.2 0.0914 0.0111 0.1218 5.0 18.5
6..8 0.051 447.8 152.2 0.0914 0.0048 0.0529 2.2 8.0
8..2 0.010 447.8 152.2 0.0914 0.0009 0.0102 0.4 1.6
8..3 0.006 447.8 152.2 0.0914 0.0005 0.0060 0.2 0.9
tree length for dN: 0.0482
tree length for dS: 0.5273
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 85
lnL(ntime: 7 np: 10): -1223.323119 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.036569 0.162432 0.128762 0.117840 0.051111 0.009846 0.005762 1.955570 0.973850 0.073208
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51232
(1: 0.036569, (4: 0.128762, 5: 0.117840): 0.162432, (2: 0.009846, 3: 0.005762): 0.051111);
(D_melanogaster_Zip102B-PD: 0.036569, (D_yakuba_Zip102B-PD: 0.128762, D_erecta_Zip102B-PD: 0.117840): 0.162432, (D_sechellia_Zip102B-PD: 0.009846, D_simulans_Zip102B-PD: 0.005762): 0.051111);
Detailed output identifying parameters
kappa (ts/tv) = 1.95557
dN/dS (w) for site classes (K=2)
p: 0.97385 0.02615
w: 0.07321 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.037 447.6 152.4 0.0974 0.0036 0.0373 1.6 5.7
6..7 0.162 447.6 152.4 0.0974 0.0162 0.1657 7.2 25.3
7..4 0.129 447.6 152.4 0.0974 0.0128 0.1314 5.7 20.0
7..5 0.118 447.6 152.4 0.0974 0.0117 0.1202 5.2 18.3
6..8 0.051 447.6 152.4 0.0974 0.0051 0.0522 2.3 7.9
8..2 0.010 447.6 152.4 0.0974 0.0010 0.0100 0.4 1.5
8..3 0.006 447.6 152.4 0.0974 0.0006 0.0059 0.3 0.9
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 85
lnL(ntime: 7 np: 12): -1223.323119 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.036569 0.162432 0.128762 0.117840 0.051111 0.009846 0.005762 1.955567 0.973850 0.011646 0.073208 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51232
(1: 0.036569, (4: 0.128762, 5: 0.117840): 0.162432, (2: 0.009846, 3: 0.005762): 0.051111);
(D_melanogaster_Zip102B-PD: 0.036569, (D_yakuba_Zip102B-PD: 0.128762, D_erecta_Zip102B-PD: 0.117840): 0.162432, (D_sechellia_Zip102B-PD: 0.009846, D_simulans_Zip102B-PD: 0.005762): 0.051111);
Detailed output identifying parameters
kappa (ts/tv) = 1.95557
dN/dS (w) for site classes (K=3)
p: 0.97385 0.01165 0.01450
w: 0.07321 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.037 447.6 152.4 0.0974 0.0036 0.0373 1.6 5.7
6..7 0.162 447.6 152.4 0.0974 0.0162 0.1657 7.2 25.3
7..4 0.129 447.6 152.4 0.0974 0.0128 0.1314 5.7 20.0
7..5 0.118 447.6 152.4 0.0974 0.0117 0.1202 5.2 18.3
6..8 0.051 447.6 152.4 0.0974 0.0051 0.0522 2.3 7.9
8..2 0.010 447.6 152.4 0.0974 0.0010 0.0100 0.4 1.5
8..3 0.006 447.6 152.4 0.0974 0.0006 0.0059 0.3 0.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zip102B-PD)
Pr(w>1) post mean +- SE for w
155 C 0.536 1.429 +- 0.894
168 N 0.513 1.399 +- 0.925
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.729 0.164 0.051 0.022 0.011 0.007 0.005 0.004 0.003 0.003
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.023 0.966
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 85
check convergence..
lnL(ntime: 7 np: 13): -1222.999647 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.036342 0.162135 0.127655 0.118326 0.051307 0.009848 0.005758 1.939749 0.404661 0.181554 0.000001 0.000001 0.227960
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51137
(1: 0.036342, (4: 0.127655, 5: 0.118326): 0.162135, (2: 0.009848, 3: 0.005758): 0.051307);
(D_melanogaster_Zip102B-PD: 0.036342, (D_yakuba_Zip102B-PD: 0.127655, D_erecta_Zip102B-PD: 0.118326): 0.162135, (D_sechellia_Zip102B-PD: 0.009848, D_simulans_Zip102B-PD: 0.005758): 0.051307);
Detailed output identifying parameters
kappa (ts/tv) = 1.93975
dN/dS (w) for site classes (K=3)
p: 0.40466 0.18155 0.41379
w: 0.00000 0.00000 0.22796
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.036 447.7 152.3 0.0943 0.0035 0.0374 1.6 5.7
6..7 0.162 447.7 152.3 0.0943 0.0157 0.1667 7.0 25.4
7..4 0.128 447.7 152.3 0.0943 0.0124 0.1313 5.5 20.0
7..5 0.118 447.7 152.3 0.0943 0.0115 0.1217 5.1 18.5
6..8 0.051 447.7 152.3 0.0943 0.0050 0.0528 2.2 8.0
8..2 0.010 447.7 152.3 0.0943 0.0010 0.0101 0.4 1.5
8..3 0.006 447.7 152.3 0.0943 0.0006 0.0059 0.3 0.9
Naive Empirical Bayes (NEB) analysis
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 85
lnL(ntime: 7 np: 10): -1223.046413 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.036385 0.162173 0.127817 0.118238 0.051270 0.009848 0.005759 1.941239 0.420164 3.864222
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51149
(1: 0.036385, (4: 0.127817, 5: 0.118238): 0.162173, (2: 0.009848, 3: 0.005759): 0.051270);
(D_melanogaster_Zip102B-PD: 0.036385, (D_yakuba_Zip102B-PD: 0.127817, D_erecta_Zip102B-PD: 0.118238): 0.162173, (D_sechellia_Zip102B-PD: 0.009848, D_simulans_Zip102B-PD: 0.005759): 0.051270);
Detailed output identifying parameters
kappa (ts/tv) = 1.94124
Parameters in M7 (beta):
p = 0.42016 q = 3.86422
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00017 0.00230 0.00785 0.01784 0.03348 0.05651 0.08983 0.13899 0.21739 0.37958
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.036 447.7 152.3 0.0944 0.0035 0.0374 1.6 5.7
6..7 0.162 447.7 152.3 0.0944 0.0157 0.1667 7.0 25.4
7..4 0.128 447.7 152.3 0.0944 0.0124 0.1314 5.6 20.0
7..5 0.118 447.7 152.3 0.0944 0.0115 0.1216 5.1 18.5
6..8 0.051 447.7 152.3 0.0944 0.0050 0.0527 2.2 8.0
8..2 0.010 447.7 152.3 0.0944 0.0010 0.0101 0.4 1.5
8..3 0.006 447.7 152.3 0.0944 0.0006 0.0059 0.3 0.9
Time used: 0:32
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 85
check convergence..
lnL(ntime: 7 np: 12): -1223.046482 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.036385 0.162173 0.127817 0.118238 0.051270 0.009848 0.005759 1.941250 0.999990 0.420234 3.865177 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.51149
(1: 0.036385, (4: 0.127817, 5: 0.118238): 0.162173, (2: 0.009848, 3: 0.005759): 0.051270);
(D_melanogaster_Zip102B-PD: 0.036385, (D_yakuba_Zip102B-PD: 0.127817, D_erecta_Zip102B-PD: 0.118238): 0.162173, (D_sechellia_Zip102B-PD: 0.009848, D_simulans_Zip102B-PD: 0.005759): 0.051270);
Detailed output identifying parameters
kappa (ts/tv) = 1.94125
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.42023 q = 3.86518
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00017 0.00230 0.00785 0.01784 0.03348 0.05652 0.08983 0.13898 0.21737 0.37953 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.036 447.7 152.3 0.0944 0.0035 0.0374 1.6 5.7
6..7 0.162 447.7 152.3 0.0944 0.0157 0.1667 7.0 25.4
7..4 0.128 447.7 152.3 0.0944 0.0124 0.1314 5.6 20.0
7..5 0.118 447.7 152.3 0.0944 0.0115 0.1216 5.1 18.5
6..8 0.051 447.7 152.3 0.0944 0.0050 0.0527 2.2 8.0
8..2 0.010 447.7 152.3 0.0944 0.0010 0.0101 0.4 1.5
8..3 0.006 447.7 152.3 0.0944 0.0006 0.0059 0.3 0.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zip102B-PD)
Pr(w>1) post mean +- SE for w
155 C 0.629 1.255 +- 0.794
168 N 0.591 1.202 +- 0.808
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.995 0.005 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.005 0.026 0.069 0.128 0.194 0.259 0.320
ws: 0.847 0.110 0.025 0.009 0.004 0.002 0.002 0.001 0.001 0.001
Time used: 0:59
Model 1: NearlyNeutral -1223.323119 Model 2: PositiveSelection -1223.323119 Model 0: one-ratio -1223.692769 Model 3: discrete -1222.999647 Model 7: beta -1223.046413 Model 8: beta&w>1 -1223.046482 Model 0 vs 1 0.7393000000001848 Model 2 vs 1 0.0 Model 8 vs 7 1.3799999987895717E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
