--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 15:50:33 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip102B-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1295.12         -1304.58
2      -1295.03         -1303.97
--------------------------------------
TOTAL    -1295.07         -1304.32
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.297719    0.003618    0.199934    0.423979    0.290921   1026.77   1061.17    1.000
r(A<->C){all}   0.047299    0.000950    0.000143    0.102876    0.042430    428.51    647.53    1.000
r(A<->G){all}   0.200959    0.003074    0.097556    0.305210    0.196925    420.49    517.88    1.000
r(A<->T){all}   0.127565    0.001420    0.060654    0.201857    0.124383    881.45    951.96    1.000
r(C<->G){all}   0.086777    0.001632    0.020755    0.170239    0.081863    793.70    846.63    1.000
r(C<->T){all}   0.463522    0.006016    0.315705    0.617108    0.463273    573.90    634.31    1.000
r(G<->T){all}   0.073878    0.001112    0.013002    0.139985    0.070200    683.94    817.56    1.000
pi(A){all}      0.291690    0.000325    0.258985    0.328770    0.291633   1348.36   1402.75    1.000
pi(C){all}      0.189153    0.000218    0.160937    0.218724    0.188776   1366.36   1387.27    1.000
pi(G){all}      0.221292    0.000255    0.192169    0.254741    0.221193   1237.29   1369.15    1.000
pi(T){all}      0.297866    0.000313    0.261829    0.331793    0.297472   1215.58   1308.40    1.000
alpha{1,2}      0.062092    0.002363    0.000135    0.153387    0.052750   1402.60   1406.33    1.000
alpha{3}        1.792035    0.578672    0.590664    3.339903    1.656158   1198.90   1275.82    1.001
pinvar{all}     0.388731    0.014175    0.129530    0.593832    0.402546   1141.46   1257.09    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1223.323119
Model 2: PositiveSelection	-1223.323119
Model 0: one-ratio	-1223.692769
Model 3: discrete	-1222.999647
Model 7: beta	-1223.046413
Model 8: beta&w>1	-1223.046482


Model 0 vs 1	0.7393000000001848

Model 2 vs 1	0.0

Model 8 vs 7	1.3799999987895717E-4
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESRDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH
o
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESRDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=202 

C1              MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C2              MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C3              MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C4              MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C5              MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
                ******.***:*.* ***********************************

C1              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C2              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C3              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C4              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
C5              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
                *********************************************:****

C1              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
C2              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
C3              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
C4              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
C5              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
                *********************************************::***

C1              QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
C2              QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
C3              QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
C4              QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
C5              QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
                **:* ******  **:*: *.****:******.*:***********:**:

C1              H-
C2              H-
C3              H-
C4              Ho
C5              Ho
                * 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4098]--->[4092]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip102B-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.272 Mb, Max= 30.515 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
Ho
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
Ho

FORMAT of file /tmp/tmp4253595435401105075aln Not Supported[FATAL:T-COFFEE]
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
Ho
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
Ho
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:202 S:99 BS:202
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.51 C1	 C2	 98.51
TOP	    1    0	 98.51 C2	 C1	 98.51
BOT	    0    2	 98.51 C1	 C3	 98.51
TOP	    2    0	 98.51 C3	 C1	 98.51
BOT	    0    3	 93.50 C1	 C4	 93.50
TOP	    3    0	 93.50 C4	 C1	 93.50
BOT	    0    4	 94.50 C1	 C5	 94.50
TOP	    4    0	 94.50 C5	 C1	 94.50
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 93.00 C2	 C4	 93.00
TOP	    3    1	 93.00 C4	 C2	 93.00
BOT	    1    4	 94.00 C2	 C5	 94.00
TOP	    4    1	 94.00 C5	 C2	 94.00
BOT	    2    3	 93.00 C3	 C4	 93.00
TOP	    3    2	 93.00 C4	 C3	 93.00
BOT	    2    4	 94.00 C3	 C5	 94.00
TOP	    4    2	 94.00 C5	 C3	 94.00
BOT	    3    4	 95.02 C4	 C5	 95.02
TOP	    4    3	 95.02 C5	 C4	 95.02
AVG	 0	 C1	  *	 96.25
AVG	 1	 C2	  *	 96.38
AVG	 2	 C3	  *	 96.38
AVG	 3	 C4	  *	 93.63
AVG	 4	 C5	  *	 94.38
TOT	 TOT	  *	 95.40
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA
C2              ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
C3              ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
C4              ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA
C5              ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA
                ***********.** ** * ******.****  **** ***** ******

C1              AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG
C2              AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
C3              AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
C4              AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG
C5              AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG
                ************************:***********.** ** *******

C1              ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
C2              ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
C3              ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
C4              ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG
C5              ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
                **********.*****************.************** ******

C1              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
C2              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
C3              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
C4              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
C5              ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG
                **************.*****************.************** **

C1              ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C2              ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C3              ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C4              GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA
C5              GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA
                .***** **:**  **** ***********:*******************

C1              GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C2              GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C3              GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C4              GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG
C5              GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT
                *******:** **.*****.********:******:******** **** 

C1              TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC
C2              TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
C3              TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
C4              TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC
C5              TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC
                ********.*****.***********.** ** ***** ** **.*****

C1              CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C2              CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C3              CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C4              TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA
C5              CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA
                 ********:********.** ****************************

C1              CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT
C2              CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
C3              CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
C4              CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT
C5              CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT
                **** ****** ************* **.******** :****.******

C1              CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C2              CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C3              CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C4              CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA
C5              CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA
                ***** .***** .* ************* **    *:*******.****

C1              TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA
C2              TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA
C3              TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA
C4              TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA
C5              CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA
                 :*.:.****.* ********:*** ** ***************** *:*

C1              TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT
C2              TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
C3              TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
C4              TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG
C5              TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG
                **.********** ********:** **.********: ********** 

C1              CAC---
C2              CAC---
C3              CAC---
C4              CAC---
C5              CAC---
                ***   



>C1
ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT
CAC---
>C2
ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
CAC---
>C3
ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
CAC---
>C4
ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG
ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA
GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG
TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC
TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT
CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA
TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA
TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG
CAC---
>C5
ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA
AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG
ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG
GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA
GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT
TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC
CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT
CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA
CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA
TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG
CAC---
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESRoDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
H
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESRoDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
H


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 606 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481298401
      Setting output file names to "/opt/ADOPS/443/Zip102B-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 852051000
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1250857571
      Seed = 1309533329
      Swapseed = 1481298401
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 20 unique site patterns
      Division 2 has 13 unique site patterns
      Division 3 has 44 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1629.573097 -- -25.624409
         Chain 2 -- -1591.347569 -- -25.624409
         Chain 3 -- -1622.947813 -- -25.624409
         Chain 4 -- -1631.814130 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1622.947813 -- -25.624409
         Chain 2 -- -1549.546348 -- -25.624409
         Chain 3 -- -1637.124480 -- -25.624409
         Chain 4 -- -1631.175648 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1629.573] (-1591.348) (-1622.948) (-1631.814) * [-1622.948] (-1549.546) (-1637.124) (-1631.176) 
        500 -- (-1319.151) (-1318.427) (-1309.701) [-1312.387] * (-1327.694) [-1320.777] (-1322.939) (-1321.567) -- 0:00:00
       1000 -- (-1314.780) (-1316.884) (-1312.051) [-1308.140] * (-1328.910) [-1316.793] (-1312.884) (-1317.993) -- 0:00:00
       1500 -- (-1311.331) (-1312.621) (-1309.375) [-1305.583] * [-1312.351] (-1307.879) (-1318.740) (-1315.836) -- 0:00:00
       2000 -- (-1313.553) (-1311.180) (-1312.609) [-1303.209] * (-1309.801) [-1312.076] (-1314.766) (-1322.612) -- 0:00:00
       2500 -- (-1310.536) (-1307.865) (-1306.560) [-1302.404] * (-1303.396) [-1301.534] (-1309.363) (-1315.916) -- 0:00:00
       3000 -- (-1313.609) [-1296.814] (-1310.733) (-1304.715) * (-1304.955) (-1300.129) [-1309.593] (-1307.405) -- 0:05:32
       3500 -- (-1311.081) (-1304.576) (-1311.060) [-1301.113] * (-1296.488) (-1298.338) [-1306.827] (-1307.230) -- 0:04:44
       4000 -- (-1306.429) (-1298.532) (-1299.716) [-1300.810] * (-1298.025) [-1297.418] (-1305.035) (-1303.446) -- 0:04:09
       4500 -- (-1295.027) (-1300.157) (-1304.420) [-1296.646] * [-1294.421] (-1297.225) (-1303.053) (-1302.861) -- 0:03:41
       5000 -- [-1296.365] (-1297.037) (-1304.878) (-1298.323) * (-1298.115) [-1295.173] (-1299.647) (-1301.584) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-1300.609) (-1296.329) [-1296.298] (-1298.135) * (-1298.053) (-1298.576) [-1304.361] (-1296.296) -- 0:03:00
       6000 -- (-1296.817) (-1301.513) (-1300.686) [-1294.020] * [-1294.880] (-1296.980) (-1302.086) (-1294.154) -- 0:02:45
       6500 -- (-1294.075) [-1297.996] (-1301.800) (-1308.041) * (-1304.028) (-1301.503) (-1297.546) [-1297.462] -- 0:02:32
       7000 -- [-1295.289] (-1296.636) (-1310.244) (-1299.205) * (-1304.653) (-1298.937) (-1297.018) [-1294.606] -- 0:02:21
       7500 -- (-1300.445) [-1302.580] (-1298.186) (-1296.178) * (-1313.566) [-1301.720] (-1298.725) (-1298.414) -- 0:02:12
       8000 -- [-1298.682] (-1296.285) (-1299.645) (-1297.438) * (-1309.264) (-1301.573) (-1294.971) [-1297.996] -- 0:02:04
       8500 -- (-1296.971) [-1296.805] (-1298.899) (-1298.657) * (-1309.676) (-1295.944) [-1293.263] (-1294.455) -- 0:03:53
       9000 -- (-1295.222) (-1296.176) [-1298.930] (-1303.037) * (-1304.969) (-1298.429) (-1297.157) [-1295.341] -- 0:03:40
       9500 -- (-1295.911) (-1302.454) (-1300.428) [-1301.569] * (-1314.084) (-1295.939) [-1294.787] (-1297.851) -- 0:03:28
      10000 -- (-1297.529) [-1297.251] (-1301.560) (-1296.936) * (-1303.574) [-1301.924] (-1300.468) (-1295.488) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-1305.379) [-1292.324] (-1294.571) (-1298.983) * (-1303.160) (-1299.829) [-1296.615] (-1295.381) -- 0:03:08
      11000 -- (-1299.108) [-1293.573] (-1297.762) (-1299.672) * (-1310.499) (-1299.618) (-1295.137) [-1295.922] -- 0:02:59
      11500 -- (-1302.156) [-1299.669] (-1300.349) (-1297.190) * (-1308.982) (-1300.469) [-1295.615] (-1300.505) -- 0:02:51
      12000 -- (-1302.003) (-1299.065) [-1299.700] (-1293.437) * [-1313.132] (-1300.523) (-1296.059) (-1296.128) -- 0:02:44
      12500 -- (-1303.200) (-1295.811) (-1299.580) [-1295.811] * (-1302.139) (-1299.289) [-1294.186] (-1301.334) -- 0:02:38
      13000 -- (-1304.425) (-1294.643) [-1299.824] (-1300.976) * [-1301.477] (-1297.611) (-1299.814) (-1300.006) -- 0:02:31
      13500 -- (-1297.721) (-1300.688) (-1299.545) [-1296.375] * (-1307.384) [-1294.682] (-1298.131) (-1295.536) -- 0:02:26
      14000 -- (-1299.399) (-1306.227) [-1293.577] (-1298.786) * (-1301.428) [-1295.279] (-1299.155) (-1298.426) -- 0:02:20
      14500 -- (-1298.798) (-1297.214) (-1297.614) [-1299.527] * (-1307.103) (-1305.149) [-1299.445] (-1299.811) -- 0:03:23
      15000 -- (-1296.526) (-1298.360) (-1296.336) [-1296.832] * (-1299.857) (-1300.792) (-1302.723) [-1298.416] -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-1291.594) (-1299.388) (-1301.846) [-1296.622] * [-1297.661] (-1300.936) (-1300.823) (-1302.109) -- 0:03:10
      16000 -- (-1296.122) [-1300.641] (-1293.219) (-1298.652) * (-1294.859) (-1298.423) (-1291.906) [-1296.157] -- 0:03:04
      16500 -- [-1297.743] (-1298.329) (-1293.626) (-1298.397) * (-1300.858) (-1304.183) [-1296.054] (-1296.600) -- 0:02:58
      17000 -- (-1300.236) (-1297.826) [-1296.370] (-1298.322) * (-1294.563) (-1295.027) (-1296.403) [-1300.163] -- 0:02:53
      17500 -- (-1298.925) [-1301.613] (-1295.642) (-1300.108) * (-1297.075) (-1291.688) [-1296.123] (-1297.898) -- 0:02:48
      18000 -- (-1297.508) [-1294.539] (-1294.373) (-1295.362) * [-1297.381] (-1294.091) (-1296.681) (-1297.436) -- 0:02:43
      18500 -- (-1302.869) (-1297.878) (-1292.982) [-1296.409] * (-1300.315) [-1296.172] (-1294.893) (-1295.403) -- 0:02:39
      19000 -- (-1302.612) (-1294.382) (-1295.603) [-1290.787] * (-1299.186) (-1301.826) (-1297.943) [-1294.828] -- 0:02:34
      19500 -- (-1298.284) (-1293.904) (-1292.800) [-1293.343] * (-1296.866) (-1306.356) (-1299.036) [-1298.125] -- 0:02:30
      20000 -- (-1300.896) (-1297.621) [-1296.229] (-1297.389) * (-1296.449) (-1303.102) [-1298.385] (-1299.177) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-1303.794) (-1299.745) [-1294.992] (-1293.220) * [-1293.369] (-1305.884) (-1301.326) (-1300.247) -- 0:03:11
      21000 -- (-1304.686) [-1294.962] (-1299.130) (-1296.176) * (-1298.474) (-1296.461) [-1294.752] (-1296.093) -- 0:03:06
      21500 -- (-1298.167) (-1293.331) [-1299.522] (-1296.692) * (-1300.277) (-1296.738) [-1299.322] (-1295.762) -- 0:03:02
      22000 -- (-1297.314) (-1299.735) (-1298.193) [-1296.129] * [-1296.543] (-1296.018) (-1304.682) (-1304.228) -- 0:02:57
      22500 -- (-1297.190) [-1297.012] (-1302.034) (-1299.511) * (-1296.127) (-1299.270) (-1305.416) [-1297.354] -- 0:02:53
      23000 -- (-1300.517) (-1301.611) (-1295.336) [-1295.754] * (-1295.707) (-1293.448) (-1317.492) [-1300.143] -- 0:02:49
      23500 -- (-1297.577) (-1298.643) (-1301.134) [-1293.070] * (-1302.250) (-1297.253) [-1309.407] (-1299.784) -- 0:02:46
      24000 -- (-1301.356) (-1298.866) [-1299.776] (-1293.559) * (-1296.027) (-1291.856) (-1306.440) [-1297.315] -- 0:02:42
      24500 -- (-1298.614) [-1298.179] (-1300.500) (-1294.191) * (-1298.310) [-1298.618] (-1301.297) (-1304.157) -- 0:02:39
      25000 -- [-1299.130] (-1296.262) (-1301.419) (-1293.819) * (-1296.181) (-1303.774) (-1302.935) [-1299.119] -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-1296.490) (-1301.941) (-1297.584) [-1297.257] * [-1294.053] (-1296.570) (-1297.332) (-1299.174) -- 0:02:32
      26000 -- (-1298.386) [-1297.106] (-1292.612) (-1297.834) * [-1294.862] (-1299.006) (-1302.217) (-1304.272) -- 0:02:29
      26500 -- (-1298.915) (-1302.127) (-1295.070) [-1298.638] * [-1294.969] (-1302.126) (-1297.237) (-1296.295) -- 0:03:03
      27000 -- (-1299.413) (-1310.082) [-1295.034] (-1303.171) * (-1298.056) [-1303.110] (-1299.519) (-1298.668) -- 0:03:00
      27500 -- (-1302.370) [-1296.109] (-1294.552) (-1298.776) * [-1296.338] (-1295.521) (-1302.716) (-1297.914) -- 0:02:56
      28000 -- (-1296.007) (-1297.555) [-1296.641] (-1305.653) * [-1293.972] (-1298.186) (-1304.061) (-1299.699) -- 0:02:53
      28500 -- [-1292.842] (-1299.738) (-1295.222) (-1295.788) * (-1299.444) (-1300.022) [-1295.505] (-1295.766) -- 0:02:50
      29000 -- (-1299.255) (-1294.173) (-1300.237) [-1299.239] * (-1295.882) [-1295.553] (-1297.730) (-1297.804) -- 0:02:47
      29500 -- [-1299.463] (-1293.925) (-1303.008) (-1294.434) * (-1295.712) (-1296.684) [-1292.269] (-1305.780) -- 0:02:44
      30000 -- (-1298.197) (-1294.311) [-1304.134] (-1303.137) * [-1299.498] (-1299.849) (-1294.783) (-1306.730) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-1299.501) (-1296.385) [-1301.316] (-1301.540) * (-1298.680) (-1300.486) (-1297.057) [-1300.598] -- 0:02:38
      31000 -- (-1300.820) (-1307.489) [-1293.432] (-1301.955) * [-1298.048] (-1298.453) (-1298.302) (-1302.016) -- 0:02:36
      31500 -- (-1304.694) (-1304.419) [-1295.188] (-1304.691) * (-1295.235) (-1298.506) [-1297.380] (-1297.479) -- 0:02:33
      32000 -- (-1301.405) (-1307.575) [-1299.085] (-1302.394) * [-1298.297] (-1299.427) (-1298.484) (-1306.609) -- 0:03:01
      32500 -- (-1298.512) (-1309.466) [-1291.622] (-1300.959) * (-1298.382) (-1303.699) [-1297.048] (-1295.480) -- 0:02:58
      33000 -- (-1296.874) (-1308.994) [-1296.369] (-1299.665) * [-1295.463] (-1300.567) (-1297.909) (-1294.992) -- 0:02:55
      33500 -- (-1296.316) (-1303.310) (-1296.267) [-1300.942] * (-1304.221) [-1292.824] (-1299.186) (-1296.464) -- 0:02:53
      34000 -- (-1302.604) [-1302.608] (-1301.492) (-1297.806) * (-1299.043) (-1297.936) [-1298.720] (-1302.985) -- 0:02:50
      34500 -- (-1305.398) (-1297.427) [-1297.413] (-1301.923) * [-1297.977] (-1295.528) (-1297.175) (-1298.695) -- 0:02:47
      35000 -- [-1295.877] (-1301.188) (-1298.460) (-1305.162) * [-1303.633] (-1295.413) (-1299.228) (-1297.774) -- 0:02:45

      Average standard deviation of split frequencies: 0.006547

      35500 -- [-1298.139] (-1294.448) (-1302.682) (-1301.259) * (-1298.172) [-1294.073] (-1299.607) (-1297.698) -- 0:02:43
      36000 -- (-1304.074) [-1300.123] (-1304.839) (-1301.795) * (-1298.630) (-1302.014) (-1295.587) [-1297.536] -- 0:02:40
      36500 -- (-1312.234) [-1298.356] (-1305.218) (-1294.707) * [-1296.949] (-1298.046) (-1302.976) (-1302.269) -- 0:02:38
      37000 -- (-1302.074) (-1298.090) [-1302.241] (-1297.645) * (-1295.128) (-1299.511) [-1299.735] (-1298.492) -- 0:02:36
      37500 -- (-1299.664) (-1294.340) (-1301.016) [-1301.463] * [-1294.387] (-1302.237) (-1295.977) (-1302.509) -- 0:02:34
      38000 -- (-1305.195) (-1295.482) (-1300.619) [-1300.024] * [-1300.505] (-1300.317) (-1298.497) (-1294.721) -- 0:02:57
      38500 -- (-1296.750) (-1305.065) [-1299.922] (-1303.428) * (-1298.141) (-1294.956) [-1298.484] (-1298.708) -- 0:02:54
      39000 -- (-1299.495) (-1304.612) (-1300.232) [-1303.454] * [-1299.406] (-1297.284) (-1304.903) (-1301.730) -- 0:02:52
      39500 -- [-1294.983] (-1301.783) (-1297.998) (-1301.773) * (-1299.522) [-1297.858] (-1305.502) (-1296.161) -- 0:02:50
      40000 -- (-1302.912) [-1304.044] (-1301.639) (-1298.570) * (-1292.293) (-1299.147) [-1302.398] (-1306.011) -- 0:02:48

      Average standard deviation of split frequencies: 0.011592

      40500 -- (-1300.000) (-1299.259) (-1302.171) [-1300.315] * (-1299.036) (-1294.155) (-1301.203) [-1299.070] -- 0:02:45
      41000 -- (-1301.817) (-1302.251) (-1304.448) [-1310.803] * (-1296.421) (-1296.534) (-1298.171) [-1298.064] -- 0:02:43
      41500 -- (-1301.463) [-1299.181] (-1295.313) (-1315.959) * (-1300.080) [-1294.504] (-1303.985) (-1305.624) -- 0:02:41
      42000 -- (-1300.473) (-1300.029) (-1295.937) [-1298.377] * (-1311.433) (-1293.109) [-1294.508] (-1298.746) -- 0:02:39
      42500 -- (-1295.683) (-1294.245) [-1300.786] (-1305.946) * (-1301.524) [-1297.763] (-1302.194) (-1302.352) -- 0:02:37
      43000 -- (-1301.987) (-1296.567) [-1294.857] (-1296.961) * (-1304.042) (-1302.333) (-1302.620) [-1295.867] -- 0:02:35
      43500 -- (-1297.406) (-1295.036) [-1296.825] (-1295.812) * (-1297.487) [-1295.582] (-1305.487) (-1303.453) -- 0:02:33
      44000 -- (-1297.070) (-1296.146) (-1294.625) [-1292.575] * (-1295.733) [-1295.907] (-1301.226) (-1297.367) -- 0:02:53
      44500 -- (-1296.883) (-1298.889) [-1295.417] (-1297.052) * [-1294.811] (-1305.843) (-1300.318) (-1293.877) -- 0:02:51
      45000 -- (-1296.059) (-1298.341) (-1297.669) [-1304.302] * [-1301.826] (-1298.455) (-1300.971) (-1295.380) -- 0:02:49

      Average standard deviation of split frequencies: 0.010248

      45500 -- (-1298.482) (-1293.716) (-1303.539) [-1304.099] * (-1300.424) [-1296.022] (-1300.596) (-1294.747) -- 0:02:47
      46000 -- (-1297.313) [-1293.673] (-1300.673) (-1303.560) * (-1295.497) (-1298.176) (-1300.913) [-1294.045] -- 0:02:45
      46500 -- (-1298.283) [-1297.253] (-1307.442) (-1307.576) * (-1301.849) [-1297.727] (-1301.965) (-1295.682) -- 0:02:44
      47000 -- (-1309.443) [-1292.943] (-1297.767) (-1302.036) * [-1297.936] (-1296.326) (-1303.115) (-1296.484) -- 0:02:42
      47500 -- (-1303.019) (-1293.155) [-1299.929] (-1298.650) * (-1295.233) (-1294.099) [-1298.322] (-1298.418) -- 0:02:40
      48000 -- [-1297.300] (-1297.665) (-1303.246) (-1303.905) * (-1295.988) (-1296.702) (-1298.359) [-1297.151] -- 0:02:38
      48500 -- (-1301.473) [-1294.938] (-1301.566) (-1301.954) * (-1296.678) (-1297.020) [-1293.532] (-1296.478) -- 0:02:36
      49000 -- (-1304.662) (-1299.954) [-1300.898] (-1301.452) * (-1305.283) (-1296.746) [-1297.654] (-1297.708) -- 0:02:35
      49500 -- (-1299.247) [-1300.695] (-1298.737) (-1301.450) * [-1293.494] (-1295.119) (-1307.608) (-1295.448) -- 0:02:52
      50000 -- (-1297.426) (-1298.696) [-1300.532] (-1299.213) * [-1294.945] (-1297.426) (-1294.019) (-1304.015) -- 0:02:51

      Average standard deviation of split frequencies: 0.009304

      50500 -- (-1304.226) [-1296.182] (-1295.590) (-1297.946) * (-1293.818) [-1296.259] (-1297.374) (-1299.528) -- 0:02:49
      51000 -- (-1300.865) (-1298.030) (-1293.850) [-1300.155] * (-1298.084) [-1295.435] (-1299.536) (-1299.161) -- 0:02:47
      51500 -- (-1299.795) [-1298.641] (-1294.489) (-1299.474) * (-1302.149) [-1296.837] (-1297.309) (-1302.559) -- 0:02:45
      52000 -- (-1297.783) [-1298.380] (-1293.034) (-1298.118) * (-1301.533) (-1297.519) (-1299.466) [-1296.766] -- 0:02:44
      52500 -- (-1295.518) (-1309.294) (-1302.823) [-1296.613] * (-1300.459) [-1300.069] (-1300.454) (-1300.020) -- 0:02:42
      53000 -- (-1297.701) (-1302.328) [-1298.970] (-1298.099) * [-1295.027] (-1297.540) (-1305.916) (-1296.504) -- 0:02:40
      53500 -- (-1298.699) [-1299.334] (-1296.720) (-1294.624) * (-1308.793) [-1299.092] (-1300.315) (-1294.134) -- 0:02:39
      54000 -- [-1295.294] (-1299.768) (-1297.268) (-1298.724) * (-1297.576) (-1298.196) (-1298.989) [-1294.424] -- 0:02:37
      54500 -- (-1303.405) [-1295.598] (-1298.146) (-1295.649) * (-1298.013) [-1301.293] (-1298.522) (-1296.544) -- 0:02:36
      55000 -- (-1301.460) [-1296.897] (-1300.267) (-1304.085) * (-1301.467) [-1300.708] (-1295.311) (-1296.978) -- 0:02:34

      Average standard deviation of split frequencies: 0.008418

      55500 -- (-1306.819) (-1293.802) (-1303.634) [-1298.333] * (-1294.470) [-1309.811] (-1301.483) (-1292.529) -- 0:02:50
      56000 -- (-1296.720) (-1295.752) [-1296.904] (-1296.623) * (-1298.057) (-1300.738) [-1295.314] (-1296.682) -- 0:02:48
      56500 -- (-1298.373) (-1295.380) [-1298.728] (-1294.675) * (-1301.331) [-1297.731] (-1298.774) (-1294.342) -- 0:02:46
      57000 -- (-1296.540) (-1296.225) (-1302.191) [-1297.802] * (-1298.669) [-1297.771] (-1308.064) (-1300.823) -- 0:02:45
      57500 -- (-1304.376) (-1295.790) [-1297.473] (-1298.791) * [-1293.579] (-1302.409) (-1297.522) (-1300.940) -- 0:02:43
      58000 -- (-1301.923) [-1297.965] (-1295.893) (-1300.042) * (-1298.539) (-1306.100) (-1300.829) [-1295.626] -- 0:02:42
      58500 -- [-1300.225] (-1300.937) (-1295.426) (-1303.399) * [-1304.173] (-1299.870) (-1300.648) (-1300.732) -- 0:02:40
      59000 -- (-1299.336) (-1303.115) (-1299.087) [-1298.488] * (-1301.935) (-1303.936) [-1300.498] (-1296.079) -- 0:02:39
      59500 -- (-1296.756) [-1302.928] (-1300.940) (-1301.802) * (-1303.557) [-1298.419] (-1295.807) (-1302.750) -- 0:02:38
      60000 -- [-1293.766] (-1303.897) (-1295.904) (-1300.234) * (-1297.003) (-1303.510) [-1295.487] (-1296.900) -- 0:02:36

      Average standard deviation of split frequencies: 0.011656

      60500 -- (-1294.581) [-1298.522] (-1296.131) (-1298.019) * (-1296.936) (-1301.409) (-1303.959) [-1296.432] -- 0:02:35
      61000 -- (-1292.163) (-1305.290) (-1294.395) [-1296.278] * [-1296.342] (-1306.138) (-1306.032) (-1297.388) -- 0:02:33
      61500 -- (-1298.410) (-1300.023) (-1300.146) [-1294.630] * [-1300.477] (-1299.153) (-1302.102) (-1295.812) -- 0:02:47
      62000 -- (-1295.267) (-1303.278) [-1296.432] (-1294.830) * (-1301.053) (-1304.104) [-1300.479] (-1300.292) -- 0:02:46
      62500 -- (-1298.019) (-1296.046) (-1296.303) [-1298.447] * (-1303.898) (-1301.402) [-1298.611] (-1294.383) -- 0:02:45
      63000 -- (-1298.927) (-1302.148) (-1300.049) [-1296.387] * [-1299.752] (-1302.663) (-1301.187) (-1295.744) -- 0:02:43
      63500 -- (-1302.604) (-1307.290) (-1303.055) [-1296.231] * (-1296.644) [-1298.523] (-1302.422) (-1302.612) -- 0:02:42
      64000 -- (-1301.929) (-1298.288) (-1295.339) [-1293.529] * (-1303.411) (-1296.941) (-1303.193) [-1297.965] -- 0:02:40
      64500 -- (-1298.418) [-1299.311] (-1296.727) (-1298.825) * (-1300.213) [-1299.281] (-1299.022) (-1297.366) -- 0:02:39
      65000 -- (-1304.499) [-1299.580] (-1300.636) (-1296.610) * (-1302.161) (-1296.445) [-1298.104] (-1296.442) -- 0:02:38

      Average standard deviation of split frequencies: 0.010714

      65500 -- [-1313.328] (-1301.602) (-1302.035) (-1305.275) * (-1308.253) (-1296.319) [-1300.498] (-1297.788) -- 0:02:36
      66000 -- (-1303.527) [-1295.147] (-1300.866) (-1305.375) * (-1303.684) (-1294.918) [-1301.471] (-1302.677) -- 0:02:35
      66500 -- (-1301.543) [-1293.888] (-1296.457) (-1298.930) * (-1304.777) [-1296.043] (-1298.498) (-1308.249) -- 0:02:34
      67000 -- (-1302.691) (-1300.301) [-1296.551] (-1301.909) * (-1299.922) (-1292.145) (-1301.033) [-1302.825] -- 0:02:47
      67500 -- (-1305.558) (-1297.311) [-1298.435] (-1300.581) * (-1297.845) (-1299.654) [-1300.795] (-1301.330) -- 0:02:45
      68000 -- [-1298.738] (-1292.493) (-1300.350) (-1296.122) * [-1294.736] (-1303.369) (-1295.916) (-1299.718) -- 0:02:44
      68500 -- [-1301.131] (-1295.992) (-1303.386) (-1303.116) * (-1295.384) (-1298.545) [-1296.669] (-1303.408) -- 0:02:43
      69000 -- (-1294.823) (-1304.719) (-1301.151) [-1291.868] * (-1297.954) [-1294.278] (-1298.715) (-1297.667) -- 0:02:41
      69500 -- (-1299.520) (-1298.988) [-1295.687] (-1295.815) * [-1298.750] (-1292.840) (-1299.168) (-1297.291) -- 0:02:40
      70000 -- (-1303.334) (-1301.050) (-1294.135) [-1294.117] * (-1296.758) (-1297.839) [-1297.264] (-1295.743) -- 0:02:39

      Average standard deviation of split frequencies: 0.010006

      70500 -- (-1299.014) [-1298.301] (-1301.012) (-1301.084) * (-1298.643) [-1298.696] (-1300.110) (-1297.345) -- 0:02:38
      71000 -- (-1305.606) (-1298.351) (-1294.994) [-1303.382] * [-1299.372] (-1300.433) (-1302.146) (-1295.467) -- 0:02:37
      71500 -- (-1299.930) (-1298.486) [-1296.204] (-1295.280) * [-1293.234] (-1297.902) (-1299.059) (-1296.877) -- 0:02:35
      72000 -- (-1305.529) (-1296.018) [-1298.252] (-1294.425) * (-1299.161) (-1300.766) [-1297.575] (-1304.045) -- 0:02:34
      72500 -- (-1311.080) (-1295.799) (-1294.884) [-1303.692] * [-1296.802] (-1302.363) (-1305.044) (-1302.892) -- 0:02:33
      73000 -- (-1303.022) (-1299.372) [-1296.282] (-1297.687) * (-1302.210) [-1297.507] (-1296.780) (-1295.620) -- 0:02:45
      73500 -- (-1298.035) (-1295.794) (-1296.540) [-1296.899] * (-1301.937) (-1301.359) (-1300.931) [-1298.594] -- 0:02:43
      74000 -- (-1302.176) [-1296.699] (-1297.632) (-1296.873) * [-1305.640] (-1298.164) (-1301.451) (-1298.250) -- 0:02:42
      74500 -- [-1309.534] (-1301.015) (-1300.998) (-1299.518) * (-1312.504) [-1297.988] (-1296.081) (-1297.245) -- 0:02:41
      75000 -- (-1302.799) (-1301.578) [-1299.801] (-1305.504) * [-1297.963] (-1300.819) (-1293.516) (-1298.939) -- 0:02:40

      Average standard deviation of split frequencies: 0.009304

      75500 -- (-1305.561) [-1295.904] (-1300.838) (-1304.014) * (-1296.146) [-1295.820] (-1301.810) (-1300.911) -- 0:02:39
      76000 -- (-1301.623) (-1297.508) [-1295.509] (-1308.112) * (-1294.334) (-1300.848) (-1297.050) [-1300.753] -- 0:02:38
      76500 -- [-1299.579] (-1300.188) (-1298.948) (-1305.823) * (-1303.253) (-1305.775) (-1298.963) [-1302.614] -- 0:02:36
      77000 -- [-1298.291] (-1297.505) (-1292.889) (-1298.012) * [-1296.634] (-1300.640) (-1300.615) (-1300.619) -- 0:02:35
      77500 -- (-1301.777) (-1297.916) (-1295.777) [-1301.218] * (-1304.567) [-1301.582] (-1301.837) (-1303.892) -- 0:02:34
      78000 -- (-1307.726) [-1300.910] (-1294.132) (-1294.259) * (-1298.473) [-1301.810] (-1297.361) (-1302.470) -- 0:02:33
      78500 -- (-1301.884) (-1294.228) [-1293.988] (-1299.707) * (-1305.382) (-1293.243) [-1296.173] (-1299.115) -- 0:02:44
      79000 -- (-1299.208) [-1297.451] (-1297.443) (-1294.684) * (-1296.492) (-1302.004) [-1299.370] (-1294.691) -- 0:02:43
      79500 -- (-1301.195) [-1298.036] (-1299.973) (-1296.454) * [-1293.984] (-1299.826) (-1300.731) (-1300.153) -- 0:02:42
      80000 -- (-1295.533) [-1302.820] (-1299.518) (-1297.232) * (-1296.791) (-1308.320) (-1298.953) [-1294.757] -- 0:02:41

      Average standard deviation of split frequencies: 0.008766

      80500 -- (-1301.677) [-1297.082] (-1296.791) (-1297.847) * [-1294.324] (-1305.615) (-1301.022) (-1292.329) -- 0:02:39
      81000 -- (-1303.699) (-1292.195) [-1299.974] (-1298.189) * (-1296.630) [-1308.450] (-1294.816) (-1295.244) -- 0:02:38
      81500 -- (-1300.786) (-1295.633) (-1296.795) [-1297.776] * (-1299.948) (-1307.940) (-1296.148) [-1294.642] -- 0:02:37
      82000 -- (-1295.842) (-1299.850) (-1305.720) [-1293.549] * (-1298.818) (-1296.210) [-1297.990] (-1298.802) -- 0:02:36
      82500 -- (-1299.384) [-1299.171] (-1299.129) (-1308.152) * (-1299.310) [-1299.904] (-1300.369) (-1293.691) -- 0:02:35
      83000 -- (-1298.044) (-1303.568) (-1301.917) [-1295.618] * [-1297.376] (-1301.357) (-1302.150) (-1294.580) -- 0:02:34
      83500 -- (-1295.809) (-1306.804) (-1302.851) [-1302.716] * [-1293.717] (-1300.409) (-1300.600) (-1294.980) -- 0:02:33
      84000 -- (-1296.156) [-1298.745] (-1300.738) (-1297.170) * (-1295.102) [-1304.394] (-1299.757) (-1296.990) -- 0:02:32
      84500 -- [-1301.760] (-1301.321) (-1293.495) (-1294.786) * (-1296.786) (-1299.591) (-1303.824) [-1297.235] -- 0:02:42
      85000 -- (-1305.208) [-1306.973] (-1298.383) (-1296.472) * (-1301.522) (-1304.133) (-1299.500) [-1302.218] -- 0:02:41

      Average standard deviation of split frequencies: 0.008222

      85500 -- (-1303.404) (-1301.081) [-1303.093] (-1300.548) * (-1297.131) (-1300.624) [-1294.644] (-1299.908) -- 0:02:40
      86000 -- (-1301.257) (-1298.574) (-1304.622) [-1299.988] * (-1299.752) (-1308.675) [-1298.402] (-1301.213) -- 0:02:39
      86500 -- (-1294.002) [-1300.949] (-1304.391) (-1304.953) * (-1308.495) (-1304.053) [-1297.328] (-1300.674) -- 0:02:38
      87000 -- [-1297.053] (-1293.851) (-1299.161) (-1301.912) * (-1315.896) (-1299.915) [-1305.150] (-1298.857) -- 0:02:37
      87500 -- (-1298.886) (-1296.084) (-1306.411) [-1298.721] * (-1301.166) (-1302.775) [-1307.063] (-1300.470) -- 0:02:36
      88000 -- [-1297.783] (-1298.131) (-1310.318) (-1299.084) * (-1300.417) [-1298.559] (-1296.757) (-1301.139) -- 0:02:35
      88500 -- (-1298.322) [-1299.583] (-1308.352) (-1299.366) * (-1301.995) (-1307.968) [-1297.542] (-1301.185) -- 0:02:34
      89000 -- (-1301.040) (-1300.965) (-1302.061) [-1302.162] * (-1302.600) [-1309.527] (-1295.200) (-1299.838) -- 0:02:33
      89500 -- (-1300.015) (-1295.727) (-1301.141) [-1304.991] * [-1295.497] (-1307.205) (-1296.293) (-1300.008) -- 0:02:32
      90000 -- (-1297.641) (-1302.320) [-1299.441] (-1300.767) * (-1297.398) (-1314.478) [-1294.314] (-1302.645) -- 0:02:41

      Average standard deviation of split frequencies: 0.007799

      90500 -- [-1297.449] (-1299.425) (-1299.159) (-1302.885) * (-1298.742) (-1315.922) (-1298.114) [-1302.578] -- 0:02:40
      91000 -- [-1294.721] (-1296.236) (-1302.295) (-1299.973) * (-1298.610) (-1309.552) (-1294.131) [-1296.582] -- 0:02:39
      91500 -- (-1297.411) (-1298.666) (-1302.923) [-1296.355] * (-1298.185) [-1300.024] (-1298.946) (-1296.245) -- 0:02:38
      92000 -- (-1300.206) (-1300.761) [-1301.528] (-1302.305) * (-1296.019) (-1304.098) [-1292.471] (-1300.475) -- 0:02:37
      92500 -- (-1298.658) [-1295.683] (-1294.935) (-1301.355) * (-1297.473) (-1300.094) (-1297.975) [-1297.458] -- 0:02:36
      93000 -- [-1293.484] (-1300.436) (-1293.510) (-1304.936) * (-1297.898) (-1302.220) (-1300.243) [-1300.869] -- 0:02:36
      93500 -- (-1297.703) [-1294.625] (-1298.112) (-1311.380) * (-1301.502) [-1299.995] (-1302.481) (-1296.342) -- 0:02:35
      94000 -- (-1305.836) (-1296.925) [-1295.944] (-1301.938) * (-1298.840) (-1299.682) [-1297.607] (-1299.353) -- 0:02:34
      94500 -- [-1295.825] (-1297.680) (-1303.670) (-1306.218) * [-1293.503] (-1300.834) (-1295.158) (-1301.976) -- 0:02:33
      95000 -- (-1306.680) (-1298.795) [-1295.672] (-1297.408) * (-1301.643) (-1296.521) (-1298.967) [-1296.495] -- 0:02:32

      Average standard deviation of split frequencies: 0.007366

      95500 -- [-1296.101] (-1294.920) (-1297.161) (-1300.503) * (-1297.076) (-1305.282) [-1299.101] (-1299.342) -- 0:02:31
      96000 -- (-1304.925) (-1297.878) [-1298.088] (-1301.725) * (-1297.116) (-1297.123) (-1296.687) [-1297.643] -- 0:02:40
      96500 -- (-1300.557) [-1293.436] (-1304.517) (-1294.155) * (-1297.723) (-1311.484) [-1297.454] (-1299.840) -- 0:02:39
      97000 -- (-1301.246) [-1297.133] (-1302.227) (-1297.991) * (-1298.684) (-1302.136) (-1298.481) [-1298.882] -- 0:02:38
      97500 -- (-1299.989) (-1295.535) (-1311.443) [-1297.330] * [-1305.177] (-1311.171) (-1295.730) (-1297.040) -- 0:02:37
      98000 -- (-1299.037) [-1298.113] (-1302.983) (-1292.370) * (-1296.915) (-1301.830) (-1300.557) [-1298.035] -- 0:02:36
      98500 -- (-1299.549) (-1297.466) [-1301.321] (-1297.817) * (-1298.488) [-1295.588] (-1296.723) (-1296.323) -- 0:02:35
      99000 -- [-1296.661] (-1302.329) (-1297.235) (-1295.868) * (-1300.592) (-1292.901) [-1296.335] (-1298.349) -- 0:02:34
      99500 -- [-1296.658] (-1304.205) (-1301.402) (-1297.825) * [-1297.273] (-1298.350) (-1297.197) (-1305.478) -- 0:02:33
      100000 -- (-1304.188) [-1295.754] (-1298.832) (-1301.858) * [-1296.979] (-1294.637) (-1302.246) (-1296.979) -- 0:02:33

      Average standard deviation of split frequencies: 0.007024

      100500 -- (-1303.248) [-1296.311] (-1298.163) (-1299.311) * (-1297.705) (-1300.394) [-1302.605] (-1302.371) -- 0:02:32
      101000 -- (-1299.743) [-1297.861] (-1302.787) (-1296.842) * (-1296.820) (-1294.914) [-1296.699] (-1300.934) -- 0:02:31
      101500 -- (-1301.154) (-1294.420) [-1297.331] (-1311.273) * [-1292.455] (-1297.307) (-1300.259) (-1300.779) -- 0:02:30
      102000 -- (-1303.161) (-1295.455) [-1301.679] (-1299.464) * [-1294.141] (-1300.627) (-1299.935) (-1300.691) -- 0:02:38
      102500 -- (-1304.939) (-1305.268) (-1301.667) [-1292.108] * [-1296.854] (-1298.290) (-1298.339) (-1303.591) -- 0:02:37
      103000 -- (-1300.451) (-1292.981) (-1297.040) [-1292.824] * [-1294.871] (-1302.240) (-1299.559) (-1310.159) -- 0:02:36
      103500 -- (-1301.347) (-1295.229) [-1294.672] (-1301.087) * [-1298.382] (-1294.986) (-1299.844) (-1305.145) -- 0:02:35
      104000 -- [-1296.551] (-1295.836) (-1302.550) (-1297.331) * (-1299.689) [-1296.155] (-1301.879) (-1304.739) -- 0:02:35
      104500 -- (-1298.617) [-1301.656] (-1293.948) (-1298.496) * [-1298.453] (-1296.860) (-1298.336) (-1305.595) -- 0:02:34
      105000 -- (-1307.857) (-1300.066) (-1298.670) [-1293.349] * [-1291.969] (-1302.529) (-1299.757) (-1309.451) -- 0:02:33

      Average standard deviation of split frequencies: 0.006671

      105500 -- (-1298.695) (-1295.822) [-1297.155] (-1298.960) * (-1299.807) (-1306.369) [-1297.435] (-1313.759) -- 0:02:32
      106000 -- [-1309.120] (-1299.767) (-1295.795) (-1303.338) * (-1299.530) (-1300.438) [-1298.432] (-1309.043) -- 0:02:31
      106500 -- [-1299.320] (-1298.341) (-1295.080) (-1295.675) * (-1301.396) [-1300.627] (-1298.272) (-1308.879) -- 0:02:31
      107000 -- (-1302.235) [-1303.381] (-1295.125) (-1296.045) * (-1312.621) (-1294.713) [-1299.954] (-1305.453) -- 0:02:30
      107500 -- (-1304.341) [-1294.246] (-1296.839) (-1297.542) * (-1303.727) [-1296.382] (-1299.441) (-1314.384) -- 0:02:37
      108000 -- (-1304.850) [-1301.548] (-1296.229) (-1300.638) * (-1308.437) (-1300.785) [-1297.453] (-1309.592) -- 0:02:36
      108500 -- (-1299.714) (-1300.403) [-1296.858] (-1296.837) * (-1300.699) [-1297.756] (-1300.661) (-1305.927) -- 0:02:36
      109000 -- [-1306.424] (-1301.720) (-1304.242) (-1294.310) * (-1303.074) [-1298.835] (-1298.174) (-1305.324) -- 0:02:35
      109500 -- (-1305.096) (-1297.977) [-1297.391] (-1296.137) * (-1298.966) [-1297.816] (-1295.654) (-1307.125) -- 0:02:34
      110000 -- (-1304.377) (-1299.316) (-1298.510) [-1296.052] * (-1300.081) [-1296.226] (-1299.546) (-1303.195) -- 0:02:33

      Average standard deviation of split frequencies: 0.006390

      110500 -- (-1306.102) (-1301.797) (-1298.104) [-1298.635] * (-1296.650) (-1299.308) (-1302.245) [-1297.122] -- 0:02:32
      111000 -- (-1299.490) (-1301.250) (-1298.737) [-1295.475] * (-1301.671) [-1295.589] (-1297.851) (-1297.129) -- 0:02:32
      111500 -- [-1299.146] (-1300.172) (-1308.158) (-1296.613) * (-1298.561) [-1293.321] (-1294.119) (-1298.294) -- 0:02:31
      112000 -- (-1293.852) (-1307.521) (-1299.259) [-1297.843] * (-1296.621) [-1300.584] (-1297.800) (-1299.662) -- 0:02:30
      112500 -- (-1294.858) (-1300.910) (-1296.722) [-1297.282] * [-1295.950] (-1295.901) (-1298.154) (-1297.877) -- 0:02:29
      113000 -- (-1297.759) (-1296.712) [-1295.317] (-1298.103) * (-1300.243) (-1298.626) [-1297.252] (-1301.905) -- 0:02:29
      113500 -- (-1294.491) [-1300.147] (-1298.409) (-1295.874) * (-1298.769) (-1294.199) (-1302.395) [-1300.261] -- 0:02:36
      114000 -- (-1295.379) [-1302.991] (-1298.733) (-1299.142) * (-1296.761) (-1298.480) (-1297.750) [-1305.536] -- 0:02:35
      114500 -- (-1299.947) (-1298.516) [-1299.211] (-1301.213) * (-1306.717) [-1294.997] (-1304.235) (-1298.523) -- 0:02:34
      115000 -- (-1299.403) [-1301.060] (-1297.717) (-1305.008) * (-1299.139) [-1298.290] (-1297.962) (-1304.867) -- 0:02:33

      Average standard deviation of split frequencies: 0.006096

      115500 -- [-1294.608] (-1298.714) (-1298.648) (-1309.452) * [-1294.720] (-1297.671) (-1295.323) (-1298.636) -- 0:02:33
      116000 -- (-1300.888) [-1297.945] (-1297.616) (-1309.678) * (-1297.322) (-1306.603) [-1296.655] (-1300.103) -- 0:02:32
      116500 -- [-1296.083] (-1294.820) (-1299.454) (-1300.106) * (-1300.544) (-1294.120) (-1296.325) [-1299.448] -- 0:02:31
      117000 -- (-1301.121) (-1304.952) [-1302.353] (-1300.563) * (-1298.105) (-1295.310) [-1293.977] (-1298.562) -- 0:02:30
      117500 -- (-1295.993) (-1298.888) (-1301.195) [-1297.512] * (-1299.365) (-1296.879) [-1298.316] (-1295.535) -- 0:02:30
      118000 -- (-1295.641) [-1303.188] (-1299.245) (-1297.844) * [-1295.852] (-1296.916) (-1306.547) (-1298.798) -- 0:02:29
      118500 -- (-1300.296) (-1294.771) [-1294.364] (-1301.061) * (-1304.431) [-1296.151] (-1301.082) (-1294.303) -- 0:02:28
      119000 -- (-1298.138) (-1292.926) [-1296.071] (-1294.437) * [-1310.540] (-1302.975) (-1299.604) (-1297.552) -- 0:02:28
      119500 -- (-1293.248) (-1296.040) (-1301.449) [-1297.636] * (-1301.224) (-1295.850) [-1300.050] (-1300.069) -- 0:02:34
      120000 -- (-1298.949) (-1298.981) [-1304.931] (-1293.782) * (-1306.891) (-1294.763) (-1299.669) [-1299.328] -- 0:02:34

      Average standard deviation of split frequencies: 0.005860

      120500 -- (-1295.710) [-1298.776] (-1302.237) (-1300.714) * (-1304.155) [-1296.062] (-1300.558) (-1300.504) -- 0:02:33
      121000 -- (-1301.494) (-1298.209) (-1301.808) [-1295.987] * (-1303.897) (-1297.521) (-1298.719) [-1299.211] -- 0:02:32
      121500 -- (-1297.776) (-1299.121) (-1304.140) [-1308.945] * (-1298.772) (-1294.528) [-1292.688] (-1294.900) -- 0:02:31
      122000 -- (-1295.604) [-1299.084] (-1300.380) (-1302.295) * [-1295.254] (-1299.871) (-1300.474) (-1299.355) -- 0:02:31
      122500 -- [-1294.694] (-1294.474) (-1296.456) (-1302.385) * (-1298.978) (-1300.289) (-1308.782) [-1299.126] -- 0:02:30
      123000 -- [-1293.666] (-1295.482) (-1300.145) (-1310.680) * [-1295.275] (-1302.902) (-1297.628) (-1299.689) -- 0:02:29
      123500 -- (-1298.197) (-1302.671) (-1302.402) [-1301.136] * (-1299.277) (-1306.170) (-1301.851) [-1294.094] -- 0:02:29
      124000 -- (-1297.601) [-1296.320] (-1298.983) (-1311.613) * [-1299.151] (-1303.173) (-1308.108) (-1300.680) -- 0:02:28
      124500 -- (-1299.225) (-1298.891) [-1298.516] (-1301.789) * (-1303.407) (-1308.240) [-1295.637] (-1301.784) -- 0:02:27
      125000 -- [-1297.500] (-1294.499) (-1306.711) (-1306.573) * (-1297.656) [-1293.710] (-1296.778) (-1298.579) -- 0:02:34

      Average standard deviation of split frequencies: 0.003741

      125500 -- (-1301.879) [-1293.313] (-1295.303) (-1298.575) * (-1296.708) (-1293.788) [-1296.294] (-1302.587) -- 0:02:33
      126000 -- (-1296.084) [-1294.049] (-1298.377) (-1300.492) * (-1294.836) [-1303.281] (-1297.601) (-1304.028) -- 0:02:32
      126500 -- (-1301.810) (-1296.045) (-1307.660) [-1293.569] * [-1301.252] (-1295.220) (-1296.821) (-1300.811) -- 0:02:31
      127000 -- [-1297.500] (-1295.862) (-1303.518) (-1302.139) * [-1302.801] (-1297.120) (-1300.046) (-1299.824) -- 0:02:31
      127500 -- (-1295.721) [-1296.624] (-1301.744) (-1293.069) * (-1295.107) (-1296.996) (-1305.935) [-1298.881] -- 0:02:30
      128000 -- (-1297.846) (-1304.875) [-1295.460] (-1297.959) * (-1299.237) [-1295.238] (-1303.214) (-1299.382) -- 0:02:29
      128500 -- [-1300.806] (-1300.621) (-1297.237) (-1304.008) * (-1296.916) [-1299.129] (-1302.380) (-1298.594) -- 0:02:29
      129000 -- (-1303.792) [-1302.901] (-1301.946) (-1300.011) * (-1296.248) (-1298.746) (-1295.245) [-1295.894] -- 0:02:28
      129500 -- (-1298.428) (-1298.956) (-1301.650) [-1296.636] * (-1303.257) (-1298.949) (-1295.884) [-1298.082] -- 0:02:27
      130000 -- [-1297.223] (-1302.503) (-1299.243) (-1303.192) * [-1300.430] (-1301.006) (-1298.262) (-1301.977) -- 0:02:27

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-1307.658) [-1301.462] (-1302.526) (-1295.397) * (-1296.709) (-1304.575) (-1295.129) [-1297.907] -- 0:02:26
      131000 -- (-1297.215) (-1301.118) (-1302.740) [-1292.825] * [-1293.903] (-1300.462) (-1301.869) (-1300.417) -- 0:02:32
      131500 -- (-1296.203) (-1297.781) [-1293.983] (-1298.091) * (-1301.961) (-1301.757) [-1297.963] (-1309.370) -- 0:02:31
      132000 -- (-1298.199) [-1301.104] (-1302.552) (-1297.239) * (-1297.539) [-1296.433] (-1301.004) (-1302.250) -- 0:02:31
      132500 -- (-1304.146) (-1305.798) (-1304.528) [-1294.653] * [-1298.788] (-1298.091) (-1299.342) (-1307.219) -- 0:02:30
      133000 -- (-1307.159) (-1308.380) (-1307.816) [-1297.460] * (-1303.121) [-1299.175] (-1297.524) (-1292.234) -- 0:02:29
      133500 -- (-1297.437) (-1308.755) [-1297.767] (-1300.912) * [-1296.986] (-1293.453) (-1300.189) (-1300.409) -- 0:02:29
      134000 -- (-1299.295) (-1298.242) [-1295.570] (-1302.266) * (-1299.774) [-1294.778] (-1302.960) (-1294.503) -- 0:02:28
      134500 -- [-1296.022] (-1299.282) (-1298.141) (-1305.084) * (-1298.890) (-1296.333) (-1301.262) [-1300.019] -- 0:02:28
      135000 -- [-1294.002] (-1305.331) (-1297.656) (-1302.288) * (-1303.176) (-1296.028) (-1298.637) [-1298.738] -- 0:02:27

      Average standard deviation of split frequencies: 0.003466

      135500 -- (-1301.239) (-1308.048) (-1300.068) [-1294.848] * [-1302.151] (-1295.406) (-1298.955) (-1301.460) -- 0:02:26
      136000 -- [-1299.027] (-1306.977) (-1298.257) (-1298.330) * (-1305.902) [-1295.982] (-1295.822) (-1303.317) -- 0:02:26
      136500 -- [-1292.826] (-1305.866) (-1303.223) (-1299.509) * (-1306.516) (-1299.738) (-1300.733) [-1297.201] -- 0:02:25
      137000 -- [-1304.917] (-1305.376) (-1298.798) (-1297.244) * (-1305.877) (-1294.929) [-1301.982] (-1300.147) -- 0:02:31
      137500 -- [-1298.637] (-1303.957) (-1303.528) (-1293.391) * (-1299.571) [-1296.411] (-1305.055) (-1296.419) -- 0:02:30
      138000 -- [-1300.380] (-1304.176) (-1296.028) (-1294.903) * (-1301.899) [-1296.755] (-1297.605) (-1294.023) -- 0:02:29
      138500 -- [-1300.491] (-1305.778) (-1297.228) (-1296.295) * (-1305.517) (-1296.507) (-1300.123) [-1298.801] -- 0:02:29
      139000 -- (-1302.966) (-1303.879) [-1290.932] (-1292.215) * (-1303.471) (-1303.445) [-1295.944] (-1300.413) -- 0:02:28
      139500 -- [-1296.664] (-1308.677) (-1295.999) (-1296.897) * (-1306.271) (-1296.150) (-1298.100) [-1297.582] -- 0:02:28
      140000 -- (-1296.349) [-1298.213] (-1294.526) (-1297.429) * (-1301.935) (-1298.121) (-1296.236) [-1296.729] -- 0:02:27

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-1299.020) (-1299.869) [-1296.016] (-1296.201) * (-1303.213) (-1296.447) (-1302.137) [-1294.444] -- 0:02:26
      141000 -- (-1303.144) [-1298.938] (-1300.296) (-1295.187) * (-1300.777) [-1299.853] (-1298.029) (-1295.339) -- 0:02:26
      141500 -- (-1297.517) (-1298.027) (-1299.571) [-1294.695] * (-1298.386) (-1297.684) [-1295.421] (-1296.806) -- 0:02:25
      142000 -- (-1300.006) [-1295.618] (-1299.606) (-1300.469) * (-1301.645) [-1298.676] (-1297.617) (-1295.070) -- 0:02:25
      142500 -- (-1297.880) (-1294.150) (-1308.467) [-1298.336] * [-1297.176] (-1293.552) (-1303.508) (-1292.093) -- 0:02:24
      143000 -- [-1298.838] (-1299.363) (-1308.082) (-1296.161) * (-1300.243) [-1293.072] (-1306.702) (-1298.023) -- 0:02:29
      143500 -- (-1297.297) (-1296.568) [-1303.432] (-1299.091) * (-1298.112) (-1295.809) [-1296.099] (-1296.793) -- 0:02:29
      144000 -- [-1294.541] (-1296.375) (-1301.351) (-1304.510) * (-1295.990) (-1298.219) [-1299.555] (-1297.062) -- 0:02:28
      144500 -- (-1298.099) [-1298.732] (-1299.026) (-1293.256) * [-1301.934] (-1300.070) (-1301.074) (-1298.676) -- 0:02:28
      145000 -- (-1295.553) (-1298.393) (-1294.967) [-1290.904] * (-1297.119) (-1293.898) (-1303.150) [-1293.142] -- 0:02:27

      Average standard deviation of split frequencies: 0.003229

      145500 -- (-1299.028) (-1297.075) (-1302.800) [-1293.307] * (-1298.119) (-1293.343) (-1300.654) [-1292.291] -- 0:02:26
      146000 -- (-1299.429) (-1300.280) [-1302.828] (-1294.600) * (-1293.739) (-1298.410) [-1298.104] (-1298.931) -- 0:02:26
      146500 -- (-1296.777) (-1296.048) [-1300.145] (-1291.691) * [-1295.214] (-1295.691) (-1292.142) (-1303.181) -- 0:02:25
      147000 -- (-1294.964) (-1295.303) (-1306.432) [-1297.292] * [-1297.648] (-1298.508) (-1300.156) (-1299.321) -- 0:02:25
      147500 -- (-1303.024) [-1298.244] (-1295.880) (-1295.463) * (-1299.211) (-1300.043) [-1294.103] (-1298.576) -- 0:02:24
      148000 -- (-1305.194) (-1301.471) (-1298.142) [-1294.867] * (-1302.868) [-1298.238] (-1307.941) (-1296.688) -- 0:02:23
      148500 -- [-1298.348] (-1305.624) (-1298.717) (-1296.647) * [-1297.916] (-1299.327) (-1302.080) (-1304.643) -- 0:02:29
      149000 -- (-1301.396) (-1303.317) (-1293.417) [-1297.832] * (-1299.427) [-1291.855] (-1298.929) (-1302.194) -- 0:02:28
      149500 -- (-1302.847) (-1302.049) [-1295.868] (-1294.496) * [-1301.548] (-1293.780) (-1297.907) (-1293.514) -- 0:02:27
      150000 -- [-1300.676] (-1303.093) (-1299.957) (-1298.881) * (-1296.318) (-1294.422) (-1292.593) [-1299.165] -- 0:02:27

      Average standard deviation of split frequencies: 0.001564

      150500 -- (-1300.241) [-1304.649] (-1301.647) (-1300.341) * (-1293.678) (-1300.621) [-1297.723] (-1294.958) -- 0:02:26
      151000 -- (-1300.473) (-1305.843) (-1302.758) [-1299.403] * (-1299.191) (-1297.878) (-1302.079) [-1294.091] -- 0:02:26
      151500 -- (-1296.002) (-1306.301) (-1301.569) [-1297.116] * (-1309.131) (-1295.459) (-1298.805) [-1302.408] -- 0:02:25
      152000 -- (-1299.536) (-1304.578) (-1308.550) [-1296.623] * (-1304.592) (-1297.271) [-1303.641] (-1300.693) -- 0:02:25
      152500 -- (-1298.361) (-1308.139) [-1304.397] (-1298.682) * [-1295.205] (-1299.665) (-1304.112) (-1295.854) -- 0:02:24
      153000 -- (-1297.245) (-1304.556) [-1299.111] (-1297.528) * (-1304.580) (-1294.812) [-1298.774] (-1303.988) -- 0:02:23
      153500 -- (-1301.938) (-1303.042) (-1302.003) [-1301.115] * (-1298.650) (-1310.788) (-1298.645) [-1296.692] -- 0:02:23
      154000 -- (-1296.004) (-1297.760) (-1298.466) [-1300.053] * (-1304.779) [-1297.781] (-1294.376) (-1301.750) -- 0:02:22
      154500 -- (-1299.005) (-1297.205) [-1301.158] (-1303.413) * (-1297.544) (-1301.884) [-1296.143] (-1298.470) -- 0:02:27
      155000 -- (-1298.093) [-1295.866] (-1298.014) (-1305.734) * (-1300.749) [-1296.853] (-1298.893) (-1299.469) -- 0:02:27

      Average standard deviation of split frequencies: 0.001511

      155500 -- (-1305.147) [-1301.227] (-1300.974) (-1310.372) * (-1298.663) (-1298.499) [-1303.520] (-1305.178) -- 0:02:26
      156000 -- (-1301.594) (-1305.043) (-1299.817) [-1304.352] * (-1302.105) [-1300.184] (-1298.126) (-1301.676) -- 0:02:26
      156500 -- (-1301.954) [-1300.311] (-1299.581) (-1301.185) * (-1301.269) (-1295.825) [-1294.339] (-1301.535) -- 0:02:25
      157000 -- (-1303.157) (-1295.593) (-1298.092) [-1300.258] * (-1297.282) [-1300.462] (-1298.579) (-1298.740) -- 0:02:24
      157500 -- [-1300.783] (-1295.281) (-1297.762) (-1296.909) * (-1298.074) [-1296.711] (-1298.792) (-1300.819) -- 0:02:24
      158000 -- (-1299.844) [-1296.768] (-1299.471) (-1297.935) * (-1293.644) [-1301.346] (-1301.265) (-1300.399) -- 0:02:23
      158500 -- (-1298.336) (-1301.688) [-1299.269] (-1305.114) * [-1295.394] (-1298.359) (-1300.679) (-1298.550) -- 0:02:23
      159000 -- (-1297.247) [-1299.624] (-1300.155) (-1294.887) * (-1297.837) (-1302.781) [-1300.608] (-1294.789) -- 0:02:22
      159500 -- [-1295.204] (-1299.653) (-1297.865) (-1295.404) * (-1292.762) (-1297.811) (-1299.971) [-1299.232] -- 0:02:22
      160000 -- (-1298.105) [-1299.851] (-1297.832) (-1299.969) * (-1295.588) (-1297.636) (-1302.940) [-1298.650] -- 0:02:21

      Average standard deviation of split frequencies: 0.001467

      160500 -- (-1297.700) [-1293.714] (-1294.319) (-1292.876) * [-1295.879] (-1300.136) (-1299.875) (-1290.764) -- 0:02:26
      161000 -- (-1299.004) (-1298.831) (-1292.927) [-1297.285] * [-1296.207] (-1295.738) (-1301.891) (-1295.660) -- 0:02:25
      161500 -- (-1304.392) (-1298.546) [-1293.488] (-1296.596) * (-1306.778) (-1300.632) [-1299.386] (-1295.861) -- 0:02:25
      162000 -- (-1300.648) (-1298.709) (-1295.383) [-1301.037] * (-1301.569) (-1303.742) (-1305.493) [-1297.259] -- 0:02:24
      162500 -- (-1299.110) (-1303.646) [-1296.024] (-1297.583) * [-1298.106] (-1299.562) (-1298.199) (-1299.991) -- 0:02:24
      163000 -- (-1301.758) (-1298.168) (-1297.452) [-1302.980] * (-1301.344) (-1301.156) [-1301.340] (-1302.180) -- 0:02:23
      163500 -- [-1296.792] (-1295.421) (-1297.141) (-1297.645) * (-1302.763) (-1300.667) (-1302.192) [-1295.478] -- 0:02:23
      164000 -- (-1297.336) (-1301.938) [-1298.544] (-1300.814) * (-1300.467) (-1306.635) [-1299.165] (-1295.586) -- 0:02:22
      164500 -- (-1302.657) [-1297.542] (-1300.912) (-1297.301) * (-1300.527) (-1306.446) (-1306.734) [-1295.681] -- 0:02:22
      165000 -- (-1294.732) (-1298.336) [-1299.832] (-1297.938) * [-1301.651] (-1302.259) (-1298.871) (-1297.492) -- 0:02:21

      Average standard deviation of split frequencies: 0.002840

      165500 -- (-1297.839) (-1295.472) [-1302.730] (-1298.212) * (-1314.690) (-1292.713) (-1294.735) [-1295.450] -- 0:02:21
      166000 -- (-1294.291) [-1293.615] (-1300.486) (-1303.692) * (-1302.555) (-1296.470) [-1295.506] (-1304.846) -- 0:02:25
      166500 -- (-1296.322) (-1296.438) (-1299.222) [-1299.916] * [-1304.871] (-1301.119) (-1297.160) (-1294.220) -- 0:02:25
      167000 -- [-1294.731] (-1302.084) (-1296.073) (-1301.011) * (-1301.255) (-1297.463) [-1297.478] (-1297.492) -- 0:02:24
      167500 -- (-1301.677) (-1303.800) [-1299.981] (-1297.531) * (-1303.394) [-1299.088] (-1313.197) (-1300.149) -- 0:02:24
      168000 -- [-1294.719] (-1306.336) (-1293.893) (-1296.513) * (-1297.894) (-1300.453) (-1300.138) [-1300.182] -- 0:02:23
      168500 -- (-1296.268) (-1299.082) (-1299.836) [-1296.213] * (-1297.545) (-1296.172) (-1304.309) [-1295.889] -- 0:02:23
      169000 -- (-1297.953) [-1300.128] (-1298.470) (-1293.312) * [-1298.467] (-1298.658) (-1302.103) (-1296.588) -- 0:02:22
      169500 -- (-1297.398) (-1304.215) [-1302.366] (-1298.246) * [-1302.158] (-1297.231) (-1298.628) (-1296.212) -- 0:02:22
      170000 -- (-1299.187) (-1306.722) (-1297.858) [-1301.118] * (-1298.402) (-1297.548) [-1294.788] (-1297.436) -- 0:02:21

      Average standard deviation of split frequencies: 0.002762

      170500 -- (-1294.445) (-1295.005) (-1300.548) [-1302.935] * [-1300.358] (-1299.274) (-1294.792) (-1300.451) -- 0:02:21
      171000 -- [-1297.555] (-1295.190) (-1298.851) (-1297.139) * (-1297.158) (-1303.173) [-1303.541] (-1292.883) -- 0:02:20
      171500 -- (-1297.189) (-1298.614) [-1298.731] (-1299.399) * [-1292.801] (-1314.719) (-1302.942) (-1293.943) -- 0:02:20
      172000 -- (-1305.165) (-1295.984) [-1299.373] (-1308.817) * (-1302.658) (-1304.877) (-1298.068) [-1294.166] -- 0:02:24
      172500 -- (-1302.723) (-1305.349) (-1301.519) [-1301.757] * (-1298.347) (-1297.094) [-1299.482] (-1297.665) -- 0:02:23
      173000 -- (-1297.770) (-1307.463) (-1292.670) [-1299.230] * [-1296.005] (-1301.362) (-1302.878) (-1293.154) -- 0:02:23
      173500 -- (-1298.076) (-1298.819) (-1296.687) [-1297.263] * [-1295.945] (-1309.078) (-1302.124) (-1302.233) -- 0:02:22
      174000 -- (-1304.844) [-1295.670] (-1297.559) (-1296.573) * [-1297.251] (-1295.659) (-1301.969) (-1296.337) -- 0:02:22
      174500 -- (-1303.868) (-1295.977) (-1300.260) [-1296.969] * (-1297.733) [-1301.298] (-1303.347) (-1297.945) -- 0:02:21
      175000 -- (-1293.900) [-1307.366] (-1295.646) (-1296.197) * (-1298.900) [-1302.364] (-1301.988) (-1299.342) -- 0:02:21

      Average standard deviation of split frequencies: 0.004018

      175500 -- (-1299.430) [-1302.402] (-1297.151) (-1299.313) * (-1296.520) (-1300.463) (-1300.083) [-1295.921] -- 0:02:20
      176000 -- (-1300.234) [-1295.402] (-1299.642) (-1300.992) * (-1302.144) (-1301.349) [-1302.390] (-1298.449) -- 0:02:20
      176500 -- [-1299.540] (-1296.717) (-1301.474) (-1293.328) * (-1303.044) [-1299.023] (-1311.697) (-1293.006) -- 0:02:19
      177000 -- (-1301.417) (-1297.773) (-1301.253) [-1295.988] * [-1298.522] (-1296.550) (-1308.331) (-1296.748) -- 0:02:19
      177500 -- (-1300.687) (-1295.400) [-1301.889] (-1296.481) * (-1299.463) (-1295.369) (-1298.133) [-1300.497] -- 0:02:19
      178000 -- (-1301.573) (-1299.878) (-1296.648) [-1297.929] * (-1304.765) (-1301.448) (-1301.291) [-1297.372] -- 0:02:23
      178500 -- (-1301.154) [-1295.994] (-1300.661) (-1294.204) * [-1300.004] (-1299.600) (-1303.330) (-1301.171) -- 0:02:22
      179000 -- [-1298.281] (-1295.142) (-1298.419) (-1297.371) * (-1301.404) (-1299.941) [-1300.825] (-1292.722) -- 0:02:22
      179500 -- (-1312.074) (-1299.876) [-1298.446] (-1296.911) * (-1299.298) (-1302.612) [-1299.540] (-1296.635) -- 0:02:21
      180000 -- (-1301.124) (-1298.982) (-1299.314) [-1301.873] * [-1293.759] (-1295.209) (-1298.345) (-1291.550) -- 0:02:21

      Average standard deviation of split frequencies: 0.003914

      180500 -- (-1296.583) [-1294.948] (-1304.639) (-1302.622) * (-1299.802) [-1300.773] (-1301.301) (-1299.568) -- 0:02:20
      181000 -- [-1296.895] (-1299.324) (-1304.118) (-1299.498) * (-1293.162) [-1292.821] (-1302.784) (-1296.525) -- 0:02:20
      181500 -- (-1299.115) [-1301.112] (-1308.923) (-1300.185) * [-1295.526] (-1299.377) (-1300.187) (-1307.573) -- 0:02:19
      182000 -- (-1295.647) (-1300.440) (-1305.898) [-1314.189] * (-1294.241) (-1298.257) (-1302.335) [-1299.396] -- 0:02:19
      182500 -- (-1301.908) (-1296.940) (-1304.083) [-1302.777] * (-1296.435) [-1298.286] (-1295.239) (-1303.063) -- 0:02:18
      183000 -- (-1299.756) (-1296.038) [-1294.020] (-1300.019) * (-1297.296) (-1303.290) (-1303.585) [-1299.031] -- 0:02:18
      183500 -- (-1298.903) [-1294.339] (-1294.191) (-1299.592) * (-1294.980) (-1297.808) (-1296.290) [-1299.177] -- 0:02:22
      184000 -- [-1296.378] (-1293.277) (-1298.701) (-1306.425) * (-1297.396) [-1300.746] (-1301.782) (-1301.322) -- 0:02:21
      184500 -- (-1298.135) (-1296.234) [-1294.066] (-1302.607) * (-1301.639) (-1297.909) [-1296.228] (-1302.625) -- 0:02:21
      185000 -- [-1298.800] (-1295.816) (-1296.714) (-1304.616) * (-1300.054) (-1300.494) (-1300.483) [-1295.928] -- 0:02:20

      Average standard deviation of split frequencies: 0.003802

      185500 -- [-1299.165] (-1300.266) (-1301.754) (-1301.237) * (-1300.537) [-1293.412] (-1298.130) (-1301.891) -- 0:02:20
      186000 -- (-1303.265) (-1298.661) (-1300.413) [-1302.338] * [-1303.037] (-1299.321) (-1302.084) (-1296.447) -- 0:02:20
      186500 -- [-1301.503] (-1295.679) (-1300.153) (-1302.183) * (-1300.023) (-1296.565) [-1293.074] (-1301.789) -- 0:02:19
      187000 -- (-1302.234) [-1297.695] (-1299.402) (-1298.642) * (-1295.635) (-1301.004) [-1297.628] (-1299.681) -- 0:02:19
      187500 -- [-1298.925] (-1298.586) (-1305.640) (-1296.544) * [-1293.745] (-1304.792) (-1293.157) (-1297.587) -- 0:02:18
      188000 -- (-1301.336) (-1299.820) [-1302.229] (-1298.554) * (-1295.468) (-1312.459) (-1292.973) [-1300.277] -- 0:02:18
      188500 -- [-1304.382] (-1293.433) (-1301.342) (-1296.981) * [-1305.818] (-1303.416) (-1293.337) (-1300.351) -- 0:02:17
      189000 -- [-1303.603] (-1301.096) (-1301.131) (-1294.718) * (-1307.740) (-1305.117) (-1299.101) [-1302.305] -- 0:02:17
      189500 -- (-1303.096) (-1299.240) (-1296.381) [-1295.494] * (-1302.613) (-1301.424) [-1298.552] (-1301.729) -- 0:02:21
      190000 -- [-1300.884] (-1300.628) (-1299.194) (-1301.311) * [-1295.448] (-1295.212) (-1298.586) (-1301.445) -- 0:02:20

      Average standard deviation of split frequencies: 0.003709

      190500 -- (-1303.698) (-1305.784) (-1298.561) [-1299.813] * [-1296.106] (-1294.908) (-1300.477) (-1296.050) -- 0:02:20
      191000 -- (-1299.097) (-1298.503) (-1298.912) [-1295.650] * (-1306.185) [-1295.811] (-1304.674) (-1305.519) -- 0:02:19
      191500 -- (-1304.128) [-1296.243] (-1299.920) (-1298.672) * (-1296.643) [-1297.376] (-1300.962) (-1295.264) -- 0:02:19
      192000 -- [-1301.150] (-1295.256) (-1300.673) (-1299.364) * (-1301.889) [-1296.057] (-1296.864) (-1300.226) -- 0:02:18
      192500 -- (-1299.721) (-1301.670) [-1299.854] (-1300.702) * (-1296.585) [-1300.099] (-1301.178) (-1295.779) -- 0:02:18
      193000 -- (-1300.273) (-1302.110) (-1301.294) [-1296.831] * [-1298.251] (-1298.525) (-1298.744) (-1295.565) -- 0:02:17
      193500 -- (-1304.834) [-1292.441] (-1302.329) (-1297.310) * (-1299.081) (-1305.466) [-1296.341] (-1300.311) -- 0:02:17
      194000 -- (-1308.286) [-1300.562] (-1303.291) (-1296.997) * [-1296.308] (-1297.299) (-1293.982) (-1296.739) -- 0:02:17
      194500 -- [-1302.841] (-1303.431) (-1297.757) (-1294.797) * [-1293.494] (-1303.670) (-1302.883) (-1296.515) -- 0:02:16
      195000 -- [-1305.731] (-1303.948) (-1296.136) (-1295.839) * (-1293.144) (-1314.309) [-1292.733] (-1294.903) -- 0:02:20

      Average standard deviation of split frequencies: 0.003608

      195500 -- (-1299.555) (-1301.137) (-1301.608) [-1305.330] * (-1301.683) (-1300.774) [-1304.307] (-1295.077) -- 0:02:19
      196000 -- (-1295.601) (-1300.022) [-1299.286] (-1305.973) * (-1297.216) (-1301.838) [-1300.837] (-1296.271) -- 0:02:19
      196500 -- [-1293.723] (-1295.471) (-1294.996) (-1302.516) * [-1299.526] (-1302.151) (-1298.443) (-1294.772) -- 0:02:19
      197000 -- (-1295.734) (-1299.582) (-1299.066) [-1296.140] * (-1298.325) (-1296.076) [-1301.162] (-1293.076) -- 0:02:18
      197500 -- (-1295.860) (-1307.630) [-1294.561] (-1297.543) * (-1295.956) [-1299.705] (-1301.403) (-1297.598) -- 0:02:18
      198000 -- (-1295.097) [-1299.908] (-1297.205) (-1296.507) * (-1299.627) [-1293.618] (-1301.146) (-1295.497) -- 0:02:17
      198500 -- (-1302.855) (-1302.589) [-1303.146] (-1298.500) * (-1299.526) (-1296.727) [-1298.944] (-1299.267) -- 0:02:17
      199000 -- [-1298.660] (-1302.015) (-1299.467) (-1297.226) * (-1297.745) (-1300.875) [-1295.568] (-1299.314) -- 0:02:16
      199500 -- (-1298.570) (-1302.935) [-1301.954] (-1296.157) * [-1297.969] (-1297.214) (-1303.202) (-1300.723) -- 0:02:16
      200000 -- (-1298.761) (-1298.324) [-1300.353] (-1298.377) * [-1296.424] (-1302.295) (-1295.154) (-1293.726) -- 0:02:16

      Average standard deviation of split frequencies: 0.003524

      200500 -- (-1301.411) (-1300.618) [-1304.688] (-1298.130) * (-1303.187) (-1296.586) [-1292.309] (-1296.795) -- 0:02:15
      201000 -- (-1303.687) [-1298.786] (-1304.644) (-1296.179) * (-1296.122) (-1296.048) (-1295.464) [-1298.454] -- 0:02:19
      201500 -- (-1297.869) (-1292.679) (-1300.438) [-1293.997] * (-1299.056) [-1295.668] (-1298.320) (-1296.787) -- 0:02:18
      202000 -- (-1303.574) [-1294.260] (-1299.680) (-1298.451) * (-1304.071) (-1297.231) (-1295.289) [-1297.530] -- 0:02:18
      202500 -- (-1298.819) (-1297.502) (-1301.599) [-1296.859] * (-1312.641) [-1295.727] (-1298.240) (-1302.179) -- 0:02:17
      203000 -- (-1293.567) (-1301.789) [-1299.204] (-1295.115) * (-1305.173) (-1297.744) [-1303.418] (-1299.770) -- 0:02:17
      203500 -- (-1298.099) (-1295.957) (-1296.563) [-1295.781] * (-1293.395) (-1299.916) [-1296.777] (-1301.170) -- 0:02:16
      204000 -- [-1295.206] (-1299.508) (-1308.446) (-1308.045) * (-1297.702) [-1302.978] (-1300.747) (-1301.315) -- 0:02:16
      204500 -- (-1294.523) (-1298.693) (-1302.109) [-1295.712] * (-1295.524) (-1303.140) [-1298.442] (-1304.623) -- 0:02:16
      205000 -- (-1294.413) (-1299.415) [-1301.280] (-1295.766) * [-1292.652] (-1297.396) (-1297.108) (-1302.097) -- 0:02:15

      Average standard deviation of split frequencies: 0.003433

      205500 -- (-1294.161) [-1297.060] (-1299.985) (-1295.560) * [-1297.018] (-1298.669) (-1294.878) (-1312.356) -- 0:02:15
      206000 -- [-1297.642] (-1298.547) (-1311.425) (-1295.996) * [-1300.730] (-1304.155) (-1297.012) (-1302.228) -- 0:02:14
      206500 -- (-1294.522) (-1301.640) (-1307.245) [-1294.759] * (-1297.291) (-1298.221) [-1296.650] (-1298.016) -- 0:02:14
      207000 -- (-1297.693) (-1294.900) [-1301.088] (-1292.137) * (-1297.883) (-1300.695) [-1297.741] (-1299.849) -- 0:02:17
      207500 -- (-1299.481) (-1302.575) (-1299.163) [-1299.463] * (-1292.287) (-1301.702) (-1295.251) [-1298.561] -- 0:02:17
      208000 -- [-1303.587] (-1296.298) (-1300.529) (-1301.451) * (-1297.095) [-1299.722] (-1292.165) (-1297.025) -- 0:02:17
      208500 -- [-1297.782] (-1294.073) (-1302.649) (-1298.853) * [-1302.524] (-1296.599) (-1297.572) (-1302.761) -- 0:02:16
      209000 -- (-1301.358) [-1298.735] (-1302.796) (-1304.101) * (-1299.624) (-1303.087) [-1299.192] (-1295.233) -- 0:02:16
      209500 -- (-1298.530) (-1297.193) (-1306.322) [-1300.199] * (-1299.275) [-1297.818] (-1301.269) (-1298.513) -- 0:02:15
      210000 -- (-1302.913) (-1297.714) [-1304.740] (-1300.249) * (-1301.812) [-1296.922] (-1304.572) (-1296.425) -- 0:02:15

      Average standard deviation of split frequencies: 0.003357

      210500 -- (-1299.584) (-1303.194) (-1305.867) [-1296.205] * [-1306.168] (-1297.377) (-1306.606) (-1297.378) -- 0:02:15
      211000 -- (-1307.502) [-1298.026] (-1307.189) (-1296.756) * (-1302.807) [-1293.889] (-1302.843) (-1304.703) -- 0:02:14
      211500 -- (-1293.529) (-1298.911) [-1302.094] (-1298.444) * [-1300.558] (-1296.818) (-1304.053) (-1302.140) -- 0:02:14
      212000 -- (-1300.662) [-1300.096] (-1305.801) (-1296.078) * (-1304.870) [-1299.610] (-1299.400) (-1299.883) -- 0:02:13
      212500 -- (-1305.699) (-1300.418) [-1298.304] (-1307.110) * [-1301.276] (-1297.104) (-1300.789) (-1299.520) -- 0:02:17
      213000 -- (-1295.005) [-1294.497] (-1305.085) (-1302.966) * (-1301.127) (-1294.765) (-1302.604) [-1302.030] -- 0:02:16
      213500 -- (-1297.784) (-1298.433) [-1293.988] (-1298.000) * [-1300.031] (-1296.410) (-1298.932) (-1296.159) -- 0:02:16
      214000 -- (-1303.316) (-1307.028) [-1292.582] (-1298.962) * (-1302.638) [-1297.987] (-1296.434) (-1295.623) -- 0:02:15
      214500 -- (-1296.900) (-1297.812) [-1298.907] (-1297.900) * (-1300.721) (-1300.113) (-1300.453) [-1298.559] -- 0:02:15
      215000 -- (-1301.526) (-1299.625) [-1299.434] (-1298.671) * (-1302.505) (-1299.582) [-1296.285] (-1298.420) -- 0:02:15

      Average standard deviation of split frequencies: 0.003274

      215500 -- (-1298.071) [-1295.545] (-1300.562) (-1296.290) * (-1306.169) (-1299.702) (-1298.932) [-1294.304] -- 0:02:14
      216000 -- [-1298.046] (-1301.450) (-1303.242) (-1299.897) * (-1302.342) (-1305.646) (-1301.779) [-1296.329] -- 0:02:14
      216500 -- (-1305.363) (-1300.865) [-1300.663] (-1302.969) * (-1310.915) (-1296.983) (-1303.639) [-1297.083] -- 0:02:13
      217000 -- [-1301.783] (-1300.329) (-1302.365) (-1300.587) * (-1302.655) (-1302.513) [-1300.678] (-1302.507) -- 0:02:13
      217500 -- (-1298.559) (-1304.386) (-1305.866) [-1297.889] * (-1297.085) (-1295.794) [-1299.059] (-1297.483) -- 0:02:13
      218000 -- (-1305.087) [-1299.579] (-1308.967) (-1294.708) * (-1298.282) (-1297.485) [-1295.823] (-1304.312) -- 0:02:12
      218500 -- (-1303.904) [-1298.433] (-1298.727) (-1301.521) * [-1296.772] (-1303.790) (-1302.889) (-1301.456) -- 0:02:15
      219000 -- [-1302.146] (-1297.938) (-1301.191) (-1303.585) * (-1296.309) (-1306.836) [-1302.080] (-1297.681) -- 0:02:15
      219500 -- (-1304.551) (-1303.006) [-1299.001] (-1303.967) * (-1295.618) (-1307.282) (-1301.905) [-1295.387] -- 0:02:15
      220000 -- (-1301.540) [-1294.061] (-1308.653) (-1292.495) * (-1296.851) (-1295.778) (-1299.657) [-1299.706] -- 0:02:14

      Average standard deviation of split frequencies: 0.003204

      220500 -- (-1300.947) [-1295.623] (-1299.421) (-1298.482) * (-1300.015) (-1302.134) [-1298.634] (-1299.954) -- 0:02:14
      221000 -- (-1298.604) (-1294.549) (-1305.858) [-1296.988] * (-1296.622) (-1292.867) [-1299.541] (-1305.312) -- 0:02:13
      221500 -- (-1299.217) (-1298.120) [-1301.071] (-1295.709) * (-1298.642) [-1296.098] (-1300.992) (-1297.352) -- 0:02:13
      222000 -- (-1299.852) (-1301.941) [-1300.481] (-1301.297) * (-1302.187) (-1296.106) [-1295.862] (-1298.995) -- 0:02:13
      222500 -- (-1308.057) [-1299.905] (-1299.703) (-1300.575) * (-1309.372) (-1303.231) (-1299.196) [-1299.125] -- 0:02:12
      223000 -- [-1303.956] (-1299.484) (-1301.968) (-1306.547) * (-1304.781) (-1295.066) [-1294.745] (-1299.713) -- 0:02:12
      223500 -- (-1302.563) [-1301.107] (-1296.306) (-1306.152) * (-1301.264) [-1295.139] (-1296.120) (-1300.926) -- 0:02:12
      224000 -- (-1298.831) [-1295.245] (-1303.104) (-1306.671) * (-1291.644) (-1293.079) [-1298.567] (-1301.299) -- 0:02:11
      224500 -- (-1299.484) [-1296.207] (-1297.036) (-1300.857) * (-1298.305) (-1301.750) [-1300.388] (-1302.250) -- 0:02:14
      225000 -- (-1299.605) (-1300.312) [-1296.265] (-1298.789) * (-1302.194) (-1298.615) [-1292.329] (-1299.156) -- 0:02:14

      Average standard deviation of split frequencies: 0.003129

      225500 -- (-1299.364) [-1298.089] (-1295.720) (-1308.744) * (-1299.144) [-1302.094] (-1297.201) (-1299.330) -- 0:02:13
      226000 -- (-1306.018) (-1298.480) (-1299.278) [-1298.694] * (-1295.732) (-1301.304) [-1297.327] (-1297.666) -- 0:02:13
      226500 -- (-1301.939) [-1299.803] (-1297.582) (-1298.083) * (-1304.008) (-1302.891) [-1296.488] (-1297.625) -- 0:02:13
      227000 -- (-1301.097) [-1295.357] (-1294.070) (-1295.624) * [-1299.142] (-1303.059) (-1296.072) (-1300.202) -- 0:02:12
      227500 -- [-1299.786] (-1301.476) (-1293.475) (-1301.974) * (-1295.378) (-1303.946) (-1298.803) [-1295.449] -- 0:02:12
      228000 -- [-1302.302] (-1305.913) (-1294.194) (-1297.577) * (-1295.939) (-1298.733) (-1303.028) [-1296.763] -- 0:02:12
      228500 -- [-1295.299] (-1301.526) (-1300.023) (-1298.291) * [-1300.668] (-1298.998) (-1303.558) (-1299.282) -- 0:02:11
      229000 -- (-1297.593) [-1297.603] (-1302.891) (-1294.679) * (-1296.534) (-1304.027) [-1300.821] (-1295.673) -- 0:02:11
      229500 -- (-1300.214) (-1307.927) (-1297.122) [-1294.953] * (-1301.941) (-1302.938) (-1299.140) [-1292.415] -- 0:02:10
      230000 -- (-1299.079) (-1308.239) (-1294.368) [-1300.188] * [-1299.899] (-1305.957) (-1305.584) (-1297.563) -- 0:02:10

      Average standard deviation of split frequencies: 0.003065

      230500 -- (-1294.217) (-1301.784) [-1296.801] (-1298.504) * [-1303.758] (-1303.737) (-1302.478) (-1299.276) -- 0:02:13
      231000 -- [-1294.371] (-1303.330) (-1295.610) (-1297.016) * (-1309.240) [-1300.998] (-1299.906) (-1299.493) -- 0:02:13
      231500 -- (-1296.370) (-1303.586) (-1297.708) [-1298.083] * [-1299.327] (-1303.753) (-1305.104) (-1301.441) -- 0:02:12
      232000 -- [-1300.882] (-1295.697) (-1310.059) (-1298.166) * (-1294.470) [-1302.830] (-1296.208) (-1298.846) -- 0:02:12
      232500 -- [-1296.657] (-1298.480) (-1300.745) (-1301.296) * [-1295.577] (-1301.239) (-1299.158) (-1296.736) -- 0:02:12
      233000 -- (-1296.595) (-1302.518) (-1303.287) [-1295.287] * [-1299.629] (-1299.279) (-1296.206) (-1305.414) -- 0:02:11
      233500 -- [-1295.774] (-1297.551) (-1315.513) (-1295.960) * [-1300.031] (-1299.376) (-1295.058) (-1301.057) -- 0:02:11
      234000 -- (-1299.946) (-1295.158) [-1299.715] (-1295.855) * (-1298.200) [-1299.702] (-1295.254) (-1302.666) -- 0:02:10
      234500 -- [-1300.899] (-1298.033) (-1299.083) (-1292.918) * [-1295.614] (-1297.661) (-1299.196) (-1299.093) -- 0:02:10
      235000 -- (-1296.715) (-1299.820) (-1296.494) [-1295.346] * (-1296.041) (-1301.325) [-1301.043] (-1292.816) -- 0:02:10

      Average standard deviation of split frequencies: 0.001997

      235500 -- (-1300.427) [-1299.340] (-1301.368) (-1299.382) * (-1297.262) (-1303.296) (-1300.983) [-1299.937] -- 0:02:09
      236000 -- (-1294.658) (-1303.832) (-1292.536) [-1294.419] * [-1292.500] (-1298.813) (-1299.266) (-1294.822) -- 0:02:12
      236500 -- [-1295.641] (-1296.802) (-1298.065) (-1297.256) * (-1295.502) (-1304.441) [-1297.001] (-1296.070) -- 0:02:12
      237000 -- (-1297.014) (-1304.085) [-1298.504] (-1296.631) * [-1298.123] (-1302.739) (-1292.955) (-1297.169) -- 0:02:11
      237500 -- (-1301.059) [-1300.943] (-1296.723) (-1302.182) * (-1292.957) (-1299.343) (-1297.391) [-1296.405] -- 0:02:11
      238000 -- (-1298.630) (-1300.926) (-1310.314) [-1297.319] * (-1301.202) (-1298.243) (-1292.557) [-1304.320] -- 0:02:11
      238500 -- (-1299.663) (-1301.849) [-1295.406] (-1302.198) * (-1299.473) (-1300.726) [-1293.289] (-1303.035) -- 0:02:10
      239000 -- (-1302.481) (-1306.683) [-1304.239] (-1304.452) * (-1304.604) [-1302.145] (-1303.726) (-1296.042) -- 0:02:10
      239500 -- (-1303.554) (-1302.396) [-1293.646] (-1305.420) * (-1297.806) (-1295.099) [-1298.234] (-1306.089) -- 0:02:10
      240000 -- (-1298.287) [-1296.259] (-1295.873) (-1301.447) * (-1301.455) (-1303.986) [-1295.526] (-1301.689) -- 0:02:09

      Average standard deviation of split frequencies: 0.001959

      240500 -- (-1293.768) (-1305.513) [-1297.269] (-1293.952) * [-1303.893] (-1297.549) (-1303.117) (-1305.025) -- 0:02:09
      241000 -- (-1294.042) (-1295.506) [-1295.416] (-1301.405) * (-1299.419) (-1296.256) (-1303.523) [-1295.459] -- 0:02:09
      241500 -- (-1296.519) [-1295.661] (-1296.021) (-1296.842) * (-1297.905) (-1300.035) (-1299.423) [-1295.502] -- 0:02:08
      242000 -- [-1294.107] (-1303.378) (-1301.582) (-1296.951) * [-1298.188] (-1301.282) (-1306.771) (-1298.143) -- 0:02:11
      242500 -- [-1294.420] (-1296.253) (-1303.869) (-1295.354) * [-1296.275] (-1304.476) (-1305.116) (-1296.283) -- 0:02:11
      243000 -- (-1293.480) [-1302.894] (-1297.918) (-1298.205) * [-1294.461] (-1298.103) (-1298.554) (-1298.981) -- 0:02:10
      243500 -- (-1303.338) (-1296.514) (-1296.859) [-1299.847] * (-1301.508) (-1292.555) [-1295.436] (-1297.402) -- 0:02:10
      244000 -- (-1299.353) [-1293.681] (-1298.554) (-1298.533) * (-1296.656) [-1295.326] (-1297.805) (-1298.629) -- 0:02:10
      244500 -- (-1298.149) (-1293.448) (-1306.045) [-1303.883] * [-1292.158] (-1293.672) (-1298.972) (-1297.815) -- 0:02:09
      245000 -- (-1296.706) (-1303.470) (-1298.567) [-1299.243] * (-1295.174) (-1302.417) (-1299.689) [-1294.457] -- 0:02:09

      Average standard deviation of split frequencies: 0.001916

      245500 -- [-1300.402] (-1301.404) (-1298.222) (-1296.845) * (-1299.272) [-1294.731] (-1305.239) (-1294.795) -- 0:02:09
      246000 -- (-1295.260) (-1306.388) [-1296.979] (-1299.599) * (-1294.923) (-1291.971) (-1296.613) [-1299.092] -- 0:02:08
      246500 -- (-1307.567) (-1303.340) (-1298.308) [-1298.244] * (-1305.059) (-1300.846) [-1300.568] (-1303.623) -- 0:02:08
      247000 -- (-1299.913) (-1297.817) (-1299.487) [-1295.934] * [-1295.779] (-1295.907) (-1296.991) (-1296.538) -- 0:02:08
      247500 -- (-1307.248) [-1295.284] (-1300.045) (-1295.948) * (-1298.889) (-1300.560) [-1294.107] (-1302.862) -- 0:02:10
      248000 -- (-1301.767) (-1296.640) [-1293.002] (-1300.463) * (-1297.128) (-1294.715) (-1294.828) [-1296.136] -- 0:02:10
      248500 -- (-1303.013) [-1295.946] (-1299.682) (-1294.473) * (-1296.585) [-1295.724] (-1297.326) (-1295.276) -- 0:02:10
      249000 -- (-1306.178) [-1298.000] (-1297.459) (-1301.796) * (-1296.302) (-1297.915) (-1295.688) [-1296.244] -- 0:02:09
      249500 -- (-1296.177) (-1301.605) [-1299.936] (-1296.913) * [-1300.195] (-1305.416) (-1296.993) (-1303.188) -- 0:02:09
      250000 -- (-1301.313) (-1303.009) [-1297.729] (-1296.217) * [-1304.259] (-1300.715) (-1302.001) (-1296.937) -- 0:02:09

      Average standard deviation of split frequencies: 0.001881

      250500 -- (-1297.351) (-1306.004) (-1297.646) [-1303.046] * [-1300.942] (-1307.248) (-1295.247) (-1297.654) -- 0:02:08
      251000 -- (-1295.415) (-1300.460) (-1301.936) [-1294.892] * (-1302.411) [-1295.624] (-1296.220) (-1295.409) -- 0:02:08
      251500 -- (-1297.378) (-1300.498) [-1300.891] (-1294.408) * [-1296.330] (-1295.995) (-1295.496) (-1303.125) -- 0:02:07
      252000 -- [-1297.919] (-1309.391) (-1295.579) (-1295.514) * (-1298.171) [-1294.355] (-1298.757) (-1297.533) -- 0:02:07
      252500 -- [-1299.959] (-1297.858) (-1303.074) (-1296.953) * (-1307.962) [-1294.516] (-1301.168) (-1297.288) -- 0:02:07
      253000 -- [-1295.711] (-1300.261) (-1301.620) (-1301.706) * (-1299.446) (-1300.787) (-1298.173) [-1302.811] -- 0:02:06
      253500 -- (-1301.629) (-1301.083) (-1296.246) [-1296.612] * (-1302.820) (-1301.610) [-1298.962] (-1299.440) -- 0:02:09
      254000 -- [-1293.892] (-1297.680) (-1299.089) (-1295.003) * (-1296.425) (-1298.503) (-1297.263) [-1299.077] -- 0:02:09
      254500 -- (-1297.000) (-1298.400) [-1297.168] (-1299.354) * (-1301.208) (-1300.053) (-1302.357) [-1296.480] -- 0:02:08
      255000 -- [-1300.347] (-1299.366) (-1303.101) (-1303.342) * (-1296.605) (-1301.188) (-1306.334) [-1301.338] -- 0:02:08

      Average standard deviation of split frequencies: 0.001841

      255500 -- (-1300.714) (-1296.053) [-1301.222] (-1296.522) * (-1295.848) (-1302.337) (-1300.284) [-1298.147] -- 0:02:08
      256000 -- (-1300.081) [-1297.550] (-1301.604) (-1300.730) * (-1296.352) (-1302.722) [-1297.743] (-1293.546) -- 0:02:07
      256500 -- (-1298.062) (-1295.956) (-1299.250) [-1298.984] * (-1295.651) (-1294.570) (-1309.702) [-1293.723] -- 0:02:07
      257000 -- [-1297.186] (-1293.018) (-1301.881) (-1298.017) * [-1297.283] (-1293.877) (-1295.110) (-1299.411) -- 0:02:07
      257500 -- (-1302.006) (-1298.705) (-1300.645) [-1301.658] * (-1298.156) (-1302.483) (-1297.721) [-1298.065] -- 0:02:06
      258000 -- (-1300.229) [-1296.376] (-1301.042) (-1299.653) * [-1294.714] (-1299.208) (-1299.488) (-1303.788) -- 0:02:06
      258500 -- (-1308.520) (-1296.657) [-1303.810] (-1298.770) * [-1299.206] (-1299.827) (-1299.652) (-1299.621) -- 0:02:06
      259000 -- (-1301.829) [-1300.977] (-1300.564) (-1298.684) * (-1297.744) [-1301.495] (-1300.854) (-1300.020) -- 0:02:08
      259500 -- (-1300.875) (-1299.653) [-1297.511] (-1294.150) * (-1297.834) [-1297.996] (-1298.941) (-1308.079) -- 0:02:08
      260000 -- (-1300.650) (-1304.215) (-1296.468) [-1295.888] * (-1296.764) (-1304.907) [-1297.919] (-1297.988) -- 0:02:08

      Average standard deviation of split frequencies: 0.001808

      260500 -- (-1300.969) (-1300.109) (-1303.078) [-1296.135] * [-1306.167] (-1294.969) (-1299.137) (-1299.073) -- 0:02:07
      261000 -- (-1307.083) (-1303.117) (-1300.858) [-1297.529] * [-1299.213] (-1298.754) (-1306.311) (-1294.495) -- 0:02:07
      261500 -- (-1304.278) [-1301.214] (-1301.695) (-1303.663) * (-1301.563) [-1295.353] (-1301.122) (-1301.121) -- 0:02:07
      262000 -- [-1300.110] (-1300.528) (-1295.808) (-1302.664) * (-1301.807) [-1296.456] (-1298.037) (-1298.305) -- 0:02:06
      262500 -- (-1305.621) [-1296.708] (-1299.715) (-1294.398) * (-1293.402) [-1295.357] (-1305.407) (-1298.372) -- 0:02:06
      263000 -- (-1303.966) (-1295.507) (-1294.088) [-1297.464] * [-1296.248] (-1295.517) (-1299.339) (-1296.819) -- 0:02:06
      263500 -- (-1301.031) [-1302.616] (-1296.457) (-1300.436) * (-1302.762) (-1299.035) (-1295.453) [-1299.753] -- 0:02:05
      264000 -- [-1299.169] (-1301.115) (-1301.135) (-1301.786) * (-1304.860) [-1296.384] (-1299.445) (-1301.689) -- 0:02:05
      264500 -- (-1294.385) [-1299.896] (-1299.186) (-1296.098) * [-1298.072] (-1304.188) (-1294.247) (-1300.587) -- 0:02:05
      265000 -- (-1295.295) (-1298.140) [-1296.636] (-1296.654) * (-1293.945) (-1304.010) [-1295.825] (-1301.800) -- 0:02:07

      Average standard deviation of split frequencies: 0.001772

      265500 -- (-1297.597) (-1296.005) (-1299.513) [-1297.184] * (-1299.298) (-1297.474) (-1296.973) [-1293.863] -- 0:02:07
      266000 -- (-1297.039) [-1300.239] (-1297.619) (-1299.411) * (-1296.590) (-1303.985) [-1294.043] (-1296.372) -- 0:02:06
      266500 -- (-1296.819) (-1303.029) (-1305.198) [-1295.152] * (-1297.001) [-1296.032] (-1296.552) (-1293.450) -- 0:02:06
      267000 -- [-1298.323] (-1302.312) (-1299.764) (-1300.065) * (-1304.530) (-1302.730) (-1297.209) [-1298.629] -- 0:02:06
      267500 -- [-1297.130] (-1302.740) (-1304.997) (-1304.442) * (-1301.878) (-1304.745) (-1303.302) [-1298.135] -- 0:02:05
      268000 -- [-1298.175] (-1304.305) (-1297.217) (-1298.338) * (-1299.282) (-1295.229) [-1294.408] (-1293.190) -- 0:02:05
      268500 -- (-1293.455) (-1300.729) [-1301.449] (-1298.431) * (-1305.162) (-1297.183) [-1294.358] (-1296.919) -- 0:02:05
      269000 -- (-1302.603) (-1301.119) [-1299.241] (-1296.796) * (-1298.665) (-1299.371) [-1299.948] (-1296.973) -- 0:02:05
      269500 -- [-1305.854] (-1302.313) (-1296.887) (-1306.657) * [-1296.887] (-1303.239) (-1296.360) (-1291.182) -- 0:02:04
      270000 -- (-1305.642) (-1297.795) (-1294.676) [-1298.839] * (-1296.778) (-1299.972) (-1293.436) [-1295.360] -- 0:02:04

      Average standard deviation of split frequencies: 0.001742

      270500 -- [-1299.523] (-1293.730) (-1297.223) (-1302.328) * (-1297.722) (-1299.136) [-1295.229] (-1297.062) -- 0:02:04
      271000 -- [-1295.226] (-1292.602) (-1301.057) (-1300.899) * (-1300.831) [-1295.678] (-1298.932) (-1300.708) -- 0:02:06
      271500 -- (-1305.386) (-1296.702) [-1297.671] (-1299.079) * (-1299.506) (-1297.956) (-1297.121) [-1298.023] -- 0:02:06
      272000 -- [-1296.309] (-1300.207) (-1298.710) (-1295.980) * [-1297.287] (-1296.171) (-1297.082) (-1303.913) -- 0:02:05
      272500 -- (-1295.280) (-1295.542) [-1295.628] (-1300.769) * [-1300.275] (-1299.863) (-1296.586) (-1296.896) -- 0:02:05
      273000 -- (-1298.541) [-1296.625] (-1298.926) (-1301.273) * (-1302.509) (-1303.299) (-1298.486) [-1295.642] -- 0:02:05
      273500 -- (-1308.106) [-1295.250] (-1298.418) (-1301.237) * [-1299.579] (-1297.145) (-1304.582) (-1296.979) -- 0:02:04
      274000 -- (-1301.433) [-1296.716] (-1309.147) (-1295.441) * (-1297.040) [-1298.414] (-1294.483) (-1299.510) -- 0:02:04
      274500 -- (-1302.159) [-1295.953] (-1308.608) (-1298.758) * [-1296.745] (-1303.380) (-1299.571) (-1301.074) -- 0:02:04
      275000 -- (-1304.582) (-1300.688) (-1306.165) [-1298.894] * (-1299.178) (-1298.465) (-1299.754) [-1301.641] -- 0:02:03

      Average standard deviation of split frequencies: 0.001708

      275500 -- (-1300.350) (-1300.473) [-1297.289] (-1300.851) * (-1305.146) [-1297.205] (-1299.658) (-1295.734) -- 0:02:03
      276000 -- (-1299.061) (-1299.589) (-1303.636) [-1297.103] * [-1299.403] (-1293.348) (-1300.341) (-1298.310) -- 0:02:03
      276500 -- (-1301.283) (-1300.159) (-1299.166) [-1295.455] * [-1298.308] (-1302.370) (-1295.893) (-1297.046) -- 0:02:05
      277000 -- (-1300.420) [-1300.924] (-1303.184) (-1300.822) * (-1302.212) (-1300.749) [-1298.155] (-1299.405) -- 0:02:05
      277500 -- [-1302.275] (-1303.178) (-1298.488) (-1304.999) * [-1302.104] (-1297.057) (-1292.378) (-1304.451) -- 0:02:04
      278000 -- [-1303.093] (-1300.969) (-1309.464) (-1303.831) * (-1298.975) (-1296.330) [-1294.450] (-1301.961) -- 0:02:04
      278500 -- [-1301.464] (-1302.121) (-1299.390) (-1303.483) * (-1297.508) (-1297.199) [-1302.479] (-1305.524) -- 0:02:04
      279000 -- (-1300.190) (-1300.086) (-1301.157) [-1294.696] * (-1306.749) (-1297.128) [-1298.700] (-1304.065) -- 0:02:04
      279500 -- (-1299.232) [-1293.518] (-1298.651) (-1298.544) * (-1298.581) (-1300.698) (-1299.935) [-1299.797] -- 0:02:03
      280000 -- (-1300.182) (-1295.982) (-1294.897) [-1296.625] * (-1294.806) (-1298.978) [-1296.668] (-1298.966) -- 0:02:03

      Average standard deviation of split frequencies: 0.001680

      280500 -- (-1300.555) [-1301.756] (-1302.371) (-1304.950) * [-1298.350] (-1300.751) (-1298.703) (-1298.160) -- 0:02:03
      281000 -- (-1305.358) [-1299.323] (-1295.733) (-1293.187) * (-1294.773) (-1301.666) [-1293.309] (-1293.382) -- 0:02:02
      281500 -- (-1302.445) (-1298.793) (-1297.634) [-1295.222] * (-1300.880) (-1301.787) [-1294.937] (-1292.868) -- 0:02:02
      282000 -- (-1303.141) (-1304.155) (-1302.454) [-1295.701] * (-1298.822) (-1299.566) [-1294.633] (-1293.343) -- 0:02:02
      282500 -- [-1299.589] (-1297.990) (-1303.561) (-1301.201) * (-1297.846) (-1295.583) [-1297.718] (-1298.108) -- 0:02:04
      283000 -- (-1300.752) [-1298.031] (-1299.947) (-1300.131) * (-1301.363) (-1296.125) [-1299.259] (-1300.063) -- 0:02:04
      283500 -- (-1300.831) [-1302.354] (-1299.057) (-1300.580) * (-1304.721) (-1298.066) [-1296.966] (-1305.210) -- 0:02:03
      284000 -- (-1297.851) [-1295.346] (-1305.394) (-1307.511) * (-1304.410) (-1296.138) (-1295.939) [-1296.746] -- 0:02:03
      284500 -- [-1295.958] (-1300.910) (-1296.820) (-1307.330) * [-1297.300] (-1301.504) (-1295.330) (-1300.664) -- 0:02:03
      285000 -- (-1297.900) (-1297.366) [-1298.974] (-1301.854) * (-1302.534) [-1293.285] (-1297.434) (-1301.523) -- 0:02:02

      Average standard deviation of split frequencies: 0.002472

      285500 -- (-1298.656) [-1296.765] (-1304.185) (-1303.016) * (-1297.665) (-1301.038) (-1304.653) [-1300.887] -- 0:02:02
      286000 -- (-1307.760) (-1296.061) [-1297.220] (-1304.976) * (-1308.919) [-1302.409] (-1303.615) (-1296.939) -- 0:02:02
      286500 -- (-1300.972) (-1298.290) (-1296.308) [-1301.352] * (-1297.079) (-1300.471) (-1299.676) [-1299.706] -- 0:02:02
      287000 -- (-1308.323) [-1294.538] (-1299.290) (-1303.139) * (-1299.823) (-1295.642) (-1301.071) [-1299.380] -- 0:02:01
      287500 -- (-1307.715) (-1296.102) (-1299.987) [-1294.586] * (-1297.177) [-1297.149] (-1299.027) (-1304.067) -- 0:02:01
      288000 -- [-1301.026] (-1296.739) (-1300.952) (-1296.868) * (-1296.734) (-1295.584) (-1299.526) [-1298.770] -- 0:02:01
      288500 -- (-1300.448) [-1295.702] (-1295.147) (-1298.284) * (-1295.832) (-1300.122) (-1299.211) [-1295.488] -- 0:02:03
      289000 -- (-1297.789) (-1299.005) (-1301.505) [-1296.098] * (-1295.540) (-1302.303) [-1295.595] (-1296.007) -- 0:02:03
      289500 -- (-1303.514) (-1295.522) [-1300.349] (-1295.212) * (-1294.218) (-1301.955) (-1296.546) [-1300.145] -- 0:02:02
      290000 -- (-1303.031) (-1305.271) (-1298.696) [-1298.254] * [-1294.843] (-1296.947) (-1295.819) (-1302.450) -- 0:02:02

      Average standard deviation of split frequencies: 0.002433

      290500 -- (-1297.060) [-1298.646] (-1301.152) (-1305.069) * [-1301.020] (-1299.899) (-1296.656) (-1294.136) -- 0:02:02
      291000 -- (-1297.361) (-1307.478) (-1306.053) [-1294.924] * (-1306.679) (-1297.909) (-1295.264) [-1299.026] -- 0:02:01
      291500 -- [-1298.781] (-1301.507) (-1298.639) (-1299.611) * [-1298.827] (-1298.594) (-1295.138) (-1294.170) -- 0:02:01
      292000 -- (-1300.298) [-1296.059] (-1302.064) (-1299.993) * (-1302.492) [-1293.251] (-1301.148) (-1297.451) -- 0:02:01
      292500 -- (-1304.857) (-1298.196) (-1296.533) [-1296.775] * (-1299.750) (-1297.831) [-1297.315] (-1306.497) -- 0:02:00
      293000 -- (-1299.175) (-1305.159) (-1302.493) [-1297.753] * (-1299.273) [-1297.925] (-1294.808) (-1299.666) -- 0:02:00
      293500 -- (-1299.584) [-1303.062] (-1299.468) (-1298.037) * [-1295.955] (-1299.518) (-1298.622) (-1295.495) -- 0:02:00
      294000 -- (-1299.106) (-1301.693) [-1297.850] (-1299.793) * (-1292.611) (-1305.160) [-1298.469] (-1301.985) -- 0:02:02
      294500 -- [-1300.405] (-1304.062) (-1299.403) (-1298.348) * (-1295.899) (-1297.251) (-1299.915) [-1294.666] -- 0:02:02
      295000 -- (-1303.544) (-1293.738) [-1296.117] (-1309.004) * (-1305.007) (-1302.147) [-1294.246] (-1297.854) -- 0:02:01

      Average standard deviation of split frequencies: 0.002389

      295500 -- [-1296.301] (-1300.804) (-1298.188) (-1306.113) * (-1298.975) (-1307.740) [-1300.961] (-1298.141) -- 0:02:01
      296000 -- (-1297.097) [-1297.707] (-1301.958) (-1299.661) * (-1305.726) [-1303.922] (-1302.461) (-1297.784) -- 0:02:01
      296500 -- [-1298.750] (-1302.367) (-1307.480) (-1302.246) * [-1298.957] (-1299.300) (-1298.969) (-1307.720) -- 0:02:01
      297000 -- (-1297.354) (-1297.065) (-1304.843) [-1297.699] * [-1295.719] (-1293.593) (-1295.153) (-1303.835) -- 0:02:00
      297500 -- [-1294.328] (-1296.628) (-1303.703) (-1298.160) * (-1294.971) (-1298.833) [-1298.698] (-1301.765) -- 0:02:00
      298000 -- (-1296.514) (-1300.483) (-1299.211) [-1300.975] * (-1296.128) (-1301.237) (-1296.445) [-1294.748] -- 0:02:00
      298500 -- (-1298.907) [-1297.974] (-1297.988) (-1306.568) * (-1293.895) (-1304.367) [-1299.985] (-1297.104) -- 0:01:59
      299000 -- (-1300.600) (-1303.534) (-1296.760) [-1299.076] * [-1293.671] (-1304.459) (-1305.434) (-1299.812) -- 0:01:59
      299500 -- [-1296.008] (-1303.006) (-1300.791) (-1295.629) * (-1309.167) (-1298.413) (-1299.155) [-1298.315] -- 0:01:59
      300000 -- [-1294.718] (-1298.178) (-1297.979) (-1297.581) * [-1298.327] (-1304.735) (-1300.350) (-1300.223) -- 0:02:01

      Average standard deviation of split frequencies: 0.002352

      300500 -- (-1299.007) [-1295.111] (-1303.560) (-1297.949) * (-1303.227) (-1298.685) (-1296.143) [-1295.686] -- 0:02:01
      301000 -- (-1301.805) [-1296.879] (-1299.108) (-1299.273) * (-1298.076) (-1301.125) [-1300.629] (-1296.074) -- 0:02:00
      301500 -- (-1300.361) (-1305.958) (-1299.898) [-1299.988] * [-1298.973] (-1305.858) (-1300.889) (-1304.217) -- 0:02:00
      302000 -- (-1303.982) [-1302.002] (-1300.020) (-1297.642) * (-1297.103) (-1304.999) [-1298.612] (-1302.105) -- 0:02:00
      302500 -- (-1299.850) (-1301.284) [-1299.570] (-1295.882) * [-1294.768] (-1297.074) (-1297.488) (-1296.656) -- 0:01:59
      303000 -- (-1296.158) (-1299.888) (-1297.447) [-1298.771] * (-1302.032) [-1299.059] (-1297.675) (-1296.586) -- 0:01:59
      303500 -- (-1297.758) [-1297.402] (-1303.401) (-1297.897) * [-1296.008] (-1297.432) (-1296.459) (-1294.289) -- 0:01:59
      304000 -- (-1294.607) (-1299.735) (-1298.545) [-1299.214] * [-1302.076] (-1307.844) (-1294.578) (-1294.999) -- 0:01:59
      304500 -- [-1298.564] (-1299.565) (-1303.249) (-1301.500) * [-1296.721] (-1305.160) (-1295.862) (-1301.184) -- 0:01:58
      305000 -- [-1296.928] (-1295.794) (-1296.846) (-1297.220) * (-1296.619) (-1303.891) [-1295.819] (-1302.946) -- 0:01:58

      Average standard deviation of split frequencies: 0.002311

      305500 -- (-1298.393) (-1301.704) (-1299.766) [-1298.214] * (-1300.899) (-1299.908) [-1295.479] (-1298.815) -- 0:01:58
      306000 -- (-1297.075) [-1293.492] (-1299.447) (-1298.520) * [-1299.303] (-1300.417) (-1302.191) (-1298.429) -- 0:02:00
      306500 -- (-1300.803) [-1297.134] (-1299.644) (-1293.359) * (-1301.770) (-1299.744) [-1301.971] (-1296.031) -- 0:01:59
      307000 -- [-1296.805] (-1303.547) (-1295.844) (-1297.188) * (-1300.835) (-1296.085) (-1302.243) [-1295.997] -- 0:01:59
      307500 -- (-1301.225) (-1298.471) (-1294.884) [-1299.677] * (-1301.329) [-1298.590] (-1303.059) (-1297.018) -- 0:01:59
      308000 -- (-1298.846) (-1298.409) [-1296.714] (-1300.931) * (-1301.407) (-1294.169) (-1301.859) [-1299.715] -- 0:01:59
      308500 -- (-1296.819) (-1299.645) (-1303.657) [-1295.881] * (-1303.053) [-1297.800] (-1296.881) (-1297.350) -- 0:01:58
      309000 -- [-1295.982] (-1299.121) (-1296.640) (-1305.196) * (-1310.542) (-1296.530) (-1300.963) [-1301.358] -- 0:01:58
      309500 -- (-1300.134) (-1301.070) [-1296.982] (-1300.572) * (-1311.746) [-1299.925] (-1308.091) (-1299.307) -- 0:01:58
      310000 -- (-1299.004) (-1295.232) [-1297.260] (-1302.433) * (-1308.469) (-1296.543) [-1298.166] (-1301.435) -- 0:01:57

      Average standard deviation of split frequencies: 0.002276

      310500 -- [-1293.007] (-1302.881) (-1298.975) (-1295.908) * [-1301.257] (-1301.441) (-1302.520) (-1305.804) -- 0:01:57
      311000 -- (-1299.731) (-1296.084) [-1296.592] (-1304.206) * (-1293.752) [-1293.219] (-1306.578) (-1296.694) -- 0:01:57
      311500 -- (-1296.220) (-1299.978) (-1301.902) [-1302.024] * (-1295.007) (-1301.715) [-1300.494] (-1293.488) -- 0:01:59
      312000 -- (-1298.222) (-1296.689) [-1299.995] (-1298.833) * (-1293.451) (-1305.680) (-1300.318) [-1301.423] -- 0:01:59
      312500 -- (-1298.367) [-1294.606] (-1303.345) (-1303.058) * [-1296.316] (-1306.284) (-1300.611) (-1300.436) -- 0:01:58
      313000 -- (-1299.027) [-1295.107] (-1300.564) (-1296.688) * [-1296.208] (-1299.209) (-1299.789) (-1300.544) -- 0:01:58
      313500 -- (-1293.291) [-1302.515] (-1297.405) (-1302.512) * [-1294.078] (-1294.964) (-1300.651) (-1302.458) -- 0:01:58
      314000 -- (-1298.596) (-1297.633) (-1299.911) [-1299.218] * (-1302.111) [-1295.197] (-1299.531) (-1299.350) -- 0:01:57
      314500 -- (-1296.462) [-1301.508] (-1298.925) (-1301.626) * (-1299.722) [-1296.697] (-1305.394) (-1303.299) -- 0:01:57
      315000 -- (-1298.939) (-1298.620) [-1302.550] (-1297.158) * [-1298.992] (-1299.256) (-1299.398) (-1295.732) -- 0:01:57

      Average standard deviation of split frequencies: 0.002238

      315500 -- (-1303.037) (-1295.871) (-1295.738) [-1297.842] * [-1298.473] (-1300.933) (-1302.563) (-1296.772) -- 0:01:57
      316000 -- [-1299.498] (-1298.049) (-1294.226) (-1294.317) * [-1294.340] (-1300.406) (-1306.679) (-1297.952) -- 0:01:56
      316500 -- (-1300.211) [-1299.203] (-1310.301) (-1305.269) * [-1300.620] (-1310.841) (-1299.794) (-1298.962) -- 0:01:56
      317000 -- (-1295.641) (-1300.061) (-1303.672) [-1303.857] * (-1298.803) (-1304.682) [-1300.978] (-1298.962) -- 0:01:56
      317500 -- (-1295.469) (-1294.215) (-1306.982) [-1302.113] * (-1301.345) (-1302.009) [-1298.904] (-1297.127) -- 0:01:58
      318000 -- [-1300.768] (-1301.745) (-1302.673) (-1300.181) * (-1302.378) [-1304.151] (-1301.722) (-1301.905) -- 0:01:57
      318500 -- (-1296.019) (-1298.704) (-1300.964) [-1310.084] * (-1297.261) (-1300.227) [-1295.256] (-1305.131) -- 0:01:57
      319000 -- (-1302.276) [-1295.028] (-1299.754) (-1299.018) * (-1298.835) (-1299.020) (-1301.486) [-1298.578] -- 0:01:57
      319500 -- [-1299.935] (-1296.363) (-1299.746) (-1295.243) * (-1296.969) (-1308.026) [-1301.172] (-1300.415) -- 0:01:57
      320000 -- [-1298.508] (-1293.172) (-1300.055) (-1297.480) * (-1299.493) (-1300.914) (-1300.798) [-1299.031] -- 0:01:56

      Average standard deviation of split frequencies: 0.002205

      320500 -- (-1303.298) [-1296.231] (-1300.239) (-1296.004) * (-1299.754) [-1300.559] (-1300.023) (-1295.667) -- 0:01:56
      321000 -- (-1309.785) [-1294.756] (-1299.884) (-1301.644) * (-1300.300) (-1305.632) [-1299.596] (-1297.325) -- 0:01:56
      321500 -- (-1296.707) (-1302.653) [-1299.961] (-1302.313) * (-1300.183) [-1298.325] (-1303.117) (-1297.239) -- 0:01:56
      322000 -- (-1298.743) (-1306.608) [-1294.952] (-1302.962) * (-1308.903) (-1293.376) [-1296.780] (-1294.514) -- 0:01:55
      322500 -- [-1295.782] (-1302.368) (-1296.041) (-1303.823) * (-1307.270) (-1298.540) (-1298.730) [-1296.006] -- 0:01:55
      323000 -- (-1308.093) (-1295.601) (-1292.707) [-1299.226] * (-1308.007) (-1297.455) [-1301.272] (-1302.377) -- 0:01:55
      323500 -- (-1298.139) (-1301.006) (-1294.311) [-1295.089] * [-1297.032] (-1297.139) (-1305.212) (-1298.615) -- 0:01:57
      324000 -- [-1298.760] (-1301.335) (-1297.635) (-1305.929) * [-1298.431] (-1302.839) (-1301.921) (-1295.647) -- 0:01:56
      324500 -- (-1299.612) [-1300.435] (-1297.028) (-1294.571) * [-1296.437] (-1298.733) (-1303.311) (-1297.323) -- 0:01:56
      325000 -- [-1295.217] (-1299.188) (-1298.191) (-1298.930) * (-1298.792) (-1295.575) (-1295.970) [-1293.496] -- 0:01:56

      Average standard deviation of split frequencies: 0.002169

      325500 -- [-1300.818] (-1296.850) (-1296.202) (-1300.917) * (-1304.423) (-1300.273) [-1296.717] (-1303.963) -- 0:01:56
      326000 -- [-1293.883] (-1300.185) (-1296.531) (-1299.004) * (-1300.979) [-1296.376] (-1294.509) (-1296.746) -- 0:01:55
      326500 -- (-1299.221) (-1298.989) (-1300.148) [-1302.932] * (-1304.300) (-1302.438) [-1294.870] (-1307.329) -- 0:01:55
      327000 -- (-1300.842) (-1292.485) (-1298.050) [-1299.721] * [-1296.375] (-1298.765) (-1298.463) (-1301.606) -- 0:01:55
      327500 -- (-1298.140) (-1296.597) [-1300.243] (-1294.428) * (-1301.539) [-1291.825] (-1301.935) (-1301.617) -- 0:01:54
      328000 -- (-1298.152) [-1298.097] (-1297.804) (-1294.672) * (-1302.343) (-1294.132) (-1300.189) [-1297.352] -- 0:01:54
      328500 -- (-1299.317) [-1298.749] (-1305.828) (-1294.989) * (-1302.504) [-1293.133] (-1304.801) (-1303.411) -- 0:01:54
      329000 -- [-1297.169] (-1298.733) (-1294.139) (-1299.530) * (-1297.260) [-1297.272] (-1300.440) (-1301.260) -- 0:01:56
      329500 -- (-1298.436) (-1300.028) (-1301.952) [-1295.169] * (-1295.698) (-1298.132) [-1297.801] (-1297.834) -- 0:01:55
      330000 -- (-1305.528) [-1300.896] (-1302.577) (-1298.088) * (-1299.480) (-1296.426) (-1298.440) [-1297.967] -- 0:01:55

      Average standard deviation of split frequencies: 0.002138

      330500 -- (-1299.296) (-1303.837) [-1298.338] (-1299.954) * (-1294.767) (-1296.928) [-1300.017] (-1296.774) -- 0:01:55
      331000 -- (-1301.104) (-1298.843) (-1306.095) [-1298.365] * [-1297.946] (-1302.198) (-1302.821) (-1302.064) -- 0:01:55
      331500 -- [-1304.581] (-1298.027) (-1301.180) (-1301.997) * [-1294.079] (-1298.944) (-1295.980) (-1294.677) -- 0:01:54
      332000 -- (-1316.425) [-1300.931] (-1296.854) (-1299.061) * (-1299.589) (-1294.671) [-1295.764] (-1302.500) -- 0:01:54
      332500 -- [-1303.165] (-1301.293) (-1296.685) (-1295.377) * (-1301.408) (-1298.867) [-1300.596] (-1305.495) -- 0:01:54
      333000 -- [-1302.647] (-1298.736) (-1292.711) (-1300.866) * (-1294.161) (-1296.559) (-1297.740) [-1299.319] -- 0:01:54
      333500 -- (-1299.989) (-1295.571) [-1296.805] (-1297.779) * (-1303.707) (-1293.794) [-1301.777] (-1296.084) -- 0:01:53
      334000 -- [-1304.650] (-1301.682) (-1292.668) (-1297.671) * (-1299.620) (-1294.501) (-1303.754) [-1298.425] -- 0:01:53
      334500 -- (-1296.169) (-1295.582) (-1292.014) [-1303.627] * [-1296.243] (-1300.344) (-1302.780) (-1292.562) -- 0:01:53
      335000 -- (-1299.306) (-1300.541) (-1299.499) [-1298.801] * [-1297.209] (-1294.862) (-1299.345) (-1297.462) -- 0:01:55

      Average standard deviation of split frequencies: 0.002104

      335500 -- (-1302.517) (-1296.100) [-1299.404] (-1296.651) * (-1298.846) [-1301.628] (-1301.451) (-1302.301) -- 0:01:54
      336000 -- (-1294.641) [-1298.128] (-1300.470) (-1297.125) * (-1300.007) (-1296.269) (-1299.799) [-1298.901] -- 0:01:54
      336500 -- (-1295.172) [-1299.204] (-1294.439) (-1295.039) * (-1296.178) [-1297.716] (-1300.073) (-1301.575) -- 0:01:54
      337000 -- (-1302.812) [-1297.917] (-1295.301) (-1302.810) * (-1298.633) [-1293.894] (-1296.600) (-1300.956) -- 0:01:54
      337500 -- (-1307.473) [-1303.738] (-1297.143) (-1300.362) * (-1298.716) (-1298.357) [-1295.990] (-1297.049) -- 0:01:53
      338000 -- [-1299.905] (-1298.945) (-1299.069) (-1295.270) * (-1301.674) (-1297.102) [-1296.266] (-1291.928) -- 0:01:53
      338500 -- [-1298.837] (-1295.541) (-1295.292) (-1296.215) * (-1304.805) (-1303.960) (-1296.258) [-1301.293] -- 0:01:53
      339000 -- (-1305.381) (-1298.721) (-1295.792) [-1296.993] * (-1299.266) (-1299.803) (-1298.664) [-1297.660] -- 0:01:53
      339500 -- (-1297.737) (-1296.951) (-1294.832) [-1295.753] * [-1298.732] (-1297.378) (-1304.948) (-1295.862) -- 0:01:52
      340000 -- (-1297.942) (-1300.684) (-1295.579) [-1296.417] * (-1300.561) [-1294.043] (-1299.291) (-1301.750) -- 0:01:52

      Average standard deviation of split frequencies: 0.002076

      340500 -- [-1295.545] (-1298.244) (-1295.690) (-1299.364) * (-1301.072) (-1296.664) [-1295.012] (-1298.709) -- 0:01:52
      341000 -- (-1302.580) (-1297.668) [-1299.503] (-1294.086) * [-1296.324] (-1296.823) (-1299.426) (-1296.386) -- 0:01:54
      341500 -- [-1297.419] (-1295.833) (-1292.466) (-1293.608) * (-1299.615) (-1293.464) (-1297.970) [-1299.924] -- 0:01:53
      342000 -- (-1298.532) [-1299.265] (-1296.169) (-1294.183) * (-1301.737) (-1296.486) [-1297.128] (-1295.274) -- 0:01:53
      342500 -- (-1299.895) (-1296.399) [-1301.181] (-1296.278) * (-1298.478) (-1301.698) [-1302.684] (-1298.559) -- 0:01:53
      343000 -- (-1304.785) (-1294.939) [-1294.768] (-1309.249) * (-1300.124) (-1310.670) [-1296.251] (-1302.723) -- 0:01:53
      343500 -- (-1301.563) (-1304.012) [-1295.099] (-1301.555) * (-1300.581) (-1299.539) [-1298.243] (-1309.804) -- 0:01:52
      344000 -- (-1300.130) (-1297.618) [-1296.585] (-1301.975) * (-1303.199) (-1302.184) [-1296.319] (-1304.900) -- 0:01:52
      344500 -- (-1298.277) (-1298.277) (-1300.581) [-1297.252] * [-1305.380] (-1299.312) (-1301.705) (-1308.706) -- 0:01:52
      345000 -- (-1296.671) (-1301.896) (-1299.337) [-1294.719] * (-1299.218) (-1303.177) (-1302.339) [-1295.965] -- 0:01:52

      Average standard deviation of split frequencies: 0.002044

      345500 -- (-1299.362) [-1299.263] (-1305.233) (-1295.620) * [-1295.358] (-1303.068) (-1297.541) (-1296.962) -- 0:01:51
      346000 -- (-1300.202) [-1294.852] (-1301.162) (-1302.231) * [-1292.552] (-1305.002) (-1299.954) (-1295.400) -- 0:01:51
      346500 -- (-1300.319) (-1303.747) (-1294.935) [-1297.892] * (-1297.302) (-1306.420) (-1306.866) [-1296.261] -- 0:01:53
      347000 -- (-1299.984) (-1297.474) [-1295.212] (-1301.566) * (-1297.163) (-1301.904) [-1295.980] (-1297.109) -- 0:01:52
      347500 -- (-1302.960) (-1299.725) (-1299.251) [-1297.902] * [-1296.868] (-1296.892) (-1301.805) (-1298.692) -- 0:01:52
      348000 -- (-1298.226) [-1295.323] (-1306.410) (-1300.957) * (-1301.628) (-1298.723) [-1303.073] (-1300.375) -- 0:01:52
      348500 -- [-1299.143] (-1299.902) (-1299.751) (-1305.959) * [-1294.256] (-1302.540) (-1298.963) (-1300.442) -- 0:01:52
      349000 -- [-1298.392] (-1297.587) (-1299.154) (-1300.108) * (-1300.382) (-1299.094) [-1294.075] (-1302.720) -- 0:01:51
      349500 -- (-1297.849) (-1299.800) [-1300.429] (-1296.402) * (-1297.613) [-1302.589] (-1299.766) (-1301.297) -- 0:01:51
      350000 -- (-1295.015) (-1297.652) (-1301.535) [-1298.921] * (-1295.323) (-1297.320) (-1301.393) [-1298.484] -- 0:01:51

      Average standard deviation of split frequencies: 0.002016

      350500 -- (-1300.568) (-1295.971) [-1299.000] (-1305.909) * (-1294.493) (-1301.365) (-1297.357) [-1294.484] -- 0:01:51
      351000 -- [-1297.856] (-1297.602) (-1302.271) (-1301.161) * [-1300.312] (-1294.614) (-1299.941) (-1295.795) -- 0:01:50
      351500 -- [-1294.622] (-1294.561) (-1302.618) (-1294.504) * [-1295.581] (-1292.150) (-1306.085) (-1305.388) -- 0:01:50
      352000 -- [-1296.888] (-1305.402) (-1296.601) (-1296.230) * (-1306.344) [-1294.367] (-1304.307) (-1305.501) -- 0:01:50
      352500 -- (-1296.522) (-1303.375) [-1295.737] (-1303.205) * (-1296.601) (-1296.596) [-1299.975] (-1302.801) -- 0:01:52
      353000 -- (-1302.822) [-1303.919] (-1293.981) (-1300.796) * (-1303.194) [-1300.253] (-1302.306) (-1302.120) -- 0:01:51
      353500 -- [-1296.141] (-1297.648) (-1298.121) (-1299.337) * (-1296.649) (-1306.576) (-1298.354) [-1305.629] -- 0:01:51
      354000 -- (-1306.955) [-1293.938] (-1295.505) (-1294.544) * (-1296.770) (-1302.029) [-1301.538] (-1296.161) -- 0:01:51
      354500 -- (-1299.991) [-1297.188] (-1301.813) (-1295.288) * (-1298.878) (-1298.612) [-1296.804] (-1294.238) -- 0:01:51
      355000 -- (-1303.816) (-1296.962) (-1299.714) [-1295.804] * [-1301.742] (-1296.355) (-1296.089) (-1294.152) -- 0:01:50

      Average standard deviation of split frequencies: 0.001986

      355500 -- (-1298.153) [-1297.135] (-1304.714) (-1303.250) * (-1303.313) [-1306.987] (-1294.703) (-1297.614) -- 0:01:50
      356000 -- (-1295.680) (-1294.918) [-1306.051] (-1304.405) * [-1297.808] (-1302.552) (-1296.087) (-1296.601) -- 0:01:50
      356500 -- (-1304.382) [-1299.196] (-1300.495) (-1302.740) * (-1300.731) [-1304.932] (-1300.927) (-1294.024) -- 0:01:50
      357000 -- (-1302.836) [-1308.305] (-1303.750) (-1299.799) * (-1295.377) (-1303.535) (-1293.129) [-1301.693] -- 0:01:49
      357500 -- [-1296.315] (-1301.010) (-1303.735) (-1297.717) * (-1295.986) [-1295.652] (-1292.273) (-1293.884) -- 0:01:49
      358000 -- (-1301.133) [-1297.750] (-1300.194) (-1299.213) * (-1301.290) [-1297.153] (-1294.701) (-1300.129) -- 0:01:49
      358500 -- (-1299.873) (-1304.207) [-1299.526] (-1297.361) * (-1304.723) (-1307.405) (-1300.171) [-1306.917] -- 0:01:50
      359000 -- (-1302.823) (-1298.413) (-1297.328) [-1293.211] * (-1299.020) (-1301.754) [-1300.403] (-1303.804) -- 0:01:50
      359500 -- (-1306.398) [-1302.193] (-1292.729) (-1294.975) * (-1305.110) (-1297.062) [-1296.952] (-1297.145) -- 0:01:50
      360000 -- (-1301.401) (-1295.358) (-1297.217) [-1296.370] * (-1297.899) (-1308.900) [-1295.336] (-1297.561) -- 0:01:50

      Average standard deviation of split frequencies: 0.001961

      360500 -- (-1297.891) [-1296.677] (-1296.143) (-1297.474) * (-1294.637) (-1296.075) [-1294.524] (-1294.087) -- 0:01:49
      361000 -- [-1301.922] (-1299.436) (-1299.615) (-1302.922) * (-1297.423) [-1295.660] (-1297.423) (-1293.882) -- 0:01:49
      361500 -- (-1296.194) (-1306.233) (-1297.337) [-1295.674] * [-1299.114] (-1301.077) (-1300.057) (-1293.853) -- 0:01:49
      362000 -- [-1299.402] (-1302.784) (-1295.564) (-1298.389) * (-1304.023) (-1305.717) [-1298.798] (-1298.771) -- 0:01:49
      362500 -- (-1296.860) [-1302.316] (-1296.719) (-1301.326) * (-1306.080) (-1301.154) [-1298.203] (-1294.841) -- 0:01:49
      363000 -- (-1302.371) (-1306.509) (-1297.569) [-1299.215] * (-1293.948) [-1302.428] (-1297.595) (-1299.812) -- 0:01:48
      363500 -- (-1302.843) (-1305.851) (-1295.112) [-1295.191] * (-1299.345) (-1298.646) (-1299.928) [-1298.068] -- 0:01:48
      364000 -- (-1307.293) (-1308.792) (-1294.523) [-1295.793] * (-1302.073) [-1297.958] (-1299.281) (-1306.170) -- 0:01:50
      364500 -- (-1306.084) (-1295.576) [-1298.679] (-1301.757) * (-1299.417) [-1299.696] (-1298.216) (-1300.406) -- 0:01:49
      365000 -- (-1299.433) [-1294.956] (-1298.422) (-1295.141) * (-1299.217) [-1299.302] (-1295.976) (-1310.234) -- 0:01:49

      Average standard deviation of split frequencies: 0.001932

      365500 -- [-1299.217] (-1300.700) (-1299.039) (-1296.727) * (-1297.701) [-1292.999] (-1299.604) (-1304.372) -- 0:01:49
      366000 -- [-1296.890] (-1301.142) (-1305.522) (-1303.542) * (-1296.377) (-1300.213) [-1298.094] (-1306.873) -- 0:01:49
      366500 -- (-1298.842) (-1295.356) (-1307.851) [-1299.711] * (-1293.958) (-1298.664) (-1296.915) [-1299.722] -- 0:01:48
      367000 -- (-1294.237) (-1300.008) (-1302.088) [-1305.357] * (-1298.084) (-1302.944) [-1293.838] (-1298.368) -- 0:01:48
      367500 -- (-1302.449) [-1297.963] (-1303.637) (-1300.780) * (-1310.466) [-1295.222] (-1296.058) (-1301.554) -- 0:01:48
      368000 -- (-1296.999) [-1299.905] (-1309.010) (-1299.151) * (-1303.172) (-1295.527) [-1298.848] (-1294.835) -- 0:01:48
      368500 -- (-1293.880) [-1293.709] (-1305.193) (-1296.608) * (-1298.473) [-1299.812] (-1307.461) (-1293.929) -- 0:01:47
      369000 -- (-1299.946) [-1292.875] (-1299.349) (-1296.677) * (-1299.263) [-1297.777] (-1297.856) (-1297.476) -- 0:01:47
      369500 -- (-1295.431) (-1297.292) [-1297.720] (-1297.296) * (-1301.284) (-1294.176) (-1293.770) [-1300.563] -- 0:01:47
      370000 -- (-1297.207) (-1295.287) [-1294.265] (-1296.059) * (-1298.177) (-1300.306) [-1295.994] (-1296.470) -- 0:01:48

      Average standard deviation of split frequencies: 0.001908

      370500 -- [-1298.054] (-1299.212) (-1297.710) (-1299.078) * [-1299.547] (-1298.432) (-1307.803) (-1296.137) -- 0:01:48
      371000 -- (-1301.630) (-1294.621) (-1299.617) [-1298.999] * [-1295.529] (-1297.873) (-1294.644) (-1304.317) -- 0:01:48
      371500 -- (-1294.690) [-1293.762] (-1295.572) (-1295.726) * (-1295.506) [-1295.437] (-1299.250) (-1297.522) -- 0:01:48
      372000 -- (-1302.727) [-1295.255] (-1299.427) (-1296.849) * (-1299.441) (-1300.376) (-1301.731) [-1294.967] -- 0:01:48
      372500 -- [-1297.196] (-1298.284) (-1293.159) (-1309.623) * (-1298.557) [-1294.933] (-1296.184) (-1295.889) -- 0:01:47
      373000 -- (-1301.762) (-1300.466) (-1295.738) [-1299.605] * (-1297.199) [-1296.648] (-1306.979) (-1297.581) -- 0:01:47
      373500 -- (-1300.174) (-1297.455) [-1305.184] (-1301.325) * (-1302.173) [-1295.162] (-1299.861) (-1297.926) -- 0:01:47
      374000 -- [-1301.233] (-1299.696) (-1300.335) (-1300.024) * (-1294.825) (-1292.858) (-1298.602) [-1297.267] -- 0:01:47
      374500 -- [-1306.187] (-1295.277) (-1296.621) (-1298.958) * (-1299.097) (-1298.294) [-1296.882] (-1309.589) -- 0:01:46
      375000 -- (-1302.958) (-1296.645) (-1299.438) [-1294.610] * (-1298.073) (-1297.826) [-1299.478] (-1302.014) -- 0:01:46

      Average standard deviation of split frequencies: 0.001881

      375500 -- [-1296.035] (-1295.372) (-1296.483) (-1296.750) * (-1299.966) (-1303.769) [-1303.543] (-1299.684) -- 0:01:48
      376000 -- (-1298.598) [-1297.159] (-1304.122) (-1298.508) * (-1302.130) [-1298.519] (-1299.241) (-1297.595) -- 0:01:47
      376500 -- [-1303.832] (-1299.713) (-1297.511) (-1297.689) * (-1310.378) (-1298.386) [-1300.106] (-1301.186) -- 0:01:47
      377000 -- [-1296.433] (-1299.232) (-1296.537) (-1298.845) * [-1298.550] (-1299.183) (-1298.452) (-1300.081) -- 0:01:47
      377500 -- [-1298.161] (-1299.302) (-1297.493) (-1295.206) * [-1300.210] (-1296.190) (-1295.974) (-1300.646) -- 0:01:47
      378000 -- (-1306.380) (-1300.464) (-1294.115) [-1299.337] * (-1296.020) (-1293.652) (-1297.580) [-1300.070] -- 0:01:46
      378500 -- [-1299.089] (-1295.483) (-1301.108) (-1294.341) * (-1300.422) (-1294.456) [-1301.235] (-1297.291) -- 0:01:46
      379000 -- (-1299.316) (-1297.043) (-1299.790) [-1298.956] * (-1299.050) (-1300.532) [-1293.387] (-1297.287) -- 0:01:46
      379500 -- [-1297.604] (-1299.282) (-1299.456) (-1296.892) * (-1303.689) (-1298.381) (-1296.758) [-1295.208] -- 0:01:46
      380000 -- (-1299.221) (-1302.832) (-1304.406) [-1295.492] * (-1300.926) (-1303.071) [-1292.799] (-1297.131) -- 0:01:46

      Average standard deviation of split frequencies: 0.001858

      380500 -- (-1298.242) (-1307.858) [-1298.371] (-1300.260) * (-1297.287) (-1297.270) [-1297.951] (-1302.723) -- 0:01:47
      381000 -- [-1302.284] (-1302.971) (-1304.213) (-1299.968) * (-1300.811) [-1298.429] (-1298.515) (-1296.416) -- 0:01:47
      381500 -- (-1302.357) (-1295.171) [-1298.791] (-1304.732) * [-1294.650] (-1297.790) (-1299.545) (-1299.331) -- 0:01:47
      382000 -- [-1300.900] (-1299.810) (-1298.630) (-1295.978) * (-1298.243) (-1300.365) (-1296.190) [-1299.574] -- 0:01:46
      382500 -- (-1305.237) (-1299.085) [-1298.232] (-1303.226) * (-1297.904) [-1298.148] (-1300.358) (-1298.227) -- 0:01:46
      383000 -- (-1304.145) [-1299.723] (-1299.423) (-1300.556) * [-1294.579] (-1305.215) (-1304.136) (-1313.456) -- 0:01:46
      383500 -- (-1306.527) (-1302.853) [-1298.258] (-1302.385) * (-1297.428) [-1301.422] (-1303.292) (-1297.955) -- 0:01:46
      384000 -- (-1301.661) (-1294.003) [-1299.810] (-1298.604) * [-1301.440] (-1301.880) (-1295.824) (-1298.508) -- 0:01:47
      384500 -- [-1300.111] (-1293.657) (-1299.671) (-1295.131) * (-1294.498) (-1299.314) (-1302.334) [-1299.148] -- 0:01:47
      385000 -- (-1301.206) (-1305.627) (-1301.169) [-1297.868] * (-1295.167) (-1305.250) (-1299.735) [-1301.671] -- 0:01:47

      Average standard deviation of split frequencies: 0.001832

      385500 -- (-1303.391) [-1294.346] (-1308.392) (-1298.617) * (-1299.679) (-1305.371) (-1297.598) [-1303.688] -- 0:01:46
      386000 -- (-1303.599) [-1296.272] (-1302.304) (-1295.454) * (-1299.079) (-1302.378) (-1300.339) [-1302.404] -- 0:01:46
      386500 -- (-1296.804) [-1294.137] (-1300.987) (-1296.282) * (-1296.744) (-1307.424) [-1299.319] (-1297.361) -- 0:01:46
      387000 -- (-1295.290) (-1292.969) (-1298.481) [-1294.967] * (-1296.468) (-1300.541) (-1301.379) [-1297.318] -- 0:01:46
      387500 -- (-1303.093) [-1297.678] (-1308.285) (-1297.775) * (-1293.703) (-1297.616) (-1300.182) [-1298.523] -- 0:01:45
      388000 -- (-1296.792) [-1293.024] (-1298.627) (-1301.263) * (-1300.897) (-1300.761) [-1296.431] (-1303.468) -- 0:01:45
      388500 -- (-1297.659) (-1300.776) [-1296.765] (-1301.560) * (-1299.937) (-1292.414) (-1309.884) [-1295.258] -- 0:01:45
      389000 -- (-1306.147) (-1298.904) [-1296.244] (-1304.907) * [-1298.078] (-1299.327) (-1301.771) (-1302.578) -- 0:01:46
      389500 -- (-1297.231) (-1306.896) (-1294.964) [-1296.539] * (-1297.708) [-1302.402] (-1296.266) (-1298.214) -- 0:01:46
      390000 -- (-1298.744) (-1305.136) [-1297.829] (-1295.682) * [-1297.385] (-1294.675) (-1298.693) (-1298.133) -- 0:01:46

      Average standard deviation of split frequencies: 0.002413

      390500 -- (-1299.788) (-1305.819) (-1295.864) [-1295.150] * (-1302.161) [-1295.782] (-1295.885) (-1305.297) -- 0:01:46
      391000 -- (-1296.622) (-1307.399) (-1299.771) [-1300.458] * (-1299.298) (-1298.457) (-1300.304) [-1299.388] -- 0:01:45
      391500 -- (-1297.815) (-1298.653) [-1299.772] (-1299.481) * (-1302.293) [-1297.351] (-1298.187) (-1295.867) -- 0:01:45
      392000 -- (-1299.907) [-1293.924] (-1294.348) (-1294.307) * (-1295.751) (-1294.389) [-1296.744] (-1300.760) -- 0:01:45
      392500 -- (-1300.339) (-1296.595) [-1299.378] (-1296.238) * [-1299.058] (-1297.497) (-1302.544) (-1296.826) -- 0:01:45
      393000 -- (-1300.472) [-1299.107] (-1293.752) (-1303.120) * (-1301.355) (-1301.200) [-1294.743] (-1299.765) -- 0:01:45
      393500 -- (-1298.576) (-1301.776) (-1301.010) [-1298.480] * (-1299.742) (-1297.797) (-1298.226) [-1294.894] -- 0:01:44
      394000 -- (-1299.083) (-1306.958) (-1301.697) [-1296.805] * [-1294.820] (-1297.446) (-1294.436) (-1296.417) -- 0:01:44
      394500 -- (-1298.095) [-1302.540] (-1299.872) (-1298.437) * (-1293.274) (-1293.934) (-1303.842) [-1300.723] -- 0:01:44
      395000 -- [-1302.812] (-1298.242) (-1294.992) (-1298.607) * (-1301.729) (-1293.794) (-1294.816) [-1294.227] -- 0:01:45

      Average standard deviation of split frequencies: 0.001786

      395500 -- (-1299.529) (-1296.221) (-1298.376) [-1303.967] * (-1309.251) (-1294.030) (-1299.664) [-1302.100] -- 0:01:45
      396000 -- (-1298.914) (-1300.499) (-1301.608) [-1303.331] * (-1300.362) [-1298.341] (-1296.182) (-1298.044) -- 0:01:45
      396500 -- [-1301.603] (-1297.139) (-1299.213) (-1303.909) * (-1301.652) [-1297.516] (-1305.375) (-1305.222) -- 0:01:45
      397000 -- (-1302.478) (-1302.392) (-1294.945) [-1296.667] * (-1297.873) (-1303.175) (-1299.174) [-1300.673] -- 0:01:44
      397500 -- (-1301.019) [-1298.806] (-1299.401) (-1302.161) * (-1302.895) (-1297.969) (-1303.754) [-1297.288] -- 0:01:44
      398000 -- (-1300.295) (-1297.797) (-1306.120) [-1295.319] * (-1301.072) (-1301.819) [-1299.940] (-1300.567) -- 0:01:44
      398500 -- (-1300.260) (-1294.186) (-1297.652) [-1293.387] * (-1298.859) (-1300.052) (-1299.067) [-1297.971] -- 0:01:44
      399000 -- (-1301.446) [-1297.743] (-1292.852) (-1296.178) * [-1296.076] (-1296.825) (-1296.995) (-1305.745) -- 0:01:43
      399500 -- (-1298.072) (-1295.786) [-1296.003] (-1302.152) * (-1297.407) [-1296.732] (-1295.007) (-1294.166) -- 0:01:43
      400000 -- (-1297.499) (-1293.209) (-1295.009) [-1303.011] * (-1296.589) [-1305.255] (-1297.403) (-1302.670) -- 0:01:43

      Average standard deviation of split frequencies: 0.001177

      400500 -- (-1297.349) (-1301.308) [-1297.877] (-1301.744) * (-1296.844) [-1295.004] (-1301.412) (-1301.749) -- 0:01:44
      401000 -- [-1299.242] (-1304.970) (-1298.129) (-1298.222) * (-1302.347) (-1295.968) [-1300.364] (-1296.762) -- 0:01:44
      401500 -- (-1294.788) (-1306.801) [-1301.004] (-1298.901) * [-1299.432] (-1299.248) (-1297.068) (-1297.611) -- 0:01:44
      402000 -- (-1294.502) (-1305.078) (-1304.208) [-1296.861] * (-1296.708) (-1296.233) (-1294.440) [-1297.210] -- 0:01:44
      402500 -- (-1297.233) (-1304.052) [-1300.834] (-1297.184) * [-1296.059] (-1305.880) (-1295.407) (-1294.784) -- 0:01:43
      403000 -- (-1296.377) (-1297.853) (-1299.364) [-1301.941] * (-1294.590) [-1298.661] (-1301.015) (-1294.176) -- 0:01:43
      403500 -- (-1298.255) (-1305.566) [-1296.249] (-1300.946) * [-1296.583] (-1297.426) (-1305.135) (-1301.071) -- 0:01:43
      404000 -- (-1295.647) (-1304.638) [-1297.161] (-1301.415) * (-1297.206) [-1302.617] (-1299.179) (-1295.886) -- 0:01:43
      404500 -- (-1296.303) [-1298.451] (-1296.631) (-1299.662) * (-1299.690) (-1307.421) (-1295.681) [-1300.711] -- 0:01:43
      405000 -- [-1298.721] (-1303.640) (-1308.486) (-1294.832) * [-1301.513] (-1310.316) (-1300.711) (-1296.407) -- 0:01:42

      Average standard deviation of split frequencies: 0.001161

      405500 -- (-1293.829) (-1300.097) (-1300.289) [-1293.794] * (-1306.518) [-1297.829] (-1303.170) (-1293.700) -- 0:01:42
      406000 -- [-1297.814] (-1304.512) (-1305.356) (-1300.348) * (-1305.699) [-1296.386] (-1299.511) (-1308.347) -- 0:01:42
      406500 -- [-1295.043] (-1301.003) (-1300.847) (-1305.527) * (-1308.598) [-1293.919] (-1303.713) (-1304.913) -- 0:01:43
      407000 -- (-1301.362) [-1297.936] (-1296.600) (-1307.725) * (-1301.068) (-1295.353) (-1295.736) [-1303.524] -- 0:01:43
      407500 -- (-1297.028) (-1298.043) (-1294.725) [-1302.811] * [-1305.058] (-1296.025) (-1297.000) (-1307.641) -- 0:01:43
      408000 -- [-1294.309] (-1295.495) (-1293.429) (-1305.499) * (-1303.196) (-1297.792) (-1297.361) [-1296.491] -- 0:01:43
      408500 -- (-1302.947) (-1295.734) [-1298.988] (-1296.137) * (-1296.516) (-1295.770) [-1298.300] (-1299.366) -- 0:01:42
      409000 -- (-1298.381) [-1298.087] (-1301.030) (-1297.386) * (-1302.942) (-1296.135) [-1298.835] (-1298.415) -- 0:01:42
      409500 -- (-1296.238) [-1302.085] (-1294.928) (-1299.935) * (-1303.117) [-1294.188] (-1297.352) (-1297.216) -- 0:01:42
      410000 -- (-1298.396) (-1296.501) (-1294.158) [-1298.171] * [-1298.178] (-1296.940) (-1300.450) (-1303.599) -- 0:01:42

      Average standard deviation of split frequencies: 0.001148

      410500 -- [-1296.121] (-1297.924) (-1295.676) (-1299.312) * (-1296.706) (-1298.551) [-1301.959] (-1309.576) -- 0:01:41
      411000 -- (-1293.228) [-1297.929] (-1300.898) (-1299.870) * (-1297.563) (-1302.062) (-1298.672) [-1298.570] -- 0:01:41
      411500 -- (-1295.755) (-1301.346) [-1298.801] (-1302.487) * [-1296.371] (-1299.185) (-1294.868) (-1298.238) -- 0:01:41
      412000 -- (-1298.271) (-1297.153) [-1301.026] (-1307.386) * (-1300.525) (-1306.081) [-1298.839] (-1298.463) -- 0:01:41
      412500 -- (-1299.626) (-1303.902) [-1300.318] (-1296.820) * (-1306.618) [-1301.031] (-1303.327) (-1302.871) -- 0:01:42
      413000 -- (-1301.240) [-1296.825] (-1302.380) (-1300.732) * (-1301.318) [-1297.698] (-1302.791) (-1295.360) -- 0:01:42
      413500 -- (-1303.197) [-1301.198] (-1299.048) (-1301.762) * (-1300.644) [-1303.425] (-1306.285) (-1302.142) -- 0:01:42
      414000 -- (-1293.726) (-1297.935) (-1294.093) [-1302.061] * (-1303.128) (-1294.958) [-1299.076] (-1303.408) -- 0:01:41
      414500 -- (-1297.625) (-1297.996) (-1307.217) [-1296.880] * (-1301.083) [-1296.594] (-1297.443) (-1296.645) -- 0:01:41
      415000 -- (-1296.965) [-1294.769] (-1297.781) (-1295.801) * (-1298.669) (-1298.728) [-1298.170] (-1299.712) -- 0:01:41

      Average standard deviation of split frequencies: 0.001133

      415500 -- (-1299.996) (-1304.847) [-1294.631] (-1305.024) * [-1299.443] (-1297.749) (-1295.148) (-1310.056) -- 0:01:41
      416000 -- [-1297.242] (-1296.228) (-1297.135) (-1304.234) * (-1296.048) (-1301.473) [-1295.373] (-1303.647) -- 0:01:41
      416500 -- (-1295.613) [-1296.377] (-1302.179) (-1301.748) * (-1302.038) (-1295.922) (-1297.202) [-1297.863] -- 0:01:40
      417000 -- (-1305.090) (-1301.475) (-1300.627) [-1296.036] * (-1298.951) (-1302.519) (-1302.670) [-1299.561] -- 0:01:40
      417500 -- (-1298.906) (-1294.998) (-1296.545) [-1291.748] * (-1294.796) (-1309.074) [-1296.881] (-1297.623) -- 0:01:40
      418000 -- (-1301.648) (-1296.508) (-1302.729) [-1299.078] * (-1298.746) (-1297.601) [-1298.142] (-1292.968) -- 0:01:40
      418500 -- [-1296.508] (-1302.812) (-1298.633) (-1295.430) * (-1296.951) [-1298.443] (-1294.915) (-1300.023) -- 0:01:41
      419000 -- [-1298.035] (-1298.699) (-1300.453) (-1300.277) * (-1302.036) (-1294.922) (-1296.318) [-1299.586] -- 0:01:41
      419500 -- (-1298.147) (-1309.019) [-1300.369] (-1299.121) * (-1300.327) [-1296.420] (-1299.428) (-1299.079) -- 0:01:41
      420000 -- (-1297.733) [-1297.403] (-1301.214) (-1301.544) * (-1297.588) (-1294.900) (-1298.464) [-1297.719] -- 0:01:40

      Average standard deviation of split frequencies: 0.001121

      420500 -- [-1295.185] (-1294.223) (-1297.639) (-1295.867) * (-1300.841) (-1296.801) (-1296.861) [-1297.707] -- 0:01:40
      421000 -- (-1292.877) (-1292.340) [-1295.442] (-1300.291) * (-1304.509) [-1296.318] (-1293.632) (-1302.116) -- 0:01:40
      421500 -- (-1300.890) (-1296.410) [-1295.574] (-1301.917) * (-1303.824) [-1295.921] (-1297.094) (-1298.656) -- 0:01:40
      422000 -- (-1301.566) (-1301.500) [-1296.998] (-1298.407) * [-1296.896] (-1296.712) (-1294.924) (-1304.875) -- 0:01:39
      422500 -- (-1296.199) (-1298.698) [-1294.317] (-1293.846) * (-1297.432) (-1301.962) (-1299.106) [-1297.014] -- 0:01:39
      423000 -- [-1297.306] (-1301.578) (-1299.932) (-1298.852) * (-1302.886) (-1297.132) [-1299.226] (-1294.314) -- 0:01:39
      423500 -- (-1299.583) (-1302.371) (-1293.428) [-1303.483] * [-1299.809] (-1297.801) (-1299.600) (-1300.307) -- 0:01:39
      424000 -- (-1301.761) (-1297.001) [-1293.828] (-1301.535) * (-1294.551) (-1296.518) [-1297.752] (-1302.342) -- 0:01:40
      424500 -- [-1301.516] (-1301.848) (-1295.907) (-1300.752) * (-1294.683) (-1294.242) [-1297.499] (-1303.988) -- 0:01:40
      425000 -- (-1297.770) [-1296.048] (-1302.530) (-1297.260) * (-1297.611) (-1298.436) [-1297.041] (-1298.977) -- 0:01:40

      Average standard deviation of split frequencies: 0.001107

      425500 -- (-1300.826) (-1300.314) [-1294.553] (-1308.118) * (-1295.056) (-1299.821) (-1297.528) [-1295.327] -- 0:01:39
      426000 -- (-1299.962) (-1296.396) (-1299.500) [-1294.529] * [-1296.991] (-1310.468) (-1296.992) (-1299.856) -- 0:01:39
      426500 -- (-1298.386) [-1290.610] (-1293.819) (-1297.923) * (-1298.959) (-1302.271) (-1295.164) [-1295.268] -- 0:01:39
      427000 -- [-1297.762] (-1295.270) (-1302.548) (-1308.490) * (-1301.229) (-1300.313) (-1295.808) [-1295.071] -- 0:01:39
      427500 -- (-1297.644) [-1301.306] (-1306.318) (-1297.049) * (-1295.140) (-1298.167) (-1299.907) [-1295.838] -- 0:01:39
      428000 -- [-1296.816] (-1299.288) (-1303.559) (-1298.251) * (-1297.175) (-1301.356) (-1301.743) [-1299.609] -- 0:01:38
      428500 -- (-1300.201) [-1294.538] (-1301.449) (-1297.577) * (-1294.982) (-1297.345) (-1295.689) [-1294.458] -- 0:01:38
      429000 -- (-1299.665) [-1299.557] (-1302.996) (-1295.905) * (-1294.225) (-1301.665) [-1303.049] (-1297.559) -- 0:01:38
      429500 -- (-1296.260) (-1297.116) [-1297.921] (-1300.516) * [-1296.301] (-1300.506) (-1303.901) (-1299.256) -- 0:01:38
      430000 -- (-1299.790) (-1296.664) [-1296.059] (-1295.715) * [-1294.219] (-1309.122) (-1302.837) (-1297.749) -- 0:01:39

      Average standard deviation of split frequencies: 0.001095

      430500 -- (-1304.396) [-1298.311] (-1301.982) (-1297.985) * (-1300.140) [-1302.924] (-1299.626) (-1298.525) -- 0:01:39
      431000 -- (-1297.284) (-1304.446) [-1295.014] (-1304.538) * (-1297.208) [-1300.217] (-1297.488) (-1297.468) -- 0:01:39
      431500 -- (-1295.050) (-1294.725) [-1299.241] (-1299.593) * (-1295.496) (-1298.137) [-1292.647] (-1302.048) -- 0:01:38
      432000 -- [-1296.182] (-1298.302) (-1298.070) (-1299.818) * (-1295.183) (-1302.430) [-1296.076] (-1301.147) -- 0:01:38
      432500 -- (-1296.364) (-1299.102) [-1300.557] (-1299.512) * (-1294.866) (-1298.306) [-1291.298] (-1301.716) -- 0:01:38
      433000 -- (-1304.113) (-1294.351) [-1294.741] (-1310.281) * (-1295.096) [-1299.635] (-1301.412) (-1300.568) -- 0:01:38
      433500 -- (-1300.834) [-1296.649] (-1300.061) (-1309.096) * (-1297.135) (-1301.992) [-1294.608] (-1298.051) -- 0:01:38
      434000 -- (-1294.828) [-1297.685] (-1297.977) (-1300.026) * [-1296.396] (-1303.531) (-1304.219) (-1298.999) -- 0:01:37
      434500 -- (-1294.000) (-1295.983) (-1302.709) [-1297.186] * (-1295.023) (-1302.543) [-1295.660] (-1298.544) -- 0:01:37
      435000 -- (-1303.234) (-1298.622) [-1298.318] (-1304.420) * (-1302.197) (-1300.104) [-1297.982] (-1297.298) -- 0:01:37

      Average standard deviation of split frequencies: 0.001081

      435500 -- (-1294.407) [-1297.010] (-1297.871) (-1301.560) * (-1300.995) [-1296.211] (-1296.614) (-1300.578) -- 0:01:38
      436000 -- (-1299.190) [-1297.321] (-1298.007) (-1296.621) * (-1296.492) (-1295.161) (-1299.931) [-1300.114] -- 0:01:38
      436500 -- [-1298.113] (-1306.715) (-1297.669) (-1296.421) * [-1296.775] (-1295.875) (-1302.518) (-1305.745) -- 0:01:38
      437000 -- (-1300.119) [-1295.666] (-1295.517) (-1301.948) * [-1296.304] (-1298.439) (-1299.131) (-1306.300) -- 0:01:37
      437500 -- [-1295.195] (-1302.336) (-1295.792) (-1298.165) * [-1293.843] (-1298.095) (-1302.475) (-1305.774) -- 0:01:37
      438000 -- (-1293.888) (-1299.412) [-1298.422] (-1299.423) * (-1294.345) [-1300.442] (-1299.692) (-1301.284) -- 0:01:37
      438500 -- (-1300.555) (-1299.566) (-1302.686) [-1299.741] * (-1294.866) (-1303.057) (-1299.086) [-1306.112] -- 0:01:37
      439000 -- [-1303.924] (-1294.444) (-1302.002) (-1297.330) * (-1297.642) (-1301.397) (-1295.316) [-1296.288] -- 0:01:37
      439500 -- [-1296.374] (-1295.795) (-1300.077) (-1297.715) * (-1294.431) (-1301.813) (-1301.591) [-1303.766] -- 0:01:36
      440000 -- (-1305.219) [-1298.337] (-1305.499) (-1299.512) * [-1294.386] (-1304.990) (-1297.532) (-1300.817) -- 0:01:36

      Average standard deviation of split frequencies: 0.001070

      440500 -- (-1295.279) [-1297.395] (-1300.848) (-1298.759) * (-1294.361) [-1300.320] (-1297.304) (-1303.107) -- 0:01:36
      441000 -- (-1295.656) (-1296.916) [-1300.828] (-1301.727) * [-1296.203] (-1299.793) (-1299.799) (-1307.585) -- 0:01:36
      441500 -- [-1297.075] (-1306.850) (-1306.199) (-1293.737) * (-1294.522) [-1299.983] (-1301.913) (-1297.448) -- 0:01:37
      442000 -- [-1293.556] (-1303.233) (-1297.690) (-1301.609) * (-1294.038) [-1303.746] (-1296.722) (-1298.826) -- 0:01:37
      442500 -- [-1293.790] (-1298.720) (-1301.605) (-1297.152) * [-1292.149] (-1302.829) (-1298.135) (-1298.844) -- 0:01:37
      443000 -- (-1300.397) (-1295.675) (-1304.792) [-1299.992] * [-1297.398] (-1302.303) (-1302.194) (-1296.054) -- 0:01:36
      443500 -- (-1296.093) (-1302.023) [-1298.250] (-1296.353) * (-1305.996) [-1296.489] (-1301.196) (-1296.290) -- 0:01:36
      444000 -- [-1294.123] (-1300.457) (-1301.018) (-1293.260) * (-1301.873) (-1297.639) [-1298.800] (-1294.112) -- 0:01:36
      444500 -- [-1296.607] (-1298.713) (-1297.345) (-1298.701) * (-1296.373) [-1302.272] (-1296.187) (-1298.332) -- 0:01:36
      445000 -- (-1296.746) [-1300.298] (-1295.135) (-1305.846) * (-1303.630) (-1299.638) (-1299.821) [-1294.527] -- 0:01:36

      Average standard deviation of split frequencies: 0.001057

      445500 -- [-1296.011] (-1309.286) (-1297.472) (-1296.704) * (-1297.642) (-1301.344) [-1297.465] (-1297.816) -- 0:01:35
      446000 -- (-1293.821) [-1294.518] (-1297.254) (-1302.078) * (-1301.025) [-1294.764] (-1305.892) (-1294.124) -- 0:01:35
      446500 -- [-1298.852] (-1301.500) (-1300.883) (-1295.421) * [-1302.345] (-1297.927) (-1300.215) (-1294.275) -- 0:01:35
      447000 -- (-1306.266) (-1296.272) (-1300.873) [-1299.062] * (-1307.278) (-1296.115) (-1303.226) [-1300.256] -- 0:01:35
      447500 -- (-1295.912) [-1297.074] (-1300.406) (-1298.265) * (-1303.339) (-1301.395) [-1303.742] (-1295.248) -- 0:01:36
      448000 -- (-1296.530) [-1298.738] (-1298.808) (-1302.234) * (-1300.073) (-1299.499) (-1298.931) [-1303.873] -- 0:01:36
      448500 -- (-1296.376) (-1307.357) [-1298.441] (-1302.408) * [-1298.721] (-1296.488) (-1295.526) (-1298.033) -- 0:01:35
      449000 -- (-1301.317) [-1296.577] (-1300.896) (-1299.844) * (-1293.583) (-1298.950) [-1302.218] (-1302.699) -- 0:01:35
      449500 -- (-1294.460) (-1301.842) [-1299.556] (-1301.698) * [-1300.270] (-1294.015) (-1295.425) (-1299.753) -- 0:01:35
      450000 -- (-1298.521) [-1297.570] (-1301.254) (-1294.420) * (-1300.036) [-1294.560] (-1298.229) (-1301.765) -- 0:01:35

      Average standard deviation of split frequencies: 0.001569

      450500 -- (-1294.788) (-1301.894) [-1297.511] (-1298.841) * [-1299.854] (-1298.619) (-1297.808) (-1297.092) -- 0:01:35
      451000 -- (-1298.129) [-1306.705] (-1296.564) (-1302.867) * [-1300.602] (-1305.601) (-1302.809) (-1297.656) -- 0:01:34
      451500 -- (-1304.492) [-1297.307] (-1304.426) (-1306.608) * (-1297.320) (-1303.366) [-1299.666] (-1300.996) -- 0:01:34
      452000 -- (-1305.207) [-1301.246] (-1299.196) (-1301.818) * [-1292.338] (-1304.622) (-1299.198) (-1304.353) -- 0:01:34
      452500 -- (-1299.687) (-1296.482) [-1299.459] (-1297.801) * (-1300.692) (-1305.350) [-1296.836] (-1296.283) -- 0:01:34
      453000 -- (-1304.404) (-1292.962) [-1299.606] (-1301.420) * (-1298.225) [-1300.425] (-1295.201) (-1299.693) -- 0:01:35
      453500 -- (-1304.117) (-1296.043) [-1302.100] (-1302.128) * (-1299.335) [-1296.748] (-1296.170) (-1304.142) -- 0:01:35
      454000 -- (-1299.888) [-1294.705] (-1298.370) (-1307.264) * (-1295.988) (-1297.419) (-1300.163) [-1294.959] -- 0:01:35
      454500 -- (-1298.492) (-1296.198) [-1296.048] (-1301.085) * (-1303.371) [-1298.209] (-1294.743) (-1296.315) -- 0:01:34
      455000 -- (-1300.292) (-1293.894) [-1298.991] (-1298.439) * (-1298.591) (-1297.678) [-1297.953] (-1302.528) -- 0:01:34

      Average standard deviation of split frequencies: 0.001551

      455500 -- (-1297.414) [-1294.321] (-1307.312) (-1302.220) * (-1299.643) [-1296.314] (-1302.540) (-1309.572) -- 0:01:34
      456000 -- (-1295.926) (-1296.055) (-1308.486) [-1295.217] * (-1298.033) (-1302.001) [-1300.032] (-1301.439) -- 0:01:34
      456500 -- (-1303.493) (-1299.360) [-1301.786] (-1294.733) * (-1300.086) (-1300.727) [-1297.363] (-1299.011) -- 0:01:34
      457000 -- [-1296.952] (-1295.609) (-1300.234) (-1300.418) * (-1296.047) [-1300.490] (-1298.117) (-1296.634) -- 0:01:33
      457500 -- [-1295.478] (-1294.988) (-1304.446) (-1296.854) * (-1298.903) (-1303.220) [-1292.855] (-1303.256) -- 0:01:33
      458000 -- (-1301.835) (-1297.204) (-1306.497) [-1299.871] * [-1296.437] (-1295.763) (-1295.716) (-1302.943) -- 0:01:33
      458500 -- [-1291.954] (-1299.673) (-1300.224) (-1303.832) * [-1299.842] (-1306.382) (-1302.640) (-1301.365) -- 0:01:33
      459000 -- (-1295.483) (-1296.848) [-1307.773] (-1302.678) * [-1297.503] (-1300.351) (-1297.376) (-1301.492) -- 0:01:34
      459500 -- (-1299.343) [-1294.651] (-1306.189) (-1298.905) * [-1299.893] (-1295.646) (-1301.580) (-1299.305) -- 0:01:34
      460000 -- (-1296.963) (-1295.333) [-1300.364] (-1298.083) * [-1299.851] (-1300.462) (-1297.913) (-1302.911) -- 0:01:33

      Average standard deviation of split frequencies: 0.001535

      460500 -- (-1297.851) [-1297.940] (-1301.624) (-1304.864) * (-1299.188) (-1300.808) [-1303.850] (-1301.180) -- 0:01:33
      461000 -- [-1295.533] (-1296.946) (-1305.915) (-1302.619) * (-1295.325) (-1305.629) (-1294.726) [-1300.979] -- 0:01:33
      461500 -- (-1295.415) (-1301.499) [-1305.685] (-1296.655) * [-1294.739] (-1304.679) (-1304.707) (-1295.107) -- 0:01:33
      462000 -- (-1297.794) (-1303.217) [-1304.518] (-1300.898) * (-1297.534) (-1307.350) [-1304.986] (-1301.079) -- 0:01:33
      462500 -- (-1310.602) [-1295.031] (-1299.440) (-1305.676) * (-1293.795) [-1303.673] (-1300.586) (-1297.315) -- 0:01:32
      463000 -- (-1295.658) (-1299.256) (-1302.250) [-1297.797] * (-1300.100) (-1304.643) (-1305.540) [-1294.909] -- 0:01:32
      463500 -- (-1293.061) [-1299.120] (-1292.397) (-1302.010) * (-1295.729) (-1306.391) (-1302.163) [-1306.360] -- 0:01:32
      464000 -- [-1295.676] (-1291.557) (-1296.189) (-1301.391) * (-1299.710) (-1300.310) (-1296.942) [-1297.224] -- 0:01:32
      464500 -- [-1295.580] (-1303.324) (-1300.259) (-1305.708) * [-1299.805] (-1296.392) (-1295.491) (-1296.112) -- 0:01:32
      465000 -- (-1301.252) (-1299.240) (-1299.865) [-1301.449] * (-1294.901) [-1298.147] (-1301.604) (-1297.017) -- 0:01:33

      Average standard deviation of split frequencies: 0.001517

      465500 -- (-1300.396) (-1304.238) (-1296.662) [-1295.675] * (-1303.084) (-1294.165) [-1301.582] (-1308.042) -- 0:01:33
      466000 -- (-1299.242) (-1303.252) [-1295.270] (-1305.341) * (-1299.753) (-1301.143) (-1299.122) [-1299.655] -- 0:01:32
      466500 -- [-1298.293] (-1300.670) (-1299.869) (-1300.270) * (-1294.263) [-1298.146] (-1308.532) (-1299.858) -- 0:01:32
      467000 -- [-1298.183] (-1299.627) (-1302.464) (-1298.080) * (-1297.968) (-1310.453) (-1303.617) [-1302.676] -- 0:01:32
      467500 -- (-1297.455) [-1300.196] (-1298.694) (-1300.236) * (-1296.366) (-1295.921) [-1294.680] (-1303.230) -- 0:01:32
      468000 -- (-1304.592) (-1296.266) [-1302.479] (-1295.026) * (-1302.170) [-1295.645] (-1297.441) (-1301.303) -- 0:01:32
      468500 -- (-1301.148) (-1306.249) (-1298.188) [-1297.198] * (-1294.376) (-1301.510) [-1296.168] (-1294.779) -- 0:01:31
      469000 -- (-1297.273) [-1296.498] (-1302.161) (-1296.499) * [-1297.750] (-1302.215) (-1296.305) (-1301.576) -- 0:01:31
      469500 -- (-1299.222) [-1297.584] (-1298.117) (-1302.625) * (-1298.365) (-1299.148) [-1292.086] (-1298.041) -- 0:01:31
      470000 -- (-1296.178) [-1301.690] (-1295.625) (-1308.570) * [-1301.233] (-1296.118) (-1290.980) (-1298.279) -- 0:01:31

      Average standard deviation of split frequencies: 0.001502

      470500 -- (-1299.046) (-1298.320) [-1298.541] (-1297.730) * [-1298.538] (-1301.556) (-1294.268) (-1298.995) -- 0:01:32
      471000 -- (-1297.200) (-1302.868) [-1297.174] (-1299.692) * (-1303.413) (-1300.893) [-1296.300] (-1296.252) -- 0:01:32
      471500 -- [-1296.028] (-1307.302) (-1303.143) (-1299.357) * [-1295.983] (-1299.454) (-1302.881) (-1300.702) -- 0:01:31
      472000 -- (-1298.325) (-1300.055) [-1304.070] (-1300.243) * (-1299.931) (-1296.451) (-1299.648) [-1299.431] -- 0:01:31
      472500 -- (-1295.825) (-1302.324) (-1300.645) [-1293.702] * [-1297.600] (-1297.320) (-1294.687) (-1303.390) -- 0:01:31
      473000 -- (-1304.014) (-1297.885) (-1303.141) [-1299.671] * (-1299.844) (-1297.108) (-1295.870) [-1295.982] -- 0:01:31
      473500 -- (-1299.717) [-1295.576] (-1298.169) (-1307.003) * (-1294.717) (-1295.820) [-1301.647] (-1297.933) -- 0:01:31
      474000 -- [-1297.297] (-1295.254) (-1306.152) (-1301.569) * (-1301.320) [-1300.528] (-1302.085) (-1302.317) -- 0:01:30
      474500 -- [-1294.637] (-1303.308) (-1311.948) (-1301.075) * [-1294.527] (-1298.183) (-1300.085) (-1299.427) -- 0:01:30
      475000 -- [-1294.365] (-1299.840) (-1307.681) (-1303.500) * [-1291.772] (-1298.469) (-1307.943) (-1299.279) -- 0:01:30

      Average standard deviation of split frequencies: 0.001486

      475500 -- (-1300.511) (-1298.759) [-1306.358] (-1297.470) * [-1295.478] (-1303.178) (-1298.186) (-1310.273) -- 0:01:30
      476000 -- (-1301.087) (-1295.446) (-1302.267) [-1299.266] * (-1303.312) [-1298.963] (-1306.058) (-1303.397) -- 0:01:30
      476500 -- (-1305.409) (-1299.603) (-1301.675) [-1295.495] * (-1296.666) [-1296.824] (-1299.302) (-1301.512) -- 0:01:31
      477000 -- (-1301.076) (-1294.834) [-1307.079] (-1296.958) * (-1294.944) (-1299.997) [-1297.939] (-1304.036) -- 0:01:31
      477500 -- (-1295.408) [-1295.019] (-1300.159) (-1299.129) * (-1295.114) (-1300.172) [-1297.172] (-1308.718) -- 0:01:30
      478000 -- (-1295.638) (-1294.082) [-1303.491] (-1295.603) * (-1301.461) [-1296.896] (-1299.190) (-1298.129) -- 0:01:30
      478500 -- (-1296.815) [-1297.178] (-1307.792) (-1294.744) * (-1302.334) (-1298.691) (-1300.141) [-1300.248] -- 0:01:30
      479000 -- (-1300.326) [-1295.886] (-1299.776) (-1303.697) * [-1298.936] (-1300.193) (-1293.866) (-1303.778) -- 0:01:30
      479500 -- (-1297.878) [-1295.122] (-1296.476) (-1292.312) * (-1301.027) [-1300.772] (-1299.303) (-1297.018) -- 0:01:30
      480000 -- (-1301.787) (-1303.140) (-1300.602) [-1296.725] * (-1298.133) [-1304.107] (-1298.584) (-1298.181) -- 0:01:29

      Average standard deviation of split frequencies: 0.001471

      480500 -- [-1294.349] (-1306.714) (-1299.042) (-1298.532) * [-1301.548] (-1299.884) (-1299.431) (-1295.466) -- 0:01:29
      481000 -- (-1305.800) [-1298.578] (-1298.337) (-1293.757) * (-1300.157) (-1298.361) [-1297.870] (-1296.464) -- 0:01:29
      481500 -- (-1306.552) [-1295.853] (-1309.681) (-1301.746) * [-1298.697] (-1295.774) (-1300.024) (-1300.002) -- 0:01:29
      482000 -- (-1302.028) (-1303.935) (-1303.123) [-1302.206] * (-1295.275) [-1301.114] (-1304.749) (-1303.325) -- 0:01:30
      482500 -- [-1296.112] (-1304.748) (-1301.579) (-1299.277) * (-1300.198) [-1294.639] (-1296.797) (-1304.834) -- 0:01:30
      483000 -- (-1300.663) [-1295.111] (-1299.190) (-1302.134) * (-1297.392) (-1301.396) [-1296.563] (-1304.681) -- 0:01:29
      483500 -- (-1302.106) (-1295.301) (-1299.684) [-1296.625] * (-1298.948) [-1298.376] (-1293.337) (-1297.133) -- 0:01:29
      484000 -- (-1305.917) (-1297.695) [-1297.800] (-1304.306) * (-1295.760) (-1303.028) (-1302.590) [-1297.839] -- 0:01:29
      484500 -- (-1297.864) [-1300.241] (-1298.016) (-1302.702) * (-1295.649) (-1305.669) [-1297.621] (-1297.259) -- 0:01:29
      485000 -- (-1299.822) (-1305.354) (-1294.477) [-1300.299] * (-1297.155) (-1302.143) [-1295.552] (-1295.791) -- 0:01:29

      Average standard deviation of split frequencies: 0.001455

      485500 -- (-1303.083) (-1299.877) [-1297.041] (-1301.007) * (-1300.818) (-1304.359) [-1296.764] (-1298.009) -- 0:01:29
      486000 -- (-1305.008) (-1300.192) [-1298.931] (-1297.442) * (-1294.843) (-1293.658) [-1293.755] (-1304.315) -- 0:01:28
      486500 -- [-1301.179] (-1299.140) (-1301.615) (-1301.877) * [-1295.369] (-1301.083) (-1295.354) (-1301.539) -- 0:01:28
      487000 -- [-1294.644] (-1308.875) (-1295.723) (-1295.678) * (-1307.860) [-1300.172] (-1297.716) (-1295.384) -- 0:01:28
      487500 -- [-1294.153] (-1303.311) (-1296.858) (-1295.705) * (-1305.074) (-1297.131) (-1293.721) [-1295.922] -- 0:01:28
      488000 -- [-1294.519] (-1305.118) (-1297.953) (-1301.856) * (-1302.189) (-1303.478) [-1299.356] (-1303.537) -- 0:01:29
      488500 -- (-1301.391) (-1297.507) (-1294.194) [-1295.472] * (-1300.478) [-1303.160] (-1304.934) (-1299.710) -- 0:01:29
      489000 -- (-1294.106) [-1302.683] (-1296.404) (-1306.925) * (-1300.482) [-1301.585] (-1298.323) (-1297.588) -- 0:01:28
      489500 -- (-1298.720) (-1300.909) [-1294.641] (-1295.304) * (-1305.649) (-1303.469) [-1297.622] (-1295.417) -- 0:01:28
      490000 -- (-1296.205) (-1298.224) (-1293.976) [-1295.207] * (-1297.978) (-1293.381) [-1296.222] (-1298.553) -- 0:01:28

      Average standard deviation of split frequencies: 0.001441

      490500 -- (-1299.127) (-1300.657) [-1306.715] (-1296.580) * (-1296.276) [-1296.047] (-1295.585) (-1298.000) -- 0:01:28
      491000 -- (-1303.951) (-1296.720) (-1304.711) [-1297.139] * (-1303.680) (-1300.749) [-1296.033] (-1300.299) -- 0:01:28
      491500 -- (-1304.998) (-1303.941) [-1296.450] (-1301.520) * (-1301.957) [-1298.924] (-1294.519) (-1293.360) -- 0:01:27
      492000 -- [-1299.473] (-1304.618) (-1297.443) (-1296.319) * (-1297.461) (-1298.962) [-1299.907] (-1295.963) -- 0:01:27
      492500 -- (-1295.065) (-1305.931) (-1302.474) [-1296.349] * (-1300.211) (-1301.343) (-1293.969) [-1297.428] -- 0:01:27
      493000 -- (-1301.415) (-1307.473) [-1297.121] (-1295.580) * (-1294.965) (-1304.151) (-1296.405) [-1295.843] -- 0:01:27
      493500 -- [-1294.187] (-1301.915) (-1298.704) (-1303.087) * [-1296.679] (-1301.586) (-1302.030) (-1294.701) -- 0:01:27
      494000 -- (-1296.035) (-1302.285) [-1294.327] (-1303.665) * (-1297.641) (-1301.025) (-1304.923) [-1296.947] -- 0:01:28
      494500 -- (-1298.386) (-1304.888) (-1296.616) [-1301.408] * (-1299.804) [-1296.958] (-1299.535) (-1295.179) -- 0:01:27
      495000 -- (-1294.897) (-1296.151) (-1299.459) [-1297.415] * (-1292.325) (-1300.975) [-1299.613] (-1296.303) -- 0:01:27

      Average standard deviation of split frequencies: 0.001426

      495500 -- (-1299.952) [-1298.574] (-1302.772) (-1295.484) * (-1296.463) (-1296.646) (-1300.636) [-1304.023] -- 0:01:27
      496000 -- (-1304.248) (-1305.618) (-1295.537) [-1297.981] * (-1294.000) (-1305.946) (-1309.733) [-1293.509] -- 0:01:27
      496500 -- [-1298.322] (-1301.170) (-1297.464) (-1300.805) * [-1294.242] (-1298.554) (-1304.264) (-1297.229) -- 0:01:27
      497000 -- (-1293.168) [-1296.536] (-1296.133) (-1297.979) * (-1298.134) [-1302.556] (-1296.353) (-1295.399) -- 0:01:27
      497500 -- (-1299.488) [-1296.931] (-1306.672) (-1299.237) * (-1296.366) (-1299.715) [-1298.898] (-1297.061) -- 0:01:26
      498000 -- (-1298.317) (-1295.452) [-1297.957] (-1298.063) * (-1295.430) (-1304.133) [-1298.010] (-1297.720) -- 0:01:26
      498500 -- (-1299.166) (-1294.434) [-1294.515] (-1293.989) * [-1294.463] (-1302.517) (-1304.092) (-1297.132) -- 0:01:26
      499000 -- (-1299.682) [-1298.704] (-1296.724) (-1298.900) * (-1302.666) (-1304.550) (-1303.975) [-1300.025] -- 0:01:26
      499500 -- (-1308.918) (-1293.777) (-1298.689) [-1296.899] * [-1299.327] (-1310.159) (-1301.841) (-1298.079) -- 0:01:27
      500000 -- [-1302.222] (-1296.860) (-1294.986) (-1296.085) * (-1297.393) (-1302.952) (-1298.452) [-1298.854] -- 0:01:27

      Average standard deviation of split frequencies: 0.001412

      500500 -- (-1304.983) (-1298.128) (-1297.388) [-1292.933] * (-1297.278) (-1307.814) (-1297.114) [-1295.257] -- 0:01:26
      501000 -- (-1301.156) [-1300.077] (-1298.927) (-1296.627) * (-1302.853) (-1301.216) [-1297.599] (-1298.466) -- 0:01:26
      501500 -- (-1294.913) (-1302.094) [-1300.689] (-1298.874) * (-1298.920) (-1303.578) (-1297.692) [-1302.677] -- 0:01:26
      502000 -- (-1294.582) [-1300.328] (-1293.360) (-1308.217) * (-1298.651) (-1305.684) (-1308.083) [-1303.298] -- 0:01:26
      502500 -- [-1294.383] (-1301.173) (-1297.899) (-1301.312) * [-1296.872] (-1301.367) (-1297.501) (-1298.544) -- 0:01:26
      503000 -- (-1293.532) (-1294.320) [-1302.973] (-1295.159) * [-1298.893] (-1302.203) (-1303.568) (-1294.152) -- 0:01:25
      503500 -- (-1300.415) (-1296.720) [-1297.620] (-1297.632) * (-1305.809) [-1298.555] (-1300.782) (-1300.248) -- 0:01:25
      504000 -- (-1297.303) (-1302.102) [-1293.409] (-1297.030) * (-1301.941) [-1301.408] (-1305.421) (-1301.295) -- 0:01:25
      504500 -- (-1295.407) (-1300.181) (-1293.312) [-1300.418] * [-1298.339] (-1298.996) (-1300.711) (-1304.857) -- 0:01:25
      505000 -- (-1302.871) (-1303.181) [-1297.611] (-1296.661) * (-1300.233) (-1296.008) (-1301.364) [-1302.324] -- 0:01:25

      Average standard deviation of split frequencies: 0.001397

      505500 -- [-1297.543] (-1303.084) (-1295.009) (-1295.942) * (-1297.237) [-1298.190] (-1303.261) (-1298.420) -- 0:01:26
      506000 -- (-1305.444) (-1300.927) (-1295.675) [-1306.741] * [-1295.655] (-1299.943) (-1299.247) (-1300.193) -- 0:01:25
      506500 -- [-1294.069] (-1299.660) (-1294.701) (-1301.885) * (-1300.965) (-1312.035) [-1301.712] (-1297.299) -- 0:01:25
      507000 -- [-1299.355] (-1299.681) (-1299.218) (-1299.767) * (-1298.723) (-1301.943) (-1306.352) [-1297.302] -- 0:01:25
      507500 -- [-1294.859] (-1296.760) (-1303.217) (-1304.344) * (-1298.062) [-1306.898] (-1299.513) (-1317.955) -- 0:01:25
      508000 -- (-1294.725) (-1298.785) [-1297.258] (-1300.092) * (-1298.551) (-1294.395) [-1297.405] (-1301.475) -- 0:01:25
      508500 -- (-1298.214) (-1299.700) [-1298.170] (-1297.837) * (-1300.889) (-1302.561) (-1298.403) [-1304.282] -- 0:01:25
      509000 -- (-1304.369) [-1302.928] (-1295.274) (-1300.725) * [-1298.942] (-1305.529) (-1296.080) (-1297.265) -- 0:01:24
      509500 -- (-1306.283) (-1299.072) [-1294.173] (-1306.450) * [-1303.910] (-1305.116) (-1299.022) (-1295.667) -- 0:01:24
      510000 -- [-1296.398] (-1297.677) (-1301.801) (-1300.214) * [-1302.138] (-1301.064) (-1304.213) (-1295.006) -- 0:01:24

      Average standard deviation of split frequencies: 0.001385

      510500 -- [-1298.357] (-1301.056) (-1298.617) (-1303.555) * (-1303.718) (-1298.363) (-1298.578) [-1301.257] -- 0:01:24
      511000 -- (-1302.344) [-1294.149] (-1302.392) (-1304.647) * (-1306.746) (-1299.934) [-1299.411] (-1298.040) -- 0:01:24
      511500 -- (-1298.019) [-1298.064] (-1307.612) (-1297.325) * (-1306.963) (-1301.129) (-1303.400) [-1299.543] -- 0:01:24
      512000 -- (-1303.332) (-1305.398) [-1297.079] (-1300.380) * (-1299.300) (-1301.942) (-1297.119) [-1296.501] -- 0:01:24
      512500 -- [-1299.147] (-1305.867) (-1300.447) (-1299.643) * (-1299.502) (-1304.301) (-1301.579) [-1298.627] -- 0:01:24
      513000 -- [-1297.794] (-1295.944) (-1296.789) (-1307.045) * [-1298.339] (-1297.423) (-1294.705) (-1300.567) -- 0:01:24
      513500 -- [-1295.269] (-1302.347) (-1303.166) (-1306.645) * (-1296.894) (-1300.551) [-1294.025] (-1300.561) -- 0:01:24
      514000 -- (-1300.195) [-1297.361] (-1302.881) (-1300.778) * (-1293.624) (-1294.570) [-1292.561] (-1297.543) -- 0:01:24
      514500 -- (-1298.728) (-1295.119) [-1298.070] (-1302.375) * (-1299.338) (-1300.812) (-1300.371) [-1295.170] -- 0:01:23
      515000 -- (-1298.171) [-1296.469] (-1300.996) (-1303.235) * (-1301.767) (-1299.133) (-1301.065) [-1295.086] -- 0:01:23

      Average standard deviation of split frequencies: 0.001370

      515500 -- [-1300.474] (-1297.425) (-1294.596) (-1305.542) * (-1295.591) [-1302.251] (-1306.590) (-1297.656) -- 0:01:23
      516000 -- [-1306.353] (-1302.797) (-1297.039) (-1297.794) * [-1300.314] (-1300.527) (-1304.080) (-1295.916) -- 0:01:23
      516500 -- (-1301.249) [-1295.914] (-1295.216) (-1298.497) * (-1296.664) (-1302.520) (-1295.809) [-1293.955] -- 0:01:23
      517000 -- (-1299.001) [-1295.072] (-1294.094) (-1299.889) * [-1296.767] (-1300.911) (-1302.524) (-1302.183) -- 0:01:23
      517500 -- [-1298.980] (-1292.956) (-1299.610) (-1301.743) * (-1297.046) (-1299.160) (-1292.198) [-1301.709] -- 0:01:23
      518000 -- (-1299.194) (-1300.332) (-1304.326) [-1296.509] * (-1298.904) (-1306.169) (-1298.965) [-1303.939] -- 0:01:23
      518500 -- [-1297.528] (-1297.214) (-1299.466) (-1298.906) * (-1299.902) [-1301.782] (-1299.540) (-1306.143) -- 0:01:23
      519000 -- (-1293.628) [-1299.011] (-1301.621) (-1296.372) * (-1294.173) (-1297.995) [-1300.410] (-1298.860) -- 0:01:23
      519500 -- (-1295.911) [-1304.101] (-1305.282) (-1295.634) * (-1296.829) (-1296.092) (-1306.879) [-1297.727] -- 0:01:23
      520000 -- (-1299.746) (-1306.721) (-1308.826) [-1295.045] * [-1295.866] (-1298.685) (-1296.352) (-1301.428) -- 0:01:23

      Average standard deviation of split frequencies: 0.001358

      520500 -- (-1305.883) (-1305.785) (-1309.604) [-1297.857] * [-1298.355] (-1296.328) (-1302.174) (-1295.451) -- 0:01:22
      521000 -- (-1300.995) (-1300.671) (-1301.572) [-1294.594] * (-1306.380) [-1301.313] (-1297.030) (-1294.695) -- 0:01:22
      521500 -- (-1303.818) (-1305.752) [-1297.864] (-1307.986) * (-1300.026) [-1299.883] (-1309.387) (-1294.948) -- 0:01:22
      522000 -- (-1296.400) (-1301.943) [-1297.676] (-1296.409) * (-1300.386) (-1300.064) (-1301.683) [-1301.327] -- 0:01:22
      522500 -- (-1299.354) [-1300.774] (-1307.127) (-1291.358) * [-1300.204] (-1299.048) (-1298.873) (-1297.109) -- 0:01:22
      523000 -- (-1296.192) (-1304.517) (-1301.071) [-1296.297] * (-1303.898) [-1294.669] (-1303.390) (-1296.624) -- 0:01:22
      523500 -- (-1302.255) (-1299.152) [-1300.764] (-1298.471) * (-1297.160) [-1306.466] (-1296.862) (-1295.286) -- 0:01:22
      524000 -- (-1302.511) (-1299.370) [-1294.087] (-1303.385) * [-1298.696] (-1306.352) (-1303.812) (-1296.541) -- 0:01:22
      524500 -- (-1300.000) (-1300.287) (-1294.682) [-1298.457] * (-1302.837) (-1302.234) (-1299.865) [-1296.673] -- 0:01:22
      525000 -- [-1295.185] (-1300.534) (-1298.947) (-1300.492) * (-1300.065) [-1305.692] (-1309.642) (-1298.814) -- 0:01:22

      Average standard deviation of split frequencies: 0.001344

      525500 -- (-1297.856) (-1297.906) (-1294.951) [-1299.073] * [-1304.338] (-1303.784) (-1300.474) (-1303.824) -- 0:01:22
      526000 -- (-1298.661) (-1299.217) [-1298.277] (-1297.658) * (-1301.136) [-1297.438] (-1301.059) (-1299.633) -- 0:01:22
      526500 -- (-1296.064) (-1303.080) [-1295.074] (-1301.121) * (-1298.627) [-1296.612] (-1306.452) (-1293.308) -- 0:01:21
      527000 -- [-1296.515] (-1306.680) (-1298.314) (-1297.503) * [-1295.835] (-1301.846) (-1301.939) (-1298.603) -- 0:01:21
      527500 -- [-1299.614] (-1304.841) (-1297.173) (-1300.313) * (-1297.506) (-1304.663) (-1294.978) [-1295.111] -- 0:01:21
      528000 -- [-1295.020] (-1296.743) (-1295.883) (-1301.890) * (-1299.100) (-1301.899) (-1301.386) [-1294.343] -- 0:01:21
      528500 -- [-1295.134] (-1294.366) (-1296.556) (-1297.210) * (-1294.450) (-1300.222) [-1296.564] (-1301.125) -- 0:01:21
      529000 -- (-1299.306) (-1296.787) (-1306.681) [-1294.381] * (-1297.008) (-1297.113) [-1292.834] (-1302.397) -- 0:01:21
      529500 -- (-1297.090) [-1297.806] (-1300.942) (-1298.453) * [-1295.363] (-1306.137) (-1296.335) (-1296.874) -- 0:01:21
      530000 -- (-1300.027) (-1299.872) (-1301.273) [-1298.700] * (-1304.627) (-1304.486) (-1296.897) [-1296.543] -- 0:01:21

      Average standard deviation of split frequencies: 0.001332

      530500 -- (-1298.909) (-1300.727) (-1302.403) [-1293.419] * (-1295.883) (-1298.947) (-1291.929) [-1299.254] -- 0:01:21
      531000 -- [-1300.479] (-1301.633) (-1300.602) (-1301.218) * (-1296.445) (-1300.930) (-1303.948) [-1294.911] -- 0:01:21
      531500 -- [-1294.122] (-1297.799) (-1293.969) (-1304.638) * [-1298.347] (-1302.383) (-1297.972) (-1298.434) -- 0:01:21
      532000 -- (-1296.686) (-1298.586) (-1299.110) [-1300.587] * (-1301.097) (-1303.721) (-1292.391) [-1298.141] -- 0:01:20
      532500 -- (-1297.093) [-1295.437] (-1298.834) (-1299.000) * (-1296.758) (-1304.708) [-1294.823] (-1295.235) -- 0:01:20
      533000 -- (-1301.224) (-1304.078) (-1296.326) [-1298.182] * (-1302.564) (-1297.420) (-1300.599) [-1295.434] -- 0:01:20
      533500 -- [-1299.155] (-1301.666) (-1302.644) (-1301.843) * (-1301.955) (-1296.267) [-1299.811] (-1296.810) -- 0:01:20
      534000 -- [-1295.545] (-1298.947) (-1305.966) (-1303.691) * (-1296.292) [-1292.552] (-1302.069) (-1293.494) -- 0:01:20
      534500 -- [-1294.824] (-1303.521) (-1308.605) (-1299.372) * (-1307.118) (-1298.602) (-1297.675) [-1300.416] -- 0:01:20
      535000 -- (-1294.780) (-1301.537) (-1298.179) [-1295.594] * [-1307.669] (-1299.272) (-1294.407) (-1299.995) -- 0:01:20

      Average standard deviation of split frequencies: 0.001319

      535500 -- (-1306.538) (-1300.415) (-1299.621) [-1300.989] * (-1309.280) [-1298.845] (-1299.071) (-1302.823) -- 0:01:20
      536000 -- (-1299.542) (-1304.306) [-1300.056] (-1296.731) * (-1302.314) [-1301.944] (-1299.534) (-1299.573) -- 0:01:20
      536500 -- (-1295.892) [-1300.599] (-1296.728) (-1302.108) * (-1299.469) (-1309.318) [-1294.969] (-1301.829) -- 0:01:20
      537000 -- (-1298.805) (-1311.909) [-1301.005] (-1300.684) * (-1302.624) (-1299.621) [-1300.897] (-1298.366) -- 0:01:20
      537500 -- (-1299.675) [-1303.893] (-1300.339) (-1300.986) * (-1299.847) (-1303.017) (-1300.682) [-1295.487] -- 0:01:20
      538000 -- [-1306.105] (-1298.779) (-1299.875) (-1298.271) * (-1296.142) (-1304.642) (-1295.756) [-1296.099] -- 0:01:19
      538500 -- (-1305.353) (-1299.065) [-1292.927] (-1296.934) * (-1302.279) [-1300.690] (-1299.594) (-1293.873) -- 0:01:19
      539000 -- (-1303.371) (-1295.562) (-1300.254) [-1296.587] * (-1295.503) (-1303.794) (-1295.144) [-1295.725] -- 0:01:19
      539500 -- (-1303.125) (-1301.566) [-1297.470] (-1296.726) * (-1296.227) (-1296.961) [-1294.902] (-1301.246) -- 0:01:19
      540000 -- [-1298.726] (-1299.025) (-1296.461) (-1294.702) * (-1299.428) [-1297.344] (-1300.807) (-1306.887) -- 0:01:19

      Average standard deviation of split frequencies: 0.001308

      540500 -- (-1300.386) (-1304.515) (-1299.799) [-1293.359] * [-1299.479] (-1298.479) (-1294.902) (-1301.724) -- 0:01:19
      541000 -- (-1296.879) (-1302.432) [-1298.712] (-1296.348) * [-1295.041] (-1298.610) (-1303.840) (-1295.473) -- 0:01:19
      541500 -- [-1296.791] (-1296.693) (-1295.622) (-1297.316) * [-1300.252] (-1299.551) (-1305.950) (-1301.389) -- 0:01:19
      542000 -- (-1308.842) [-1297.220] (-1301.722) (-1295.875) * [-1302.591] (-1302.595) (-1308.421) (-1303.342) -- 0:01:19
      542500 -- (-1301.131) (-1309.090) (-1299.697) [-1295.922] * (-1299.582) (-1299.762) (-1309.391) [-1294.182] -- 0:01:19
      543000 -- (-1300.117) (-1299.851) (-1300.165) [-1295.427] * (-1298.371) (-1310.797) [-1307.148] (-1299.838) -- 0:01:19
      543500 -- (-1301.737) [-1300.017] (-1293.780) (-1297.559) * [-1292.528] (-1299.266) (-1309.091) (-1298.406) -- 0:01:18
      544000 -- (-1296.989) [-1297.013] (-1295.753) (-1298.480) * [-1300.344] (-1298.299) (-1294.211) (-1301.964) -- 0:01:18
      544500 -- (-1299.277) (-1302.038) [-1300.396] (-1298.188) * [-1307.004] (-1300.924) (-1297.215) (-1294.579) -- 0:01:18
      545000 -- (-1302.966) [-1304.760] (-1301.704) (-1299.678) * [-1302.623] (-1297.716) (-1300.458) (-1294.833) -- 0:01:18

      Average standard deviation of split frequencies: 0.001295

      545500 -- [-1296.948] (-1300.076) (-1301.763) (-1299.252) * (-1304.625) (-1294.569) [-1294.793] (-1303.715) -- 0:01:18
      546000 -- [-1298.698] (-1302.888) (-1293.905) (-1298.422) * [-1300.573] (-1293.584) (-1295.124) (-1303.667) -- 0:01:18
      546500 -- (-1299.377) (-1296.939) (-1300.637) [-1298.488] * [-1300.731] (-1295.444) (-1294.974) (-1299.237) -- 0:01:18
      547000 -- [-1297.179] (-1297.400) (-1305.222) (-1295.004) * [-1297.022] (-1303.214) (-1294.737) (-1298.236) -- 0:01:18
      547500 -- (-1298.842) (-1298.140) [-1300.339] (-1296.424) * (-1299.819) (-1307.171) (-1297.760) [-1298.258] -- 0:01:18
      548000 -- [-1297.230] (-1297.334) (-1299.123) (-1293.723) * [-1297.441] (-1306.321) (-1299.026) (-1294.417) -- 0:01:18
      548500 -- [-1301.152] (-1296.991) (-1300.057) (-1293.846) * [-1293.576] (-1303.325) (-1297.048) (-1300.191) -- 0:01:18
      549000 -- (-1307.860) (-1299.047) (-1304.698) [-1294.769] * (-1299.020) (-1302.112) [-1300.638] (-1299.363) -- 0:01:18
      549500 -- (-1300.294) [-1297.739] (-1302.479) (-1294.266) * (-1297.324) (-1301.377) [-1296.288] (-1304.085) -- 0:01:17
      550000 -- (-1300.166) [-1302.579] (-1299.378) (-1296.106) * [-1294.255] (-1300.285) (-1299.448) (-1299.149) -- 0:01:17

      Average standard deviation of split frequencies: 0.000856

      550500 -- (-1308.287) (-1301.101) (-1299.166) [-1294.098] * (-1301.804) (-1296.715) (-1299.821) [-1299.440] -- 0:01:17
      551000 -- [-1303.927] (-1296.539) (-1300.753) (-1295.125) * (-1307.436) (-1295.669) [-1297.639] (-1303.215) -- 0:01:17
      551500 -- (-1301.998) (-1298.107) (-1310.711) [-1296.578] * (-1296.689) (-1296.943) [-1295.732] (-1307.164) -- 0:01:17
      552000 -- (-1295.382) [-1301.842] (-1308.682) (-1298.485) * (-1301.924) [-1293.010] (-1294.616) (-1297.144) -- 0:01:17
      552500 -- (-1300.814) (-1301.678) (-1297.040) [-1295.817] * (-1301.949) (-1299.122) [-1297.783] (-1293.558) -- 0:01:17
      553000 -- (-1298.957) (-1299.069) [-1295.701] (-1298.443) * (-1299.114) [-1296.794] (-1299.098) (-1297.025) -- 0:01:17
      553500 -- (-1296.906) [-1296.440] (-1295.563) (-1296.445) * (-1302.841) (-1300.351) (-1296.611) [-1296.167] -- 0:01:17
      554000 -- (-1299.143) (-1294.099) (-1296.538) [-1303.269] * (-1293.537) (-1297.170) (-1296.645) [-1297.398] -- 0:01:17
      554500 -- [-1300.267] (-1298.289) (-1298.242) (-1291.762) * (-1297.166) [-1301.257] (-1298.585) (-1296.813) -- 0:01:17
      555000 -- (-1298.072) [-1297.478] (-1305.654) (-1299.515) * (-1293.672) (-1298.334) [-1295.328] (-1301.430) -- 0:01:16

      Average standard deviation of split frequencies: 0.000848

      555500 -- (-1305.924) [-1297.635] (-1306.971) (-1300.914) * [-1299.701] (-1298.402) (-1295.749) (-1303.845) -- 0:01:16
      556000 -- [-1307.659] (-1297.484) (-1299.088) (-1294.441) * (-1298.202) [-1301.351] (-1299.385) (-1304.575) -- 0:01:16
      556500 -- (-1311.579) (-1299.947) (-1301.043) [-1299.613] * (-1301.714) [-1297.961] (-1296.695) (-1302.458) -- 0:01:16
      557000 -- (-1297.680) (-1297.115) (-1299.788) [-1292.193] * (-1304.342) (-1298.281) [-1295.926] (-1304.563) -- 0:01:16
      557500 -- (-1299.985) (-1298.627) [-1302.081] (-1296.813) * (-1301.181) (-1295.933) (-1297.834) [-1310.310] -- 0:01:16
      558000 -- [-1302.845] (-1299.667) (-1293.187) (-1293.976) * (-1302.162) [-1300.961] (-1298.030) (-1304.796) -- 0:01:16
      558500 -- [-1301.069] (-1300.024) (-1299.616) (-1303.133) * (-1297.768) (-1296.615) [-1295.523] (-1301.513) -- 0:01:16
      559000 -- [-1304.721] (-1294.924) (-1295.364) (-1298.684) * [-1296.335] (-1295.187) (-1295.124) (-1292.888) -- 0:01:16
      559500 -- (-1296.803) [-1296.748] (-1296.484) (-1299.035) * (-1296.328) (-1299.049) (-1292.915) [-1295.652] -- 0:01:16
      560000 -- [-1302.241] (-1298.889) (-1303.213) (-1300.078) * (-1298.132) (-1297.489) (-1295.221) [-1294.337] -- 0:01:16

      Average standard deviation of split frequencies: 0.000841

      560500 -- (-1299.986) [-1296.835] (-1300.980) (-1297.593) * (-1295.760) (-1296.293) (-1299.441) [-1297.468] -- 0:01:16
      561000 -- [-1296.698] (-1293.130) (-1296.400) (-1301.302) * (-1301.789) [-1297.251] (-1300.039) (-1297.878) -- 0:01:15
      561500 -- (-1296.170) [-1298.569] (-1293.486) (-1298.454) * (-1300.554) [-1299.048] (-1297.390) (-1299.081) -- 0:01:15
      562000 -- (-1299.441) (-1297.643) [-1296.270] (-1300.068) * (-1305.093) (-1302.979) [-1301.700] (-1299.125) -- 0:01:15
      562500 -- (-1300.886) [-1296.843] (-1294.789) (-1295.874) * (-1299.067) [-1296.590] (-1294.191) (-1295.637) -- 0:01:15
      563000 -- (-1296.286) [-1300.836] (-1299.917) (-1301.659) * (-1294.134) (-1301.600) [-1297.086] (-1293.285) -- 0:01:15
      563500 -- (-1296.212) (-1301.680) (-1301.472) [-1293.708] * (-1303.088) [-1300.737] (-1308.276) (-1301.565) -- 0:01:15
      564000 -- (-1298.356) (-1301.889) [-1299.702] (-1299.362) * (-1299.564) [-1297.101] (-1304.072) (-1298.376) -- 0:01:15
      564500 -- (-1298.070) (-1300.773) (-1299.686) [-1294.984] * (-1300.081) (-1299.071) (-1299.232) [-1307.275] -- 0:01:15
      565000 -- [-1297.030] (-1293.517) (-1308.397) (-1301.288) * (-1303.590) [-1298.202] (-1297.404) (-1295.027) -- 0:01:15

      Average standard deviation of split frequencies: 0.000833

      565500 -- (-1298.562) (-1299.377) (-1303.705) [-1299.367] * (-1299.051) (-1293.254) (-1301.720) [-1298.026] -- 0:01:15
      566000 -- (-1299.211) [-1295.282] (-1307.130) (-1296.359) * [-1302.847] (-1294.316) (-1293.564) (-1299.854) -- 0:01:15
      566500 -- (-1298.203) [-1296.872] (-1305.134) (-1294.276) * (-1304.699) (-1300.695) (-1295.442) [-1297.277] -- 0:01:14
      567000 -- [-1296.993] (-1295.200) (-1304.892) (-1304.906) * [-1295.957] (-1300.891) (-1294.866) (-1301.566) -- 0:01:14
      567500 -- (-1296.078) (-1295.844) (-1297.667) [-1295.691] * (-1299.598) (-1296.125) (-1298.795) [-1298.475] -- 0:01:14
      568000 -- (-1300.726) (-1296.945) [-1298.045] (-1296.653) * (-1299.420) (-1300.715) [-1298.849] (-1303.031) -- 0:01:14
      568500 -- [-1298.446] (-1295.403) (-1299.748) (-1297.654) * [-1302.628] (-1296.154) (-1299.348) (-1298.313) -- 0:01:14
      569000 -- [-1293.644] (-1295.904) (-1303.508) (-1301.670) * [-1296.167] (-1297.100) (-1297.161) (-1298.635) -- 0:01:14
      569500 -- (-1299.766) [-1298.409] (-1306.650) (-1298.416) * (-1300.698) [-1300.486] (-1303.402) (-1299.256) -- 0:01:14
      570000 -- [-1294.195] (-1297.591) (-1299.764) (-1294.497) * (-1299.065) (-1296.318) (-1302.576) [-1297.994] -- 0:01:14

      Average standard deviation of split frequencies: 0.000826

      570500 -- (-1303.301) (-1292.861) [-1298.636] (-1302.922) * (-1295.983) [-1299.886] (-1299.701) (-1298.113) -- 0:01:14
      571000 -- (-1298.103) (-1301.323) [-1299.488] (-1298.146) * (-1299.781) [-1297.811] (-1297.088) (-1299.336) -- 0:01:14
      571500 -- (-1302.069) (-1299.191) (-1296.166) [-1298.502] * (-1297.240) (-1298.980) [-1295.736] (-1301.195) -- 0:01:14
      572000 -- [-1301.466] (-1296.537) (-1294.136) (-1298.813) * [-1297.249] (-1299.832) (-1302.654) (-1295.361) -- 0:01:14
      572500 -- [-1298.394] (-1302.279) (-1295.084) (-1297.521) * (-1300.095) (-1307.969) (-1301.154) [-1304.005] -- 0:01:13
      573000 -- [-1298.938] (-1302.181) (-1298.314) (-1294.673) * (-1297.247) (-1299.580) [-1296.626] (-1294.805) -- 0:01:13
      573500 -- (-1298.563) [-1298.737] (-1301.655) (-1300.985) * [-1296.906] (-1300.797) (-1296.561) (-1298.854) -- 0:01:13
      574000 -- (-1298.504) (-1296.950) (-1299.344) [-1298.486] * (-1294.565) (-1294.831) [-1299.532] (-1302.571) -- 0:01:13
      574500 -- (-1303.589) (-1300.104) (-1303.947) [-1299.741] * (-1297.003) [-1297.764] (-1304.866) (-1300.578) -- 0:01:13
      575000 -- [-1295.222] (-1294.088) (-1311.049) (-1301.528) * [-1297.755] (-1296.144) (-1306.360) (-1298.105) -- 0:01:13

      Average standard deviation of split frequencies: 0.000409

      575500 -- (-1302.873) [-1298.106] (-1300.807) (-1295.546) * (-1297.310) (-1304.494) [-1299.321] (-1294.786) -- 0:01:13
      576000 -- (-1293.805) (-1295.953) (-1307.595) [-1299.474] * (-1308.213) [-1293.100] (-1299.574) (-1303.444) -- 0:01:13
      576500 -- (-1295.099) [-1300.248] (-1307.532) (-1299.434) * [-1300.341] (-1298.181) (-1296.717) (-1302.179) -- 0:01:13
      577000 -- (-1302.020) (-1301.276) [-1302.733] (-1299.464) * (-1301.020) (-1299.299) (-1300.305) [-1293.859] -- 0:01:13
      577500 -- (-1295.167) (-1300.923) [-1296.790] (-1298.241) * (-1298.371) (-1301.433) [-1300.735] (-1292.904) -- 0:01:13
      578000 -- (-1302.892) (-1298.305) [-1303.308] (-1300.985) * (-1297.179) (-1297.886) [-1296.895] (-1294.634) -- 0:01:13
      578500 -- [-1294.229] (-1294.739) (-1302.654) (-1300.867) * [-1299.241] (-1297.400) (-1295.577) (-1296.527) -- 0:01:12
      579000 -- (-1305.803) [-1292.663] (-1301.048) (-1298.077) * (-1299.378) (-1299.592) [-1298.044] (-1293.760) -- 0:01:12
      579500 -- [-1293.567] (-1296.393) (-1296.898) (-1302.245) * (-1298.651) (-1294.878) [-1299.457] (-1292.424) -- 0:01:12
      580000 -- [-1295.756] (-1295.151) (-1300.929) (-1297.415) * (-1306.684) [-1295.713] (-1304.657) (-1302.651) -- 0:01:12

      Average standard deviation of split frequencies: 0.000406

      580500 -- (-1293.651) (-1298.495) (-1295.412) [-1303.021] * (-1303.093) (-1297.320) [-1304.417] (-1297.016) -- 0:01:12
      581000 -- (-1300.790) (-1298.114) (-1296.880) [-1303.088] * [-1300.522] (-1298.339) (-1303.610) (-1299.401) -- 0:01:12
      581500 -- (-1302.270) (-1296.339) (-1294.002) [-1296.664] * [-1301.301] (-1300.566) (-1308.595) (-1299.425) -- 0:01:12
      582000 -- [-1302.069] (-1303.035) (-1298.107) (-1300.861) * [-1302.828] (-1297.612) (-1301.146) (-1299.490) -- 0:01:12
      582500 -- (-1299.819) (-1302.776) (-1301.360) [-1298.995] * (-1301.653) [-1296.648] (-1294.658) (-1297.184) -- 0:01:12
      583000 -- [-1293.150] (-1299.023) (-1293.086) (-1296.077) * [-1302.435] (-1298.387) (-1296.359) (-1309.909) -- 0:01:12
      583500 -- (-1300.049) (-1295.645) [-1299.923] (-1299.920) * (-1303.641) (-1296.885) [-1300.471] (-1298.091) -- 0:01:12
      584000 -- (-1300.410) (-1295.399) (-1301.256) [-1297.002] * [-1295.916] (-1296.944) (-1296.777) (-1301.896) -- 0:01:11
      584500 -- (-1297.621) (-1303.616) [-1295.075] (-1296.653) * (-1299.128) [-1295.989] (-1296.396) (-1299.992) -- 0:01:11
      585000 -- (-1299.144) (-1296.094) (-1297.950) [-1295.088] * (-1296.441) (-1297.442) (-1303.661) [-1301.937] -- 0:01:11

      Average standard deviation of split frequencies: 0.000804

      585500 -- (-1295.999) (-1299.062) (-1297.593) [-1295.557] * (-1297.228) [-1296.889] (-1304.957) (-1304.881) -- 0:01:11
      586000 -- [-1300.415] (-1293.258) (-1293.793) (-1296.150) * [-1300.465] (-1297.403) (-1300.374) (-1301.002) -- 0:01:11
      586500 -- (-1298.922) (-1301.025) [-1298.309] (-1298.001) * (-1294.340) [-1295.408] (-1298.273) (-1296.908) -- 0:01:11
      587000 -- (-1298.926) (-1297.566) [-1296.828] (-1301.447) * (-1294.774) [-1297.801] (-1299.827) (-1295.682) -- 0:01:11
      587500 -- [-1298.729] (-1297.608) (-1305.084) (-1300.188) * [-1296.395] (-1304.701) (-1295.970) (-1298.794) -- 0:01:11
      588000 -- (-1299.711) [-1298.804] (-1294.830) (-1294.910) * (-1296.912) (-1303.827) [-1300.416] (-1302.523) -- 0:01:11
      588500 -- (-1295.973) (-1296.908) [-1299.023] (-1294.263) * (-1303.635) [-1294.205] (-1295.946) (-1306.343) -- 0:01:11
      589000 -- (-1300.536) (-1295.300) (-1299.088) [-1298.011] * (-1300.093) (-1298.318) [-1300.160] (-1301.976) -- 0:01:11
      589500 -- (-1305.178) (-1298.208) (-1299.488) [-1301.836] * (-1297.236) (-1295.426) (-1298.646) [-1299.381] -- 0:01:11
      590000 -- [-1296.835] (-1297.783) (-1296.356) (-1305.977) * [-1302.515] (-1301.216) (-1296.006) (-1305.848) -- 0:01:10

      Average standard deviation of split frequencies: 0.000798

      590500 -- [-1297.801] (-1300.534) (-1303.985) (-1296.864) * (-1295.168) (-1296.727) [-1296.829] (-1306.772) -- 0:01:10
      591000 -- (-1294.469) (-1302.711) (-1299.787) [-1298.452] * (-1309.286) (-1302.710) (-1298.790) [-1293.454] -- 0:01:10
      591500 -- (-1299.979) [-1296.065] (-1307.362) (-1301.697) * [-1300.358] (-1302.566) (-1302.328) (-1296.759) -- 0:01:10
      592000 -- [-1296.525] (-1299.431) (-1301.636) (-1303.762) * (-1298.765) (-1305.403) (-1298.712) [-1294.886] -- 0:01:10
      592500 -- (-1303.690) (-1304.270) (-1301.282) [-1290.760] * (-1300.494) (-1301.416) [-1303.139] (-1302.162) -- 0:01:10
      593000 -- (-1303.577) [-1296.229] (-1297.547) (-1298.984) * (-1297.174) (-1302.321) (-1304.029) [-1293.949] -- 0:01:10
      593500 -- (-1302.861) [-1298.828] (-1298.409) (-1299.849) * [-1295.141] (-1304.378) (-1298.826) (-1299.167) -- 0:01:10
      594000 -- [-1290.791] (-1304.132) (-1299.563) (-1295.301) * (-1296.828) (-1301.723) [-1299.742] (-1294.194) -- 0:01:10
      594500 -- (-1294.462) (-1305.986) (-1299.962) [-1293.180] * [-1298.746] (-1295.539) (-1302.989) (-1300.257) -- 0:01:10
      595000 -- (-1298.378) (-1298.459) [-1300.655] (-1296.644) * (-1300.058) (-1298.292) (-1301.304) [-1297.709] -- 0:01:10

      Average standard deviation of split frequencies: 0.000791

      595500 -- [-1297.369] (-1307.045) (-1309.689) (-1302.932) * (-1304.006) (-1299.013) (-1303.444) [-1296.792] -- 0:01:09
      596000 -- (-1303.174) [-1295.370] (-1300.229) (-1296.137) * (-1299.468) [-1299.307] (-1298.959) (-1293.411) -- 0:01:09
      596500 -- (-1301.118) (-1298.135) [-1298.281] (-1303.666) * (-1307.228) (-1294.919) [-1295.525] (-1301.117) -- 0:01:09
      597000 -- [-1295.822] (-1295.825) (-1296.847) (-1293.020) * (-1301.246) [-1291.962] (-1293.974) (-1299.386) -- 0:01:09
      597500 -- (-1303.555) [-1297.042] (-1304.187) (-1297.563) * (-1306.412) (-1296.739) (-1299.254) [-1295.492] -- 0:01:09
      598000 -- (-1299.193) [-1301.072] (-1298.734) (-1296.415) * (-1299.422) [-1297.615] (-1298.874) (-1300.597) -- 0:01:09
      598500 -- [-1297.896] (-1303.420) (-1310.640) (-1297.710) * (-1301.967) [-1304.053] (-1294.416) (-1298.078) -- 0:01:09
      599000 -- (-1305.473) (-1296.912) (-1303.302) [-1296.493] * (-1298.315) (-1309.371) (-1297.961) [-1298.104] -- 0:01:09
      599500 -- (-1301.294) (-1302.924) (-1309.114) [-1295.997] * (-1297.300) (-1300.107) [-1298.757] (-1303.763) -- 0:01:09
      600000 -- (-1300.063) (-1296.412) (-1299.899) [-1296.539] * (-1304.170) [-1297.995] (-1294.342) (-1301.232) -- 0:01:09

      Average standard deviation of split frequencies: 0.000785

      600500 -- (-1304.123) [-1300.629] (-1303.703) (-1294.948) * (-1300.700) (-1297.061) (-1298.933) [-1299.702] -- 0:01:09
      601000 -- (-1303.534) (-1306.866) (-1307.276) [-1299.927] * (-1302.969) (-1298.623) [-1300.498] (-1298.887) -- 0:01:09
      601500 -- (-1299.875) (-1298.459) (-1304.303) [-1296.232] * (-1299.036) (-1305.476) (-1304.743) [-1294.367] -- 0:01:08
      602000 -- (-1301.590) (-1299.501) [-1295.734] (-1299.948) * (-1297.499) [-1295.781] (-1302.319) (-1299.699) -- 0:01:08
      602500 -- [-1305.493] (-1300.373) (-1307.479) (-1305.248) * (-1300.165) [-1301.447] (-1298.796) (-1301.441) -- 0:01:08
      603000 -- [-1293.402] (-1295.875) (-1300.346) (-1297.500) * (-1301.671) [-1292.237] (-1292.119) (-1298.426) -- 0:01:08
      603500 -- (-1301.179) (-1298.088) [-1298.372] (-1304.063) * (-1304.027) [-1299.252] (-1301.715) (-1295.123) -- 0:01:08
      604000 -- [-1300.922] (-1300.120) (-1298.690) (-1300.777) * (-1306.432) (-1299.751) (-1297.456) [-1294.298] -- 0:01:08
      604500 -- [-1299.873] (-1301.447) (-1298.729) (-1299.879) * (-1306.080) (-1298.302) [-1295.742] (-1297.947) -- 0:01:08
      605000 -- [-1297.317] (-1301.844) (-1301.465) (-1302.280) * [-1300.183] (-1302.434) (-1301.719) (-1304.142) -- 0:01:08

      Average standard deviation of split frequencies: 0.000778

      605500 -- (-1300.847) [-1306.685] (-1295.780) (-1304.751) * (-1295.578) [-1294.306] (-1294.847) (-1298.711) -- 0:01:08
      606000 -- (-1295.364) [-1301.276] (-1304.131) (-1302.290) * (-1290.835) [-1298.777] (-1299.145) (-1293.500) -- 0:01:08
      606500 -- (-1299.960) (-1302.496) [-1300.332] (-1298.633) * [-1293.096] (-1302.550) (-1294.723) (-1301.036) -- 0:01:08
      607000 -- [-1295.144] (-1299.454) (-1299.224) (-1302.060) * [-1296.761] (-1298.015) (-1299.959) (-1301.495) -- 0:01:07
      607500 -- (-1295.847) (-1302.392) [-1303.781] (-1299.275) * [-1295.646] (-1298.992) (-1296.965) (-1302.471) -- 0:01:07
      608000 -- [-1297.205] (-1297.851) (-1300.402) (-1294.536) * [-1293.325] (-1297.614) (-1301.577) (-1303.139) -- 0:01:07
      608500 -- (-1304.135) (-1300.138) [-1293.532] (-1302.603) * [-1293.807] (-1295.272) (-1301.273) (-1304.280) -- 0:01:07
      609000 -- (-1301.684) (-1299.892) (-1299.978) [-1296.197] * (-1299.600) [-1294.679] (-1304.594) (-1302.885) -- 0:01:07
      609500 -- (-1297.548) [-1303.154] (-1296.477) (-1300.608) * (-1297.113) (-1297.700) (-1302.307) [-1295.483] -- 0:01:07
      610000 -- (-1300.097) (-1297.930) (-1302.764) [-1299.034] * (-1306.822) [-1296.950] (-1307.066) (-1295.917) -- 0:01:07

      Average standard deviation of split frequencies: 0.000772

      610500 -- [-1298.996] (-1304.262) (-1299.658) (-1296.338) * (-1300.827) (-1299.469) [-1300.358] (-1299.402) -- 0:01:07
      611000 -- (-1293.030) (-1301.493) (-1300.368) [-1295.907] * (-1298.431) (-1295.112) (-1300.584) [-1298.535] -- 0:01:07
      611500 -- (-1295.809) (-1302.529) (-1308.359) [-1298.724] * (-1295.887) (-1301.894) (-1304.653) [-1296.615] -- 0:01:07
      612000 -- (-1297.216) (-1303.607) (-1293.787) [-1294.603] * (-1295.651) (-1296.290) (-1301.833) [-1297.706] -- 0:01:07
      612500 -- (-1297.828) (-1300.278) (-1301.260) [-1301.965] * (-1295.625) (-1302.415) [-1294.861] (-1298.270) -- 0:01:07
      613000 -- (-1297.611) (-1304.917) [-1294.674] (-1295.694) * [-1294.976] (-1295.963) (-1302.483) (-1300.582) -- 0:01:06
      613500 -- [-1299.910] (-1298.654) (-1299.405) (-1302.007) * [-1293.193] (-1297.484) (-1306.931) (-1294.488) -- 0:01:06
      614000 -- (-1296.994) (-1299.825) [-1298.725] (-1295.653) * (-1297.886) (-1295.894) [-1298.384] (-1303.918) -- 0:01:06
      614500 -- (-1301.386) (-1308.385) (-1296.087) [-1292.004] * (-1293.695) [-1292.731] (-1298.853) (-1299.958) -- 0:01:06
      615000 -- [-1305.371] (-1300.552) (-1310.780) (-1298.578) * [-1296.984] (-1299.218) (-1303.493) (-1293.662) -- 0:01:06

      Average standard deviation of split frequencies: 0.000765

      615500 -- (-1301.487) (-1301.014) [-1298.575] (-1301.419) * (-1298.828) (-1300.548) [-1294.020] (-1298.376) -- 0:01:06
      616000 -- (-1298.584) [-1297.989] (-1301.081) (-1293.704) * (-1302.332) (-1305.943) [-1293.026] (-1298.871) -- 0:01:06
      616500 -- (-1305.651) (-1300.377) (-1297.582) [-1292.463] * (-1297.452) (-1294.540) [-1293.244] (-1303.095) -- 0:01:06
      617000 -- [-1301.014] (-1301.107) (-1299.324) (-1297.774) * (-1301.914) (-1295.533) [-1292.194] (-1302.856) -- 0:01:06
      617500 -- (-1297.737) [-1299.825] (-1301.066) (-1299.964) * (-1300.093) (-1296.064) (-1297.176) [-1297.320] -- 0:01:06
      618000 -- (-1302.376) (-1295.962) [-1299.676] (-1295.668) * (-1295.208) [-1295.704] (-1300.722) (-1296.782) -- 0:01:06
      618500 -- (-1300.330) (-1299.191) (-1299.161) [-1304.811] * (-1294.069) (-1294.767) [-1295.739] (-1303.623) -- 0:01:05
      619000 -- [-1308.286] (-1298.222) (-1303.757) (-1294.971) * (-1298.797) (-1296.290) [-1300.171] (-1307.866) -- 0:01:05
      619500 -- (-1298.830) (-1295.616) (-1306.473) [-1301.698] * (-1294.578) (-1298.221) [-1298.580] (-1300.140) -- 0:01:05
      620000 -- (-1299.848) [-1298.757] (-1296.627) (-1296.241) * (-1298.306) [-1296.140] (-1299.828) (-1299.705) -- 0:01:05

      Average standard deviation of split frequencies: 0.000760

      620500 -- [-1305.651] (-1298.293) (-1300.980) (-1296.349) * [-1306.975] (-1298.866) (-1299.083) (-1298.728) -- 0:01:05
      621000 -- [-1299.627] (-1301.561) (-1300.694) (-1294.233) * (-1299.638) (-1293.454) [-1293.636] (-1299.020) -- 0:01:05
      621500 -- [-1294.913] (-1296.947) (-1301.507) (-1296.345) * (-1297.884) [-1297.307] (-1297.535) (-1302.727) -- 0:01:05
      622000 -- (-1301.021) (-1299.553) (-1300.552) [-1299.590] * (-1299.357) (-1303.012) (-1300.481) [-1299.614] -- 0:01:05
      622500 -- (-1299.965) (-1302.361) (-1298.622) [-1297.470] * (-1297.118) (-1306.624) (-1293.636) [-1296.142] -- 0:01:05
      623000 -- (-1299.877) (-1298.923) (-1298.489) [-1298.999] * (-1297.473) (-1295.333) (-1298.264) [-1300.494] -- 0:01:05
      623500 -- (-1301.449) (-1296.346) [-1296.167] (-1303.928) * [-1296.437] (-1304.270) (-1295.933) (-1299.231) -- 0:01:05
      624000 -- (-1302.286) [-1298.585] (-1298.529) (-1307.368) * (-1297.241) (-1299.345) [-1296.121] (-1299.110) -- 0:01:05
      624500 -- (-1308.822) [-1297.761] (-1298.063) (-1308.983) * (-1302.203) [-1296.961] (-1303.822) (-1308.070) -- 0:01:04
      625000 -- (-1294.679) [-1295.641] (-1292.941) (-1299.629) * (-1302.069) (-1302.519) [-1296.810] (-1295.406) -- 0:01:04

      Average standard deviation of split frequencies: 0.000753

      625500 -- (-1298.509) (-1297.741) [-1295.013] (-1302.258) * [-1301.208] (-1298.875) (-1298.163) (-1298.911) -- 0:01:04
      626000 -- (-1297.480) (-1299.659) (-1293.840) [-1301.266] * (-1296.580) [-1296.684] (-1294.513) (-1296.609) -- 0:01:04
      626500 -- (-1297.735) [-1296.173] (-1299.304) (-1302.006) * [-1296.597] (-1300.881) (-1299.514) (-1306.791) -- 0:01:04
      627000 -- (-1295.791) (-1296.052) [-1298.335] (-1304.557) * (-1299.088) (-1300.105) (-1299.294) [-1296.370] -- 0:01:04
      627500 -- (-1301.036) (-1300.095) [-1298.356] (-1300.491) * (-1296.982) (-1301.706) (-1302.069) [-1294.688] -- 0:01:04
      628000 -- (-1300.222) (-1295.750) [-1292.990] (-1307.715) * (-1301.527) (-1297.230) (-1304.206) [-1298.487] -- 0:01:04
      628500 -- [-1301.824] (-1301.215) (-1298.974) (-1297.186) * (-1300.012) [-1297.100] (-1302.232) (-1298.828) -- 0:01:04
      629000 -- (-1298.720) (-1301.150) (-1296.498) [-1296.929] * (-1303.415) (-1302.876) (-1306.583) [-1292.712] -- 0:01:04
      629500 -- [-1299.462] (-1300.660) (-1301.622) (-1298.218) * (-1305.742) (-1302.056) (-1299.853) [-1296.967] -- 0:01:04
      630000 -- (-1296.570) [-1297.912] (-1295.040) (-1298.791) * (-1302.873) [-1296.634] (-1308.170) (-1296.076) -- 0:01:04

      Average standard deviation of split frequencies: 0.000747

      630500 -- [-1296.136] (-1301.666) (-1294.743) (-1298.048) * (-1298.661) (-1300.575) (-1302.205) [-1298.946] -- 0:01:03
      631000 -- [-1298.855] (-1294.764) (-1299.025) (-1298.741) * (-1309.125) (-1295.028) (-1306.968) [-1296.224] -- 0:01:03
      631500 -- (-1299.700) (-1300.285) (-1306.042) [-1295.504] * (-1299.537) (-1300.975) [-1298.375] (-1302.642) -- 0:01:03
      632000 -- (-1303.248) [-1296.822] (-1311.301) (-1297.014) * (-1304.382) [-1302.363] (-1299.926) (-1300.041) -- 0:01:03
      632500 -- (-1300.232) [-1294.145] (-1306.939) (-1297.996) * (-1293.591) (-1302.881) (-1299.680) [-1300.622] -- 0:01:03
      633000 -- (-1296.281) [-1296.908] (-1304.064) (-1295.377) * (-1297.167) (-1308.772) [-1301.416] (-1297.350) -- 0:01:03
      633500 -- (-1300.058) [-1302.420] (-1299.929) (-1295.587) * (-1297.299) (-1305.357) (-1299.092) [-1300.792] -- 0:01:03
      634000 -- (-1300.829) (-1304.002) [-1298.343] (-1302.888) * (-1297.626) (-1297.146) [-1302.755] (-1302.649) -- 0:01:03
      634500 -- (-1300.681) (-1297.388) [-1299.448] (-1297.066) * (-1303.643) (-1299.588) (-1296.433) [-1302.325] -- 0:01:03
      635000 -- (-1296.449) (-1298.012) (-1296.938) [-1297.328] * (-1298.234) [-1296.064] (-1297.059) (-1305.845) -- 0:01:03

      Average standard deviation of split frequencies: 0.000741

      635500 -- (-1296.743) [-1295.636] (-1298.845) (-1306.009) * (-1296.766) [-1297.540] (-1296.071) (-1301.173) -- 0:01:03
      636000 -- (-1302.709) (-1296.736) [-1297.232] (-1297.591) * (-1295.055) [-1295.453] (-1295.652) (-1297.708) -- 0:01:02
      636500 -- [-1303.977] (-1303.365) (-1293.754) (-1298.933) * [-1297.836] (-1298.348) (-1300.307) (-1295.321) -- 0:01:02
      637000 -- (-1295.414) (-1301.023) (-1298.497) [-1295.291] * (-1301.430) (-1308.777) [-1294.588] (-1296.058) -- 0:01:02
      637500 -- [-1299.013] (-1303.096) (-1302.935) (-1301.022) * (-1296.704) (-1306.232) (-1295.165) [-1296.747] -- 0:01:02
      638000 -- (-1295.287) [-1299.426] (-1301.496) (-1299.480) * (-1298.346) (-1295.767) [-1295.694] (-1302.393) -- 0:01:02
      638500 -- (-1297.259) [-1295.883] (-1302.746) (-1301.922) * (-1293.714) (-1302.998) (-1300.344) [-1294.716] -- 0:01:02
      639000 -- [-1311.134] (-1294.804) (-1298.152) (-1301.256) * [-1296.121] (-1298.709) (-1297.967) (-1297.948) -- 0:01:02
      639500 -- (-1302.094) [-1301.249] (-1294.214) (-1304.234) * (-1298.893) (-1298.613) (-1301.660) [-1302.139] -- 0:01:02
      640000 -- (-1316.753) (-1297.582) [-1295.498] (-1294.704) * [-1304.721] (-1300.481) (-1300.531) (-1301.808) -- 0:01:02

      Average standard deviation of split frequencies: 0.000736

      640500 -- (-1303.398) (-1293.304) [-1296.701] (-1303.198) * (-1296.888) (-1298.956) (-1300.256) [-1299.205] -- 0:01:02
      641000 -- (-1292.481) [-1300.103] (-1299.782) (-1299.055) * [-1296.276] (-1297.582) (-1304.319) (-1305.238) -- 0:01:02
      641500 -- [-1293.773] (-1297.883) (-1298.171) (-1301.887) * (-1299.556) (-1299.632) [-1297.181] (-1298.528) -- 0:01:02
      642000 -- [-1294.660] (-1296.742) (-1305.400) (-1299.028) * (-1297.574) [-1294.080] (-1307.281) (-1297.572) -- 0:01:01
      642500 -- (-1298.103) (-1299.591) (-1297.791) [-1296.977] * [-1296.483] (-1298.366) (-1301.422) (-1306.269) -- 0:01:01
      643000 -- [-1298.134] (-1305.708) (-1296.690) (-1302.507) * (-1298.025) [-1296.335] (-1297.053) (-1306.475) -- 0:01:01
      643500 -- [-1298.343] (-1297.230) (-1299.116) (-1301.919) * [-1296.013] (-1297.359) (-1300.367) (-1300.015) -- 0:01:01
      644000 -- (-1294.728) (-1293.414) [-1294.694] (-1297.372) * (-1295.705) [-1298.630] (-1307.439) (-1300.322) -- 0:01:01
      644500 -- (-1302.390) (-1299.515) (-1292.822) [-1302.121] * [-1297.666] (-1303.094) (-1311.044) (-1304.569) -- 0:01:01
      645000 -- (-1300.109) (-1295.028) [-1300.177] (-1302.253) * (-1298.111) (-1298.862) [-1294.277] (-1303.676) -- 0:01:01

      Average standard deviation of split frequencies: 0.000730

      645500 -- (-1295.220) (-1299.019) (-1300.760) [-1296.969] * (-1305.925) (-1299.081) (-1298.727) [-1301.964] -- 0:01:01
      646000 -- [-1297.856] (-1302.162) (-1299.583) (-1299.433) * (-1301.400) (-1302.189) [-1298.282] (-1300.509) -- 0:01:01
      646500 -- (-1295.316) (-1306.341) (-1295.589) [-1295.261] * [-1299.221] (-1302.132) (-1294.269) (-1297.183) -- 0:01:01
      647000 -- (-1306.921) (-1301.611) [-1298.788] (-1293.469) * (-1296.102) [-1302.882] (-1294.322) (-1296.380) -- 0:01:01
      647500 -- (-1306.680) (-1302.150) [-1299.030] (-1298.852) * (-1299.687) (-1300.046) (-1295.549) [-1305.293] -- 0:01:00
      648000 -- (-1301.205) (-1296.686) [-1297.089] (-1298.026) * [-1305.279] (-1301.620) (-1303.020) (-1294.676) -- 0:01:00
      648500 -- (-1293.968) (-1299.094) (-1300.370) [-1298.830] * (-1303.040) (-1301.233) (-1297.070) [-1299.109] -- 0:01:00
      649000 -- (-1292.986) (-1298.660) (-1296.912) [-1296.605] * (-1298.259) [-1296.176] (-1298.595) (-1299.542) -- 0:01:00
      649500 -- (-1295.449) (-1299.923) (-1301.174) [-1298.971] * (-1303.933) (-1303.152) (-1301.351) [-1301.026] -- 0:01:00
      650000 -- [-1296.269] (-1297.473) (-1304.738) (-1306.962) * (-1299.229) (-1299.191) [-1299.128] (-1298.103) -- 0:01:00

      Average standard deviation of split frequencies: 0.000362

      650500 -- [-1301.891] (-1300.805) (-1299.869) (-1302.539) * (-1296.601) [-1297.140] (-1296.956) (-1299.563) -- 0:01:00
      651000 -- (-1299.682) [-1296.425] (-1295.897) (-1305.891) * (-1302.280) (-1295.761) [-1298.055] (-1305.406) -- 0:01:00
      651500 -- (-1295.493) [-1303.091] (-1295.541) (-1301.601) * (-1295.881) (-1301.403) (-1296.097) [-1303.131] -- 0:01:00
      652000 -- (-1300.630) [-1299.214] (-1299.696) (-1295.213) * (-1299.108) (-1310.906) [-1298.016] (-1303.625) -- 0:01:00
      652500 -- (-1305.250) [-1299.608] (-1306.063) (-1294.743) * (-1301.477) (-1307.550) [-1301.104] (-1302.771) -- 0:01:00
      653000 -- [-1299.253] (-1294.312) (-1298.545) (-1300.611) * [-1299.803] (-1308.228) (-1296.757) (-1297.671) -- 0:01:00
      653500 -- (-1298.792) (-1300.582) [-1300.393] (-1299.320) * (-1307.071) (-1305.159) (-1297.452) [-1294.585] -- 0:00:59
      654000 -- (-1302.405) [-1297.728] (-1304.612) (-1300.088) * (-1297.755) (-1302.879) [-1295.656] (-1295.917) -- 0:00:59
      654500 -- [-1301.776] (-1297.927) (-1297.264) (-1297.700) * (-1298.855) (-1298.469) [-1293.520] (-1298.839) -- 0:00:59
      655000 -- (-1299.445) [-1300.341] (-1296.884) (-1301.126) * (-1295.661) [-1296.571] (-1296.625) (-1300.327) -- 0:00:59

      Average standard deviation of split frequencies: 0.000359

      655500 -- (-1301.402) [-1292.502] (-1298.441) (-1299.435) * (-1296.345) [-1300.660] (-1299.108) (-1303.449) -- 0:00:59
      656000 -- [-1301.451] (-1301.825) (-1301.485) (-1297.572) * (-1297.435) [-1295.670] (-1300.840) (-1297.654) -- 0:00:59
      656500 -- (-1296.746) [-1295.619] (-1297.301) (-1295.336) * (-1296.640) [-1292.813] (-1297.982) (-1300.238) -- 0:00:59
      657000 -- (-1299.910) [-1296.164] (-1300.308) (-1296.002) * (-1296.220) (-1293.621) [-1297.061] (-1297.938) -- 0:00:58
      657500 -- (-1295.852) (-1297.404) (-1297.579) [-1296.798] * [-1297.377] (-1297.894) (-1296.678) (-1299.591) -- 0:00:59
      658000 -- (-1297.829) [-1295.815] (-1297.250) (-1299.094) * (-1296.998) (-1299.992) [-1297.268] (-1302.261) -- 0:00:59
      658500 -- (-1296.280) (-1302.054) (-1299.954) [-1301.519] * [-1296.696] (-1298.342) (-1292.729) (-1299.421) -- 0:00:59
      659000 -- (-1302.010) [-1296.694] (-1298.276) (-1294.851) * (-1297.001) [-1295.263] (-1296.583) (-1294.542) -- 0:00:58
      659500 -- (-1298.958) (-1296.926) (-1296.235) [-1296.098] * (-1297.505) (-1306.114) (-1293.812) [-1298.684] -- 0:00:58
      660000 -- (-1298.149) (-1298.769) (-1296.331) [-1295.340] * [-1297.825] (-1306.163) (-1296.332) (-1294.401) -- 0:00:58

      Average standard deviation of split frequencies: 0.000357

      660500 -- (-1297.837) (-1296.721) (-1303.386) [-1296.391] * [-1301.113] (-1314.315) (-1294.953) (-1301.699) -- 0:00:58
      661000 -- (-1296.251) [-1297.013] (-1296.623) (-1299.050) * (-1296.213) [-1303.572] (-1305.480) (-1300.418) -- 0:00:58
      661500 -- (-1297.730) (-1294.972) [-1301.057] (-1299.793) * (-1296.064) (-1308.269) [-1296.248] (-1300.805) -- 0:00:58
      662000 -- (-1303.046) (-1296.064) [-1297.304] (-1296.774) * (-1296.923) (-1296.411) [-1299.014] (-1301.796) -- 0:00:58
      662500 -- (-1305.518) [-1295.798] (-1295.224) (-1299.148) * [-1295.677] (-1297.914) (-1298.154) (-1299.029) -- 0:00:58
      663000 -- [-1303.376] (-1294.907) (-1300.183) (-1300.656) * (-1296.030) [-1298.999] (-1294.482) (-1302.855) -- 0:00:58
      663500 -- (-1306.558) [-1298.190] (-1299.657) (-1299.432) * (-1297.382) (-1297.280) (-1297.795) [-1300.684] -- 0:00:58
      664000 -- (-1309.412) (-1310.652) (-1301.379) [-1297.167] * (-1295.227) [-1302.934] (-1308.901) (-1301.968) -- 0:00:58
      664500 -- (-1300.063) (-1304.148) [-1294.268] (-1295.626) * (-1301.065) (-1300.647) (-1309.720) [-1301.041] -- 0:00:58
      665000 -- [-1301.861] (-1297.330) (-1308.951) (-1299.719) * (-1303.382) [-1300.589] (-1299.728) (-1302.004) -- 0:00:57

      Average standard deviation of split frequencies: 0.000354

      665500 -- (-1297.012) (-1296.552) [-1302.164] (-1294.139) * (-1300.902) [-1296.362] (-1302.265) (-1303.732) -- 0:00:57
      666000 -- (-1319.008) [-1297.685] (-1294.092) (-1297.777) * (-1294.450) (-1304.662) [-1297.408] (-1299.083) -- 0:00:57
      666500 -- (-1303.440) (-1294.463) (-1299.076) [-1301.127] * [-1295.564] (-1302.898) (-1299.437) (-1302.234) -- 0:00:57
      667000 -- (-1301.045) [-1294.585] (-1293.738) (-1312.065) * (-1295.332) (-1301.599) [-1296.531] (-1299.384) -- 0:00:57
      667500 -- (-1299.089) (-1293.574) [-1298.080] (-1302.879) * [-1298.888] (-1308.828) (-1296.032) (-1294.526) -- 0:00:57
      668000 -- (-1302.443) (-1301.244) [-1294.621] (-1297.027) * (-1299.572) (-1300.434) [-1297.134] (-1305.787) -- 0:00:57
      668500 -- (-1302.171) [-1294.543] (-1298.055) (-1304.913) * (-1298.451) [-1302.470] (-1297.605) (-1295.949) -- 0:00:57
      669000 -- [-1298.268] (-1294.809) (-1297.115) (-1299.056) * (-1300.064) (-1305.806) (-1301.164) [-1297.823] -- 0:00:57
      669500 -- [-1302.113] (-1305.889) (-1298.704) (-1295.894) * (-1302.995) (