--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 15:46:39 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/Zip102B-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1295.10         -1303.58
2      -1295.13         -1305.13
--------------------------------------
TOTAL    -1295.11         -1304.63
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.298582    0.003343    0.193652    0.411625    0.291829   1081.21   1161.28    1.000
r(A<->C){all}   0.046062    0.000947    0.000042    0.103495    0.040329    867.35    893.15    1.001
r(A<->G){all}   0.201201    0.002955    0.106221    0.312160    0.195630    689.13    693.33    1.001
r(A<->T){all}   0.128233    0.001402    0.055710    0.198145    0.125198    865.44    891.70    1.000
r(C<->G){all}   0.089470    0.001870    0.012830    0.170552    0.083647    788.54    819.99    1.000
r(C<->T){all}   0.463133    0.005905    0.315422    0.606761    0.461532    692.34    716.96    1.000
r(G<->T){all}   0.071901    0.001053    0.013032    0.136356    0.068597    877.64    925.66    1.000
pi(A){all}      0.291152    0.000302    0.259185    0.326667    0.290983   1237.29   1252.18    1.000
pi(C){all}      0.189732    0.000224    0.160115    0.218664    0.189774   1202.29   1311.43    1.000
pi(G){all}      0.221729    0.000254    0.187932    0.251041    0.221318   1185.53   1225.71    1.000
pi(T){all}      0.297387    0.000308    0.264287    0.331965    0.296991    949.46   1182.02    1.000
alpha{1,2}      0.062604    0.002309    0.000113    0.153492    0.053683   1283.72   1332.45    1.000
alpha{3}        1.809067    0.615516    0.558151    3.388782    1.677103   1278.35   1297.93    1.000
pinvar{all}     0.390935    0.013906    0.143701    0.601833    0.407066   1041.42   1160.25    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1223.323119
Model 2: PositiveSelection	-1223.323119
Model 0: one-ratio	-1223.692769
Model 3: discrete	-1222.999647
Model 7: beta	-1223.046413
Model 8: beta&w>1	-1223.046482


Model 0 vs 1	0.7393000000001848

Model 2 vs 1	0.0

Model 8 vs 7	1.3799999987895717E-4
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESRDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHKH
o
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESRDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHKH
o
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=202 

C1              MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C2              MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C3              MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C4              MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
C5              MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
                ******.***:*.* ***********************************

C1              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C2              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C3              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
C4              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
C5              IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
                *********************************************:****

C1              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
C2              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
C3              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
C4              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
C5              YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
                *********************************************::***

C1              QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
C2              QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
C3              QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
C4              QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
C5              QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
                **:* ******  **:*: *.****:******.*:***********:**:

C1              H-
C2              H-
C3              H-
C4              Ho
C5              Ho
                * 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4098]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4098]--->[4092]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/Zip102B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.272 Mb, Max= 30.515 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
Ho
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
Ho

FORMAT of file /tmp/tmp5923832570551792127aln Not Supported[FATAL:T-COFFEE]
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H-
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESR-DATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
Ho
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESR-DATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
Ho
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:202 S:99 BS:202
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.51 C1	 C2	 98.51
TOP	    1    0	 98.51 C2	 C1	 98.51
BOT	    0    2	 98.51 C1	 C3	 98.51
TOP	    2    0	 98.51 C3	 C1	 98.51
BOT	    0    3	 93.50 C1	 C4	 93.50
TOP	    3    0	 93.50 C4	 C1	 93.50
BOT	    0    4	 94.50 C1	 C5	 94.50
TOP	    4    0	 94.50 C5	 C1	 94.50
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 93.00 C2	 C4	 93.00
TOP	    3    1	 93.00 C4	 C2	 93.00
BOT	    1    4	 94.00 C2	 C5	 94.00
TOP	    4    1	 94.00 C5	 C2	 94.00
BOT	    2    3	 93.00 C3	 C4	 93.00
TOP	    3    2	 93.00 C4	 C3	 93.00
BOT	    2    4	 94.00 C3	 C5	 94.00
TOP	    4    2	 94.00 C5	 C3	 94.00
BOT	    3    4	 95.02 C4	 C5	 95.02
TOP	    4    3	 95.02 C5	 C4	 95.02
AVG	 0	 C1	  *	 96.25
AVG	 1	 C2	  *	 96.38
AVG	 2	 C3	  *	 96.38
AVG	 3	 C4	  *	 93.63
AVG	 4	 C5	  *	 94.38
TOT	 TOT	  *	 95.40
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA
C2              ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
C3              ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
C4              ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA
C5              ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA
                ***********.** ** * ******.****  **** ***** ******

C1              AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG
C2              AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
C3              AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
C4              AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG
C5              AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG
                ************************:***********.** ** *******

C1              ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
C2              ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
C3              ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
C4              ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG
C5              ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
                **********.*****************.************** ******

C1              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
C2              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
C3              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
C4              ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
C5              ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG
                **************.*****************.************** **

C1              ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C2              ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C3              ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
C4              GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA
C5              GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA
                .***** **:**  **** ***********:*******************

C1              GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C2              GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C3              GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
C4              GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG
C5              GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT
                *******:** **.*****.********:******:******** **** 

C1              TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC
C2              TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
C3              TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
C4              TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC
C5              TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC
                ********.*****.***********.** ** ***** ** **.*****

C1              CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C2              CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C3              CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
C4              TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA
C5              CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA
                 ********:********.** ****************************

C1              CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT
C2              CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
C3              CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
C4              CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT
C5              CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT
                **** ****** ************* **.******** :****.******

C1              CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C2              CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C3              CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
C4              CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA
C5              CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA
                ***** .***** .* ************* **    *:*******.****

C1              TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA
C2              TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA
C3              TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA
C4              TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA
C5              CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA
                 :*.:.****.* ********:*** ** ***************** *:*

C1              TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT
C2              TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
C3              TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
C4              TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG
C5              TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG
                **.********** ********:** **.********: ********** 

C1              CAC---
C2              CAC---
C3              CAC---
C4              CAC---
C5              CAC---
                ***   



>C1
ATGATGTTGGTGGACATCTCTCAGCGGAAGAGTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCCGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
ATTAGTGACATTCTTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGGATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTGAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTGCATGTTTTACCAGAGCTTACCCAAGGGGGATTTACGAAAAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TATAAATGGAAGCAATAGTATTCAAGCACTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTACCCCTAATTATAACATTTGGACATAAT
CAC---
>C2
ATGATGTTGGTGGATATCTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
ATTAGTCACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TTTGAATGGAAGTAATAGTATACAAGCATTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
CAC---
>C3
ATGATGTTGGTGGATATTTCTCAGCGGAAGACTAATGTTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTTGGATTGGTTGTGCATGCTGCAGCTG
ATGGAGTTGCATTGGGAGCAGCTGCCACCACTAGCCATCAAGATGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTCGG
ATTAGTGACATTCCTACTGCACGAAAAAGTAGACAGACATCAAATTCGCA
GACACCTAGTCTTATTTTCCCTGTCGGCTCCCCTTATGACTATTTTAACG
TATTTTGGAATCGGACAGGAGCAGAAGGACACGTTAAATTCCGTAAATGC
CACTGGTATAGCTATGCTATTCTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTTTACCAGAGCTTACCCAAGGGGGATTAACGAAGAGCGAT
CAGCATGATTATTGTTTGCTAGAGGAATCTCGAGGTGTTGCTACGAATGA
TTTGAATGGAAGTAATAGTATTCAAGCATTAAAATATAGTGAATTGGTAA
TTCTGATTTGCGGCGCACTGCTTCCCCTAATTATAACATTTGGACATAAT
CAC---
>C4
ATGATGTTGGTAGACATCTGTCAGCGAAAGAGCAATGCTGGAAGTAATAA
AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTACACGCCGCAGCTG
ATGGAGTTGCGTTGGGAGCAGCTGCCACAACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTAGCTATAATGCTTCATAAGGCACCAGCAGCATTTGG
GTTAGTGACTTTTTTACTGCACGAAAAAGTTGACAGACATCAAATTCGCA
GACACCTTGTGTTGTTTTCCCTGTCGGCACCCCTTTTGACTATTTTAACG
TATTTTGGAATCGGCCAGGAGCAGAAAGATACTTTAAACTCCGTAAATGC
TACTGGTATAGCTATGCTGTTTTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTTCATGTTCTACCAGAGCTTACGCAAGGGGGATTGTCGAAGAGCGAT
CAGCACAATTATCATTTGCTAGAGGAATCTCGT---GATGCTACGCATGA
TATAAATGGAGGCAATAGTATACAAGCATTAAAATATAGTGAATTGGTTA
TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACACTTGGACATAAG
CAC---
>C5
ATGATGTTGGTGGACATCTCTCAGCGAAAGAGCAATGTTGGAATTAATAA
AAAAAACAATGCCACACTAACTCTAGGATTGGTTGTGCATGCCGCAGCTG
ATGGAGTTGCGTTGGGAGCAGCTGCCACCACTAGCCATCAAGACGTTGAG
ATAATTGTATTTTTGGCTATAATGCTTCATAAAGCACCAGCAGCATTTGG
GTTAGTGACTTTCCTACTTCACGAAAAAGTTGACAGACATCAAATTCGCA
GACACCTAGTCTTGTTTTCACTGTCGGCTCCCCTTTTGACTATTCTAACT
TATTTTGGAATCGGCCAGGAGCAGAAGGATACGTTAAATTCTGTAAATGC
CACTGGTATTGCTATGCTATTTTCCGCTGGAACATTTTTGTACGTAGCAA
CTGTCCATGTTCTACCAGAGCTTACTCAGGGGGGATTGACGAAGAGCGAT
CAGCATGATTATCATCTGCTAGAGGAATCCCGC---GATGCTACGAATGA
CATATGTGGAGGCAATAGTATACAATCATTAAAATATAGTGAATTGTTTA
TTATGATTTGCGGTGCACTGCTTCCGCTGATTATAACTTTTGGACATAAG
CAC---
>C1
MMLVDISQRKSNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGFTKSD
QHDYCLLEESRGVATNDINGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C2
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C3
MMLVDISQRKTNVGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLMTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYCLLEESRGVATNDLNGSNSIQALKYSELVILICGALLPLIITFGHN
H
>C4
MMLVDICQRKSNAGSNKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLSKSD
QHNYHLLEESRoDATHDINGGNSIQALKYSELVIMICGALLPLIITLGHK
H
>C5
MMLVDISQRKSNVGINKKNNATLTLGLVVHAAADGVALGAAATTSHQDVE
IIVFLAIMLHKAPAAFGLVTFLLHEKVDRHQIRRHLVLFSLSAPLLTILT
YFGIGQEQKDTLNSVNATGIAMLFSAGTFLYVATVHVLPELTQGGLTKSD
QHDYHLLEESRoDATNDICGGNSIQSLKYSELFIMICGALLPLIITFGHK
H


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 606 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481298167
      Setting output file names to "/opt/ADOPS/443/Zip102B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 959757526
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1477237784
      Seed = 2053189238
      Swapseed = 1481298167
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 20 unique site patterns
      Division 2 has 13 unique site patterns
      Division 3 has 44 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1629.573097 -- -25.624409
         Chain 2 -- -1622.947813 -- -25.624409
         Chain 3 -- -1591.347569 -- -25.624409
         Chain 4 -- -1631.175648 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1593.047315 -- -25.624409
         Chain 2 -- -1622.406525 -- -25.624409
         Chain 3 -- -1637.124480 -- -25.624409
         Chain 4 -- -1622.947813 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1629.573] (-1622.948) (-1591.348) (-1631.176) * [-1593.047] (-1622.407) (-1637.124) (-1622.948) 
        500 -- (-1325.973) (-1322.876) [-1317.458] (-1315.542) * (-1317.706) (-1324.399) (-1325.391) [-1319.968] -- 0:00:00
       1000 -- (-1323.341) (-1317.000) [-1311.922] (-1311.178) * (-1319.058) (-1328.654) (-1308.191) [-1313.415] -- 0:00:00
       1500 -- (-1314.318) (-1317.170) (-1308.746) [-1307.780] * (-1319.503) (-1319.025) [-1304.523] (-1311.149) -- 0:00:00
       2000 -- (-1312.856) (-1311.376) (-1307.933) [-1301.384] * (-1320.366) (-1314.729) (-1302.949) [-1301.488] -- 0:00:00
       2500 -- (-1310.682) (-1306.985) [-1296.816] (-1301.485) * (-1309.464) (-1305.839) (-1307.534) [-1300.269] -- 0:00:00
       3000 -- (-1304.265) (-1310.638) [-1297.632] (-1297.256) * (-1307.108) [-1307.565] (-1299.825) (-1297.782) -- 0:00:00
       3500 -- (-1310.507) (-1300.090) (-1299.352) [-1303.745] * (-1302.892) (-1296.336) [-1301.098] (-1303.352) -- 0:04:44
       4000 -- (-1303.175) [-1302.218] (-1301.826) (-1305.737) * (-1302.291) (-1296.387) (-1300.835) [-1299.482] -- 0:04:09
       4500 -- (-1308.715) (-1303.345) [-1295.279] (-1312.359) * (-1305.456) [-1292.870] (-1300.434) (-1298.099) -- 0:03:41
       5000 -- (-1302.014) (-1299.855) [-1296.745] (-1305.706) * (-1296.081) (-1297.672) [-1296.475] (-1299.785) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-1299.694) [-1303.231] (-1302.274) (-1297.027) * (-1296.496) (-1298.167) (-1304.540) [-1298.192] -- 0:03:00
       6000 -- (-1298.644) (-1304.163) (-1308.071) [-1300.486] * (-1300.878) [-1295.356] (-1303.896) (-1299.532) -- 0:02:45
       6500 -- (-1293.495) [-1302.861] (-1298.503) (-1296.171) * (-1302.347) [-1293.933] (-1304.803) (-1302.680) -- 0:02:32
       7000 -- (-1297.849) [-1302.641] (-1301.263) (-1297.840) * (-1305.667) (-1295.755) (-1297.879) [-1298.949] -- 0:02:21
       7500 -- (-1303.643) (-1300.382) (-1309.435) [-1297.541] * (-1303.901) (-1298.239) [-1299.439] (-1297.342) -- 0:02:12
       8000 -- (-1296.800) [-1296.623] (-1302.802) (-1297.522) * [-1303.285] (-1296.011) (-1296.844) (-1293.050) -- 0:02:04
       8500 -- (-1302.111) (-1302.057) (-1301.116) [-1298.771] * [-1299.470] (-1298.500) (-1301.804) (-1294.524) -- 0:01:56
       9000 -- (-1297.023) (-1301.640) (-1300.040) [-1299.337] * (-1300.289) [-1293.127] (-1301.431) (-1296.984) -- 0:01:50
       9500 -- [-1301.627] (-1299.752) (-1302.282) (-1299.806) * (-1298.882) (-1294.629) [-1298.972] (-1298.996) -- 0:03:28
      10000 -- (-1298.814) (-1308.030) (-1298.531) [-1296.963] * (-1304.706) (-1296.116) (-1299.224) [-1295.770] -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-1303.253) [-1303.676] (-1298.777) (-1306.813) * (-1299.744) [-1300.459] (-1298.204) (-1300.600) -- 0:03:08
      11000 -- (-1295.341) (-1304.099) [-1300.228] (-1302.027) * (-1307.934) (-1300.659) [-1302.429] (-1301.832) -- 0:02:59
      11500 -- (-1295.249) (-1306.327) [-1306.825] (-1301.198) * (-1302.787) (-1296.740) [-1296.001] (-1302.405) -- 0:02:51
      12000 -- (-1297.468) (-1296.845) [-1301.257] (-1305.087) * (-1301.617) [-1295.336] (-1293.317) (-1300.285) -- 0:02:44
      12500 -- (-1296.410) (-1294.512) [-1302.532] (-1302.836) * [-1304.169] (-1299.699) (-1298.115) (-1298.248) -- 0:02:38
      13000 -- (-1298.931) (-1296.801) (-1305.187) [-1300.061] * (-1299.435) (-1299.331) (-1296.580) [-1298.481] -- 0:02:31
      13500 -- (-1301.695) [-1293.313] (-1307.098) (-1303.419) * [-1298.578] (-1300.008) (-1304.013) (-1297.222) -- 0:02:26
      14000 -- (-1309.481) [-1294.744] (-1298.491) (-1301.140) * [-1291.842] (-1300.951) (-1303.387) (-1303.236) -- 0:02:20
      14500 -- (-1306.041) [-1298.037] (-1302.178) (-1304.520) * (-1295.286) [-1296.618] (-1300.336) (-1300.559) -- 0:02:15
      15000 -- (-1303.089) (-1296.883) [-1302.328] (-1297.167) * (-1298.487) (-1296.912) (-1305.327) [-1302.289] -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-1303.138) (-1298.723) (-1294.130) [-1299.392] * [-1294.870] (-1303.471) (-1299.355) (-1301.834) -- 0:03:10
      16000 -- (-1301.446) (-1298.620) [-1296.349] (-1300.723) * [-1299.137] (-1302.087) (-1298.367) (-1297.656) -- 0:03:04
      16500 -- [-1302.285] (-1298.058) (-1306.497) (-1299.461) * (-1311.545) (-1301.311) [-1298.610] (-1297.617) -- 0:02:58
      17000 -- (-1298.550) (-1301.446) [-1298.005] (-1301.839) * (-1304.390) [-1296.670] (-1297.047) (-1300.276) -- 0:02:53
      17500 -- (-1300.045) (-1300.345) (-1295.730) [-1296.696] * (-1298.153) [-1298.984] (-1299.019) (-1304.636) -- 0:02:48
      18000 -- [-1300.098] (-1299.703) (-1304.137) (-1294.519) * [-1297.251] (-1298.620) (-1298.121) (-1306.060) -- 0:02:43
      18500 -- (-1303.993) (-1295.122) (-1298.144) [-1300.222] * (-1298.729) (-1299.827) [-1300.217] (-1304.288) -- 0:02:39
      19000 -- (-1302.031) (-1295.213) (-1298.418) [-1304.052] * [-1293.673] (-1303.461) (-1293.637) (-1293.861) -- 0:02:34
      19500 -- (-1295.401) (-1296.988) [-1302.178] (-1296.934) * (-1292.084) (-1306.663) (-1295.178) [-1300.632] -- 0:02:30
      20000 -- (-1303.706) (-1294.715) [-1300.048] (-1301.593) * (-1297.223) (-1295.734) [-1306.075] (-1306.837) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-1302.827) (-1299.686) (-1298.658) [-1301.063] * [-1298.260] (-1297.890) (-1306.528) (-1316.969) -- 0:02:23
      21000 -- (-1303.548) [-1299.020] (-1296.935) (-1299.106) * (-1297.891) (-1300.762) (-1305.629) [-1306.920] -- 0:03:06
      21500 -- [-1298.705] (-1304.457) (-1294.241) (-1298.423) * (-1300.596) (-1295.410) [-1306.894] (-1306.852) -- 0:03:02
      22000 -- [-1297.211] (-1296.737) (-1301.552) (-1298.687) * (-1300.344) [-1297.613] (-1299.788) (-1297.086) -- 0:02:57
      22500 -- (-1298.104) (-1298.211) [-1299.096] (-1295.627) * (-1297.719) [-1295.363] (-1303.378) (-1294.039) -- 0:02:53
      23000 -- (-1298.215) (-1302.117) [-1296.626] (-1305.354) * (-1303.085) (-1304.385) [-1298.557] (-1295.640) -- 0:02:49
      23500 -- (-1298.110) (-1305.349) [-1294.365] (-1298.566) * [-1301.583] (-1299.486) (-1306.223) (-1300.357) -- 0:02:46
      24000 -- (-1299.931) (-1306.234) [-1301.094] (-1297.574) * (-1301.666) (-1300.506) [-1303.390] (-1297.895) -- 0:02:42
      24500 -- (-1295.895) (-1307.067) [-1294.491] (-1295.894) * (-1301.513) (-1296.300) (-1299.649) [-1297.201] -- 0:02:39
      25000 -- [-1297.779] (-1303.042) (-1297.496) (-1298.673) * (-1301.593) [-1293.778] (-1296.334) (-1301.375) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-1298.728] (-1299.136) (-1297.282) (-1293.798) * (-1299.816) (-1294.286) [-1300.592] (-1303.792) -- 0:02:32
      26000 -- (-1301.443) (-1298.213) [-1302.089] (-1295.407) * (-1296.306) [-1297.143] (-1305.598) (-1304.091) -- 0:02:29
      26500 -- (-1296.921) (-1298.233) (-1297.875) [-1300.185] * (-1295.857) [-1300.255] (-1307.881) (-1299.980) -- 0:02:26
      27000 -- [-1296.512] (-1301.826) (-1300.181) (-1296.293) * (-1301.316) (-1300.940) (-1313.521) [-1296.335] -- 0:03:00
      27500 -- (-1300.461) (-1295.490) [-1298.057] (-1296.215) * (-1299.840) [-1296.562] (-1309.118) (-1298.529) -- 0:02:56
      28000 -- (-1306.229) (-1300.602) [-1294.187] (-1300.801) * (-1297.393) (-1303.199) [-1300.639] (-1304.184) -- 0:02:53
      28500 -- (-1301.502) (-1297.655) [-1300.347] (-1292.851) * (-1306.734) [-1305.044] (-1301.368) (-1301.219) -- 0:02:50
      29000 -- (-1300.201) (-1295.824) [-1304.578] (-1299.436) * (-1308.766) (-1303.747) (-1302.067) [-1299.652] -- 0:02:47
      29500 -- (-1307.246) (-1301.847) (-1292.916) [-1296.278] * (-1298.883) (-1300.730) [-1297.471] (-1298.812) -- 0:02:44
      30000 -- (-1301.907) (-1293.240) [-1296.659] (-1294.828) * (-1299.306) [-1302.708] (-1296.624) (-1301.307) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-1299.855) (-1296.800) [-1299.598] (-1295.816) * (-1304.035) [-1302.265] (-1296.231) (-1300.533) -- 0:02:38
      31000 -- (-1302.330) (-1297.593) (-1298.920) [-1294.075] * (-1299.552) (-1309.333) [-1297.617] (-1299.852) -- 0:02:36
      31500 -- (-1300.176) [-1298.422] (-1299.650) (-1295.513) * (-1296.483) (-1302.577) [-1293.504] (-1298.613) -- 0:02:33
      32000 -- (-1298.720) (-1302.429) [-1296.402] (-1297.473) * (-1303.935) [-1304.804] (-1303.995) (-1301.581) -- 0:02:31
      32500 -- (-1307.943) (-1306.972) (-1301.346) [-1292.901] * (-1301.875) (-1306.875) (-1299.512) [-1302.025] -- 0:02:28
      33000 -- (-1299.852) (-1303.280) (-1304.962) [-1293.622] * [-1297.938] (-1299.923) (-1301.759) (-1302.862) -- 0:02:55
      33500 -- (-1301.810) [-1295.396] (-1303.118) (-1301.237) * [-1293.913] (-1306.468) (-1296.509) (-1307.009) -- 0:02:53
      34000 -- (-1299.087) [-1291.644] (-1298.019) (-1295.059) * (-1298.026) (-1313.085) [-1298.535] (-1307.239) -- 0:02:50
      34500 -- [-1294.550] (-1304.868) (-1304.869) (-1294.654) * (-1299.358) (-1299.728) (-1301.349) [-1306.557] -- 0:02:47
      35000 -- (-1301.888) (-1301.542) [-1304.483] (-1299.041) * (-1295.590) (-1298.453) (-1296.619) [-1302.180] -- 0:02:45

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-1302.825) (-1295.961) (-1301.583) [-1297.648] * (-1306.233) (-1297.899) [-1298.866] (-1306.665) -- 0:02:43
      36000 -- (-1300.731) [-1293.125] (-1305.229) (-1299.946) * (-1301.274) [-1299.290] (-1294.125) (-1301.731) -- 0:02:40
      36500 -- [-1296.810] (-1296.464) (-1299.683) (-1300.277) * (-1294.116) (-1297.750) [-1294.916] (-1304.043) -- 0:02:38
      37000 -- (-1303.398) [-1295.803] (-1301.469) (-1295.788) * [-1294.142] (-1296.234) (-1296.290) (-1308.662) -- 0:02:36
      37500 -- (-1297.619) [-1297.563] (-1300.879) (-1300.949) * (-1295.698) (-1296.683) [-1295.577] (-1307.217) -- 0:02:34
      38000 -- [-1294.595] (-1294.152) (-1303.850) (-1297.957) * (-1300.770) [-1299.405] (-1297.760) (-1302.774) -- 0:02:31
      38500 -- (-1295.095) (-1303.649) [-1295.782] (-1294.869) * (-1298.025) (-1303.300) [-1296.676] (-1303.049) -- 0:02:54
      39000 -- (-1301.702) (-1299.579) (-1294.794) [-1291.036] * (-1298.100) (-1292.779) (-1298.968) [-1302.713] -- 0:02:52
      39500 -- (-1301.615) (-1302.457) [-1299.153] (-1291.896) * (-1294.806) (-1300.913) [-1293.436] (-1299.711) -- 0:02:50
      40000 -- (-1297.331) [-1300.076] (-1307.549) (-1303.024) * [-1294.831] (-1295.813) (-1300.935) (-1300.826) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-1301.967) (-1301.453) [-1300.245] (-1301.808) * (-1296.243) (-1303.499) (-1302.256) [-1296.121] -- 0:02:45
      41000 -- (-1304.969) (-1301.838) (-1300.678) [-1295.214] * (-1300.010) [-1293.197] (-1300.525) (-1295.175) -- 0:02:43
      41500 -- (-1296.173) (-1306.921) [-1300.232] (-1301.257) * (-1302.461) (-1297.473) (-1303.487) [-1296.033] -- 0:02:41
      42000 -- (-1295.109) (-1294.471) [-1298.937] (-1296.788) * (-1298.962) (-1293.012) (-1297.809) [-1298.040] -- 0:02:39
      42500 -- [-1295.158] (-1300.997) (-1298.296) (-1293.696) * (-1302.908) (-1297.814) (-1303.694) [-1297.413] -- 0:02:37
      43000 -- (-1300.557) [-1297.581] (-1293.796) (-1293.741) * (-1298.543) [-1290.722] (-1302.304) (-1301.071) -- 0:02:35
      43500 -- (-1297.156) (-1300.888) [-1295.090] (-1297.634) * (-1302.596) (-1297.170) (-1296.894) [-1300.739] -- 0:02:33
      44000 -- (-1297.245) (-1303.536) [-1297.529] (-1299.930) * (-1295.934) (-1296.382) (-1305.636) [-1305.953] -- 0:02:32
      44500 -- (-1302.918) (-1295.053) [-1302.325] (-1295.670) * [-1301.542] (-1301.016) (-1304.911) (-1310.105) -- 0:02:51
      45000 -- (-1299.612) (-1299.343) [-1292.439] (-1311.435) * [-1297.476] (-1298.608) (-1301.191) (-1303.433) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-1306.077) (-1299.434) [-1297.652] (-1301.549) * (-1302.933) (-1296.480) [-1303.443] (-1300.689) -- 0:02:47
      46000 -- (-1297.647) (-1303.495) (-1295.954) [-1293.231] * [-1299.041] (-1313.956) (-1298.635) (-1300.221) -- 0:02:45
      46500 -- (-1294.431) [-1306.591] (-1297.556) (-1298.324) * (-1301.438) (-1306.837) (-1299.444) [-1294.744] -- 0:02:44
      47000 -- (-1295.275) (-1302.643) [-1297.964] (-1299.391) * (-1299.587) (-1293.803) [-1296.247] (-1299.710) -- 0:02:42
      47500 -- [-1296.447] (-1299.329) (-1299.922) (-1304.680) * (-1302.260) (-1301.667) [-1302.907] (-1292.817) -- 0:02:40
      48000 -- (-1299.868) (-1310.284) (-1294.768) [-1294.757] * (-1296.364) (-1302.883) (-1307.933) [-1298.890] -- 0:02:38
      48500 -- (-1294.568) [-1302.063] (-1300.830) (-1300.394) * [-1299.333] (-1299.435) (-1301.677) (-1300.590) -- 0:02:36
      49000 -- [-1299.125] (-1296.108) (-1304.684) (-1296.852) * (-1298.714) (-1303.621) [-1299.871] (-1299.124) -- 0:02:35
      49500 -- [-1300.313] (-1300.389) (-1295.777) (-1299.210) * (-1301.415) (-1299.681) (-1296.882) [-1297.664] -- 0:02:33
      50000 -- (-1300.205) (-1298.233) (-1295.827) [-1300.486] * (-1302.308) [-1299.395] (-1298.459) (-1300.507) -- 0:02:32

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-1305.387) (-1295.518) [-1292.948] (-1301.989) * (-1296.888) (-1295.014) (-1298.473) [-1298.815] -- 0:02:49
      51000 -- [-1302.190] (-1299.266) (-1298.187) (-1296.878) * (-1293.990) [-1294.210] (-1297.453) (-1302.660) -- 0:02:47
      51500 -- (-1294.637) [-1303.504] (-1306.798) (-1296.472) * (-1308.407) (-1301.541) (-1296.880) [-1298.978] -- 0:02:45
      52000 -- [-1299.455] (-1304.041) (-1300.775) (-1297.100) * (-1310.336) (-1296.601) (-1291.734) [-1297.338] -- 0:02:44
      52500 -- (-1298.488) (-1303.407) (-1296.526) [-1296.247] * (-1298.520) [-1295.350] (-1295.751) (-1299.407) -- 0:02:42
      53000 -- [-1293.977] (-1295.740) (-1301.838) (-1299.546) * (-1293.994) [-1295.841] (-1295.675) (-1301.690) -- 0:02:40
      53500 -- (-1295.742) [-1299.475] (-1298.419) (-1299.194) * (-1303.544) (-1301.869) (-1294.349) [-1298.891] -- 0:02:39
      54000 -- [-1294.486] (-1295.626) (-1295.303) (-1300.761) * (-1295.321) [-1305.587] (-1295.059) (-1300.271) -- 0:02:37
      54500 -- (-1296.300) (-1297.522) [-1296.023] (-1293.223) * (-1295.468) (-1303.918) (-1294.704) [-1297.052] -- 0:02:36
      55000 -- [-1297.971] (-1296.972) (-1296.822) (-1294.405) * (-1294.233) (-1301.015) (-1292.856) [-1294.716] -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-1298.706) (-1301.042) [-1294.349] (-1302.062) * (-1304.878) [-1301.724] (-1300.319) (-1294.242) -- 0:02:33
      56000 -- (-1300.579) (-1297.907) (-1301.058) [-1304.320] * (-1294.887) [-1305.244] (-1305.999) (-1295.112) -- 0:02:48
      56500 -- (-1299.058) [-1303.584] (-1299.935) (-1300.146) * (-1293.849) (-1310.294) (-1297.095) [-1296.693] -- 0:02:46
      57000 -- [-1294.657] (-1298.523) (-1297.877) (-1298.166) * (-1296.406) (-1304.638) (-1300.417) [-1300.001] -- 0:02:45
      57500 -- [-1291.972] (-1298.685) (-1295.378) (-1305.048) * (-1295.410) [-1299.811] (-1299.853) (-1294.548) -- 0:02:43
      58000 -- (-1299.286) (-1296.870) (-1300.329) [-1297.710] * (-1297.548) (-1304.051) [-1301.565] (-1300.567) -- 0:02:42
      58500 -- (-1293.142) (-1302.281) (-1305.612) [-1301.998] * (-1298.747) [-1298.322] (-1301.920) (-1296.371) -- 0:02:40
      59000 -- [-1294.951] (-1298.247) (-1303.424) (-1301.010) * (-1298.908) (-1303.049) [-1302.332] (-1295.664) -- 0:02:39
      59500 -- (-1295.205) (-1301.278) [-1303.122] (-1297.995) * (-1301.744) [-1295.950] (-1301.494) (-1298.792) -- 0:02:38
      60000 -- [-1296.975] (-1303.985) (-1299.776) (-1295.132) * [-1295.958] (-1298.371) (-1304.170) (-1301.356) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-1294.678) (-1303.965) [-1300.923] (-1298.195) * (-1296.795) [-1296.820] (-1299.222) (-1297.904) -- 0:02:35
      61000 -- [-1296.470] (-1303.863) (-1307.435) (-1296.477) * [-1293.840] (-1295.242) (-1300.468) (-1303.229) -- 0:02:33
      61500 -- [-1298.986] (-1296.878) (-1298.530) (-1304.998) * (-1300.857) (-1296.687) (-1300.253) [-1296.275] -- 0:02:32
      62000 -- (-1295.388) (-1298.413) [-1301.255] (-1294.987) * (-1296.328) [-1297.538] (-1297.943) (-1300.045) -- 0:02:46
      62500 -- (-1299.464) (-1296.351) [-1301.477] (-1295.181) * [-1293.914] (-1303.410) (-1295.959) (-1298.476) -- 0:02:45
      63000 -- (-1296.298) (-1298.096) [-1296.191] (-1297.034) * (-1306.730) [-1297.831] (-1295.021) (-1301.551) -- 0:02:43
      63500 -- (-1298.257) (-1295.677) [-1296.222] (-1307.380) * [-1293.652] (-1300.059) (-1296.171) (-1300.442) -- 0:02:42
      64000 -- (-1297.041) [-1296.375] (-1298.093) (-1295.980) * (-1297.141) (-1293.188) (-1296.205) [-1306.086] -- 0:02:40
      64500 -- (-1299.773) (-1295.463) [-1297.625] (-1296.590) * (-1300.021) [-1299.457] (-1301.206) (-1302.541) -- 0:02:39
      65000 -- [-1297.714] (-1293.882) (-1294.987) (-1293.387) * (-1304.434) (-1298.873) [-1300.132] (-1306.340) -- 0:02:38

      Average standard deviation of split frequencies: 0.000000

      65500 -- [-1295.768] (-1297.212) (-1294.027) (-1297.829) * [-1300.793] (-1299.722) (-1302.065) (-1312.556) -- 0:02:36
      66000 -- (-1299.518) (-1296.546) [-1295.318] (-1303.828) * (-1305.904) [-1297.186] (-1297.169) (-1308.505) -- 0:02:35
      66500 -- (-1299.700) [-1295.658] (-1292.054) (-1300.071) * (-1294.248) (-1298.431) [-1297.052] (-1309.120) -- 0:02:34
      67000 -- (-1297.606) (-1297.883) [-1299.458] (-1295.518) * (-1303.335) (-1302.607) (-1300.414) [-1301.096] -- 0:02:33
      67500 -- (-1301.538) (-1293.019) (-1301.968) [-1297.273] * (-1300.922) (-1307.231) [-1298.269] (-1305.936) -- 0:02:31
      68000 -- (-1297.482) [-1300.536] (-1304.060) (-1298.738) * [-1297.093] (-1299.683) (-1296.221) (-1311.850) -- 0:02:44
      68500 -- [-1294.779] (-1298.430) (-1296.173) (-1305.533) * [-1296.499] (-1300.355) (-1293.796) (-1309.507) -- 0:02:43
      69000 -- (-1300.121) [-1297.690] (-1299.092) (-1301.259) * [-1300.227] (-1303.095) (-1295.170) (-1303.254) -- 0:02:41
      69500 -- [-1296.536] (-1297.656) (-1297.336) (-1298.249) * [-1299.197] (-1304.405) (-1297.059) (-1304.139) -- 0:02:40
      70000 -- [-1296.520] (-1298.381) (-1298.172) (-1303.521) * [-1303.181] (-1308.099) (-1298.139) (-1307.686) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-1299.203) [-1294.708] (-1301.090) (-1300.675) * [-1297.172] (-1306.310) (-1299.541) (-1301.613) -- 0:02:38
      71000 -- (-1298.000) [-1295.137] (-1302.783) (-1300.537) * [-1298.304] (-1299.473) (-1295.264) (-1301.944) -- 0:02:37
      71500 -- (-1300.304) (-1295.128) [-1301.453] (-1302.044) * (-1304.682) (-1296.186) (-1303.735) [-1302.575] -- 0:02:35
      72000 -- (-1293.151) (-1299.766) [-1302.694] (-1304.330) * (-1308.345) (-1298.351) (-1291.593) [-1302.210] -- 0:02:34
      72500 -- (-1300.448) (-1293.864) [-1297.983] (-1296.528) * (-1307.017) [-1297.455] (-1297.527) (-1295.155) -- 0:02:33
      73000 -- (-1297.088) [-1293.233] (-1303.760) (-1300.233) * [-1294.812] (-1297.923) (-1297.571) (-1301.612) -- 0:02:32
      73500 -- (-1296.672) [-1300.294] (-1300.746) (-1300.193) * (-1292.838) [-1296.958] (-1298.778) (-1295.493) -- 0:02:31
      74000 -- [-1306.966] (-1294.942) (-1293.770) (-1297.494) * [-1296.313] (-1297.400) (-1299.940) (-1297.712) -- 0:02:42
      74500 -- (-1299.389) (-1300.570) [-1297.517] (-1298.702) * (-1292.810) (-1296.176) (-1300.739) [-1291.892] -- 0:02:41
      75000 -- [-1299.510] (-1294.992) (-1297.847) (-1303.729) * (-1292.814) (-1298.946) (-1303.311) [-1294.112] -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-1296.553) [-1295.371] (-1300.790) (-1297.029) * (-1301.462) (-1298.887) (-1294.599) [-1293.955] -- 0:02:39
      76000 -- (-1299.609) [-1294.901] (-1296.722) (-1292.061) * (-1293.500) (-1299.190) (-1296.493) [-1299.720] -- 0:02:38
      76500 -- (-1299.066) (-1296.154) [-1301.088] (-1296.322) * [-1302.650] (-1301.855) (-1307.721) (-1298.995) -- 0:02:36
      77000 -- (-1301.342) (-1301.492) [-1296.804] (-1298.118) * (-1296.834) (-1300.610) (-1302.952) [-1300.313] -- 0:02:35
      77500 -- (-1304.060) (-1300.787) (-1296.276) [-1295.405] * (-1292.345) [-1295.222] (-1298.825) (-1297.186) -- 0:02:34
      78000 -- [-1295.473] (-1296.492) (-1296.004) (-1299.502) * (-1294.934) (-1292.671) [-1299.392] (-1296.161) -- 0:02:33
      78500 -- (-1303.979) [-1298.762] (-1297.461) (-1301.761) * (-1292.933) [-1293.865] (-1309.660) (-1294.986) -- 0:02:32
      79000 -- (-1300.169) (-1293.074) (-1298.127) [-1296.489] * [-1294.327] (-1295.421) (-1300.699) (-1297.121) -- 0:02:31
      79500 -- (-1297.967) (-1297.002) [-1302.698] (-1300.268) * (-1305.784) (-1296.178) (-1301.865) [-1296.459] -- 0:02:30
      80000 -- (-1301.050) [-1295.519] (-1300.719) (-1302.816) * (-1301.184) [-1296.483] (-1296.538) (-1298.620) -- 0:02:41

      Average standard deviation of split frequencies: 0.002922

      80500 -- (-1301.771) [-1293.514] (-1301.289) (-1299.021) * (-1301.156) (-1293.469) (-1299.331) [-1299.524] -- 0:02:39
      81000 -- (-1303.293) (-1297.275) [-1299.300] (-1295.744) * [-1296.595] (-1304.128) (-1307.828) (-1304.796) -- 0:02:38
      81500 -- (-1298.423) (-1304.404) (-1301.289) [-1301.964] * (-1300.730) (-1298.690) [-1303.630] (-1298.878) -- 0:02:37
      82000 -- (-1299.730) [-1295.300] (-1299.318) (-1300.750) * (-1299.559) (-1300.324) (-1305.800) [-1297.370] -- 0:02:36
      82500 -- (-1298.848) [-1294.170] (-1295.761) (-1298.850) * (-1300.123) (-1298.404) (-1307.409) [-1302.656] -- 0:02:35
      83000 -- [-1298.477] (-1298.452) (-1298.908) (-1298.014) * (-1304.941) [-1297.646] (-1302.312) (-1302.487) -- 0:02:34
      83500 -- (-1302.992) (-1301.879) (-1302.113) [-1297.092] * (-1296.804) [-1294.601] (-1298.233) (-1295.333) -- 0:02:33
      84000 -- [-1296.356] (-1302.401) (-1298.994) (-1302.045) * (-1299.554) [-1299.940] (-1298.290) (-1296.388) -- 0:02:32
      84500 -- (-1298.002) (-1297.230) (-1299.345) [-1296.317] * (-1296.137) [-1295.604] (-1295.336) (-1297.470) -- 0:02:31
      85000 -- [-1298.312] (-1299.313) (-1296.703) (-1294.515) * (-1300.784) [-1296.902] (-1293.231) (-1297.734) -- 0:02:30

      Average standard deviation of split frequencies: 0.002741

      85500 -- [-1299.794] (-1297.875) (-1298.263) (-1296.694) * (-1304.947) [-1295.305] (-1301.077) (-1299.602) -- 0:02:29
      86000 -- (-1296.537) [-1296.216] (-1298.331) (-1296.362) * (-1297.880) (-1301.319) [-1295.250] (-1297.471) -- 0:02:39
      86500 -- (-1294.816) (-1297.489) (-1297.770) [-1295.695] * (-1297.185) (-1294.401) [-1296.806] (-1304.164) -- 0:02:38
      87000 -- [-1294.335] (-1301.045) (-1295.617) (-1296.373) * (-1298.064) (-1301.374) (-1293.393) [-1297.989] -- 0:02:37
      87500 -- (-1295.816) [-1296.942] (-1295.307) (-1298.246) * (-1300.991) (-1301.946) (-1301.340) [-1294.996] -- 0:02:36
      88000 -- (-1297.997) [-1297.063] (-1302.600) (-1305.736) * (-1297.685) [-1298.081] (-1297.404) (-1301.884) -- 0:02:35
      88500 -- (-1299.530) [-1297.146] (-1300.582) (-1298.969) * [-1305.294] (-1299.449) (-1297.350) (-1295.753) -- 0:02:34
      89000 -- [-1296.164] (-1299.782) (-1298.065) (-1294.192) * [-1297.953] (-1303.634) (-1297.988) (-1294.764) -- 0:02:33
      89500 -- [-1294.670] (-1293.433) (-1299.707) (-1299.795) * (-1302.433) (-1300.269) (-1297.575) [-1299.581] -- 0:02:32
      90000 -- (-1298.999) (-1300.837) (-1294.336) [-1295.272] * (-1304.498) (-1301.550) (-1304.437) [-1295.460] -- 0:02:31

      Average standard deviation of split frequencies: 0.002600

      90500 -- (-1301.401) (-1297.481) (-1295.667) [-1299.943] * (-1306.833) (-1301.889) (-1293.833) [-1294.682] -- 0:02:30
      91000 -- (-1299.536) (-1301.371) [-1295.327] (-1305.432) * (-1304.983) (-1300.038) [-1295.964] (-1297.160) -- 0:02:29
      91500 -- (-1298.095) (-1295.328) [-1296.726] (-1303.908) * (-1298.334) [-1295.619] (-1298.317) (-1299.718) -- 0:02:28
      92000 -- (-1301.786) [-1304.536] (-1295.145) (-1301.053) * (-1297.292) (-1294.168) (-1296.826) [-1299.839] -- 0:02:37
      92500 -- (-1304.574) (-1298.467) [-1293.482] (-1304.340) * (-1298.677) (-1300.590) [-1296.241] (-1296.347) -- 0:02:36
      93000 -- (-1296.558) (-1297.680) [-1297.080] (-1295.786) * [-1300.994] (-1295.836) (-1299.712) (-1296.107) -- 0:02:36
      93500 -- (-1299.842) (-1302.005) (-1295.284) [-1296.294] * (-1302.766) [-1297.560] (-1301.553) (-1296.651) -- 0:02:35
      94000 -- (-1296.122) (-1298.375) (-1295.789) [-1302.997] * (-1297.715) [-1298.145] (-1297.393) (-1294.247) -- 0:02:34
      94500 -- (-1299.859) (-1301.276) [-1298.576] (-1297.267) * (-1300.319) [-1298.864] (-1305.499) (-1293.842) -- 0:02:33
      95000 -- (-1298.065) (-1300.644) [-1302.171] (-1295.730) * (-1296.128) (-1296.119) (-1304.523) [-1297.409] -- 0:02:32

      Average standard deviation of split frequencies: 0.004910

      95500 -- (-1302.408) [-1302.897] (-1293.445) (-1295.651) * (-1300.048) (-1298.937) (-1297.506) [-1294.317] -- 0:02:31
      96000 -- (-1298.876) (-1302.393) [-1295.742] (-1299.766) * [-1297.219] (-1301.511) (-1296.279) (-1298.508) -- 0:02:30
      96500 -- (-1295.306) [-1308.011] (-1296.898) (-1306.451) * (-1298.908) (-1300.466) (-1293.440) [-1295.414] -- 0:02:29
      97000 -- (-1296.156) (-1303.457) [-1295.216] (-1299.410) * (-1297.147) (-1295.115) [-1294.485] (-1299.450) -- 0:02:28
      97500 -- [-1296.513] (-1298.526) (-1302.820) (-1304.197) * [-1295.326] (-1297.206) (-1294.635) (-1300.011) -- 0:02:37
      98000 -- (-1297.674) [-1297.331] (-1298.959) (-1301.430) * (-1296.455) (-1297.987) (-1301.087) [-1299.491] -- 0:02:36
      98500 -- [-1303.615] (-1302.528) (-1300.355) (-1305.244) * (-1301.445) (-1300.228) [-1294.640] (-1302.765) -- 0:02:35
      99000 -- [-1300.568] (-1305.466) (-1296.926) (-1296.203) * (-1304.225) [-1295.344] (-1300.548) (-1299.465) -- 0:02:34
      99500 -- [-1301.618] (-1301.389) (-1298.522) (-1296.728) * (-1298.857) (-1296.618) [-1297.180] (-1299.000) -- 0:02:33
      100000 -- (-1300.183) (-1300.441) [-1298.035] (-1299.694) * (-1301.004) [-1298.264] (-1301.347) (-1294.907) -- 0:02:33

      Average standard deviation of split frequencies: 0.004683

      100500 -- (-1302.384) (-1296.606) [-1300.675] (-1294.769) * (-1301.436) (-1310.028) (-1298.718) [-1298.286] -- 0:02:32
      101000 -- [-1303.415] (-1302.969) (-1295.092) (-1299.758) * (-1303.385) [-1303.999] (-1300.183) (-1299.391) -- 0:02:31
      101500 -- (-1307.666) [-1301.164] (-1296.513) (-1304.703) * (-1298.282) (-1304.837) (-1297.508) [-1297.683] -- 0:02:30
      102000 -- (-1300.884) [-1297.876] (-1296.873) (-1298.241) * (-1303.781) (-1305.960) (-1298.122) [-1296.293] -- 0:02:29
      102500 -- (-1300.698) (-1301.425) [-1297.550] (-1303.769) * (-1298.536) [-1298.163] (-1298.503) (-1297.886) -- 0:02:28
      103000 -- (-1300.799) (-1293.633) [-1300.697] (-1296.408) * (-1295.294) (-1303.692) (-1297.359) [-1299.570] -- 0:02:28
      103500 -- (-1302.894) (-1296.923) (-1302.661) [-1297.640] * (-1297.955) (-1301.285) (-1296.624) [-1299.928] -- 0:02:35
      104000 -- (-1303.869) [-1297.709] (-1297.593) (-1297.716) * (-1297.818) (-1302.474) (-1300.677) [-1298.058] -- 0:02:35
      104500 -- (-1296.847) [-1295.587] (-1301.196) (-1298.630) * (-1297.298) (-1298.500) [-1303.678] (-1296.473) -- 0:02:34
      105000 -- (-1305.298) (-1296.895) [-1301.142] (-1296.742) * (-1296.152) (-1302.725) (-1296.096) [-1299.484] -- 0:02:33

      Average standard deviation of split frequencies: 0.004447

      105500 -- (-1303.909) (-1296.986) (-1298.179) [-1297.336] * (-1299.150) (-1297.685) (-1295.931) [-1298.478] -- 0:02:32
      106000 -- (-1307.545) (-1302.068) [-1296.008] (-1300.272) * (-1294.877) (-1294.233) (-1301.890) [-1292.167] -- 0:02:31
      106500 -- (-1295.589) (-1302.153) [-1298.006] (-1306.443) * (-1299.706) (-1304.664) (-1299.919) [-1294.685] -- 0:02:31
      107000 -- (-1299.468) (-1303.812) (-1298.132) [-1301.520] * [-1303.719] (-1301.340) (-1300.109) (-1298.736) -- 0:02:30
      107500 -- (-1299.050) [-1299.917] (-1298.631) (-1300.421) * (-1298.421) [-1296.227] (-1300.002) (-1298.895) -- 0:02:29
      108000 -- (-1299.643) (-1300.701) [-1305.566] (-1305.628) * (-1302.288) [-1299.900] (-1297.952) (-1295.458) -- 0:02:28
      108500 -- (-1305.551) (-1298.721) (-1295.898) [-1299.791] * (-1295.332) (-1294.535) (-1298.139) [-1297.123] -- 0:02:27
      109000 -- (-1297.273) (-1298.253) [-1297.593] (-1303.228) * [-1296.250] (-1294.732) (-1297.175) (-1300.804) -- 0:02:27
      109500 -- (-1300.629) [-1294.399] (-1308.566) (-1295.371) * (-1296.294) [-1298.250] (-1300.712) (-1298.243) -- 0:02:34
      110000 -- (-1300.393) (-1297.471) [-1300.069] (-1294.962) * [-1295.096] (-1298.800) (-1294.601) (-1293.804) -- 0:02:33

      Average standard deviation of split frequencies: 0.004260

      110500 -- [-1293.923] (-1298.643) (-1297.239) (-1295.458) * (-1294.460) [-1301.741] (-1299.410) (-1296.806) -- 0:02:32
      111000 -- [-1296.205] (-1295.525) (-1298.945) (-1298.427) * [-1296.225] (-1298.685) (-1297.156) (-1298.332) -- 0:02:32
      111500 -- (-1306.051) (-1298.466) [-1299.050] (-1307.444) * (-1301.397) (-1298.611) [-1300.402] (-1295.146) -- 0:02:31
      112000 -- (-1306.015) [-1295.780] (-1301.775) (-1302.240) * (-1295.943) [-1298.666] (-1303.433) (-1295.665) -- 0:02:30
      112500 -- (-1301.061) [-1300.272] (-1296.946) (-1300.700) * (-1294.901) (-1300.225) [-1302.950] (-1298.781) -- 0:02:29
      113000 -- [-1303.936] (-1297.820) (-1299.240) (-1301.247) * (-1299.801) (-1298.987) (-1307.469) [-1300.765] -- 0:02:29
      113500 -- (-1300.753) [-1303.183] (-1301.632) (-1299.796) * [-1296.019] (-1296.497) (-1308.529) (-1302.223) -- 0:02:28
      114000 -- [-1296.598] (-1304.713) (-1303.516) (-1299.549) * [-1295.848] (-1295.816) (-1302.966) (-1298.225) -- 0:02:27
      114500 -- (-1302.292) (-1302.376) [-1292.906] (-1299.832) * (-1298.700) [-1297.572] (-1305.143) (-1298.529) -- 0:02:26
      115000 -- [-1299.001] (-1303.207) (-1291.971) (-1299.520) * [-1301.711] (-1297.202) (-1299.897) (-1295.873) -- 0:02:26

      Average standard deviation of split frequencies: 0.004064

      115500 -- (-1305.408) (-1294.562) [-1298.998] (-1292.876) * (-1302.465) (-1299.556) [-1295.521] (-1298.116) -- 0:02:33
      116000 -- (-1297.897) (-1304.788) [-1297.768] (-1294.400) * (-1295.880) [-1297.558] (-1297.833) (-1298.001) -- 0:02:32
      116500 -- (-1297.452) (-1302.899) [-1295.342] (-1294.795) * (-1298.058) [-1294.563] (-1293.555) (-1302.687) -- 0:02:31
      117000 -- (-1302.931) [-1300.929] (-1298.488) (-1295.711) * (-1303.198) [-1293.004] (-1308.036) (-1303.671) -- 0:02:30
      117500 -- (-1292.105) (-1306.618) (-1304.113) [-1296.087] * [-1299.233] (-1298.092) (-1296.968) (-1296.153) -- 0:02:30
      118000 -- (-1301.163) (-1303.574) (-1300.371) [-1298.473] * (-1299.764) (-1299.681) [-1294.147] (-1299.985) -- 0:02:29
      118500 -- (-1300.516) (-1307.719) [-1297.520] (-1305.190) * (-1305.923) [-1297.786] (-1301.141) (-1305.602) -- 0:02:28
      119000 -- (-1300.761) (-1301.317) (-1295.955) [-1297.217] * (-1302.520) [-1298.268] (-1302.620) (-1302.595) -- 0:02:28
      119500 -- (-1308.743) [-1298.030] (-1300.067) (-1294.678) * (-1298.575) [-1297.113] (-1303.080) (-1298.765) -- 0:02:27
      120000 -- [-1298.570] (-1303.945) (-1303.628) (-1299.342) * (-1298.008) (-1296.706) (-1301.838) [-1297.514] -- 0:02:26

      Average standard deviation of split frequencies: 0.003907

      120500 -- (-1297.633) (-1306.879) [-1298.386] (-1296.653) * [-1299.150] (-1295.907) (-1299.738) (-1297.683) -- 0:02:25
      121000 -- (-1307.168) (-1305.089) (-1298.183) [-1301.760] * (-1298.012) [-1301.503] (-1300.094) (-1302.285) -- 0:02:25
      121500 -- (-1301.423) (-1298.021) [-1297.624] (-1297.826) * (-1303.790) (-1303.487) (-1298.893) [-1295.784] -- 0:02:31
      122000 -- (-1299.444) (-1307.241) (-1295.275) [-1296.585] * (-1299.092) (-1298.142) [-1306.914] (-1296.587) -- 0:02:31
      122500 -- (-1302.538) (-1300.448) (-1294.103) [-1296.454] * (-1293.125) (-1304.990) (-1299.990) [-1297.990] -- 0:02:30
      123000 -- (-1304.917) (-1296.260) [-1294.431] (-1302.877) * (-1302.926) [-1294.435] (-1296.506) (-1299.073) -- 0:02:29
      123500 -- (-1302.332) [-1294.424] (-1301.567) (-1299.483) * [-1294.813] (-1297.343) (-1292.754) (-1291.467) -- 0:02:29
      124000 -- (-1300.269) [-1296.786] (-1296.527) (-1298.449) * (-1296.149) (-1298.561) (-1311.408) [-1292.706] -- 0:02:28
      124500 -- (-1297.284) (-1295.184) [-1297.025] (-1296.025) * [-1298.310] (-1300.223) (-1303.595) (-1292.510) -- 0:02:27
      125000 -- (-1299.385) [-1298.875] (-1293.910) (-1297.842) * (-1297.438) (-1297.302) [-1297.601] (-1292.992) -- 0:02:27

      Average standard deviation of split frequencies: 0.003741

      125500 -- (-1301.106) (-1300.907) [-1297.558] (-1299.939) * (-1297.351) [-1299.948] (-1295.410) (-1299.426) -- 0:02:26
      126000 -- (-1293.693) (-1301.559) (-1303.738) [-1296.179] * (-1295.074) (-1297.245) [-1298.095] (-1303.492) -- 0:02:25
      126500 -- [-1292.891] (-1300.160) (-1300.564) (-1296.677) * (-1303.961) (-1299.367) (-1299.103) [-1299.493] -- 0:02:25
      127000 -- [-1299.304] (-1297.536) (-1304.138) (-1296.175) * (-1295.687) (-1296.962) (-1298.844) [-1295.619] -- 0:02:24
      127500 -- [-1298.152] (-1299.333) (-1300.947) (-1299.037) * (-1295.986) (-1293.663) (-1300.838) [-1296.353] -- 0:02:30
      128000 -- (-1302.906) (-1296.424) [-1297.895] (-1296.797) * (-1293.513) (-1297.735) [-1295.641] (-1296.349) -- 0:02:29
      128500 -- (-1296.299) (-1310.465) [-1299.482] (-1302.755) * (-1299.970) (-1294.871) [-1294.893] (-1298.516) -- 0:02:29
      129000 -- [-1300.886] (-1300.404) (-1294.396) (-1298.481) * (-1294.293) [-1293.462] (-1294.236) (-1295.175) -- 0:02:28
      129500 -- (-1301.181) [-1296.694] (-1293.254) (-1298.251) * (-1295.243) [-1294.746] (-1300.072) (-1305.775) -- 0:02:27
      130000 -- (-1313.206) (-1296.727) (-1296.425) [-1299.505] * (-1299.639) [-1296.493] (-1306.826) (-1296.632) -- 0:02:27

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-1307.068) [-1296.482] (-1296.330) (-1302.637) * (-1296.996) [-1297.461] (-1297.564) (-1301.883) -- 0:02:26
      131000 -- [-1299.227] (-1299.158) (-1297.318) (-1306.791) * (-1296.673) (-1296.651) (-1306.370) [-1303.417] -- 0:02:25
      131500 -- (-1298.757) (-1298.323) [-1296.554] (-1302.036) * (-1297.406) [-1298.687] (-1303.348) (-1309.737) -- 0:02:25
      132000 -- (-1298.351) (-1293.530) [-1302.624] (-1299.145) * [-1295.960] (-1301.584) (-1295.853) (-1303.890) -- 0:02:24
      132500 -- (-1305.217) (-1300.069) [-1295.141] (-1298.690) * (-1299.138) [-1301.751] (-1302.994) (-1302.575) -- 0:02:24
      133000 -- (-1300.470) [-1299.089] (-1295.482) (-1298.536) * (-1298.623) (-1299.964) (-1296.686) [-1304.521] -- 0:02:29
      133500 -- (-1297.140) [-1298.163] (-1296.594) (-1299.591) * [-1302.077] (-1305.318) (-1300.061) (-1301.533) -- 0:02:29
      134000 -- (-1300.044) [-1295.696] (-1292.251) (-1303.853) * (-1302.319) (-1305.213) (-1297.530) [-1301.376] -- 0:02:28
      134500 -- [-1299.121] (-1307.757) (-1300.164) (-1301.014) * [-1297.353] (-1295.005) (-1294.861) (-1297.463) -- 0:02:28
      135000 -- [-1301.147] (-1297.777) (-1301.385) (-1299.914) * (-1298.668) [-1302.443] (-1304.573) (-1300.268) -- 0:02:27

      Average standard deviation of split frequencies: 0.003466

      135500 -- [-1297.438] (-1297.174) (-1299.547) (-1303.507) * [-1308.970] (-1302.790) (-1295.394) (-1295.601) -- 0:02:26
      136000 -- (-1301.754) [-1294.860] (-1310.962) (-1301.176) * (-1300.727) (-1298.873) (-1291.805) [-1294.149] -- 0:02:26
      136500 -- (-1297.874) [-1294.642] (-1299.448) (-1299.536) * [-1292.134] (-1293.779) (-1300.292) (-1296.702) -- 0:02:25
      137000 -- (-1298.884) (-1298.765) (-1306.088) [-1295.159] * (-1297.309) [-1301.459] (-1294.738) (-1301.470) -- 0:02:24
      137500 -- (-1298.699) [-1293.299] (-1298.050) (-1297.828) * (-1298.711) (-1303.088) (-1302.919) [-1304.749] -- 0:02:24
      138000 -- [-1298.925] (-1300.937) (-1299.215) (-1297.684) * [-1298.003] (-1302.908) (-1300.283) (-1293.195) -- 0:02:23
      138500 -- (-1297.114) (-1294.490) (-1295.019) [-1294.739] * [-1303.965] (-1297.120) (-1297.139) (-1296.812) -- 0:02:23
      139000 -- [-1298.758] (-1298.213) (-1304.282) (-1299.676) * (-1304.810) (-1297.392) (-1297.841) [-1293.291] -- 0:02:28
      139500 -- (-1304.041) (-1298.994) (-1305.336) [-1297.376] * (-1304.921) (-1297.210) [-1294.794] (-1297.122) -- 0:02:28
      140000 -- (-1302.111) [-1292.990] (-1298.183) (-1298.257) * (-1298.366) (-1294.515) [-1298.569] (-1305.705) -- 0:02:27

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-1309.418) [-1294.347] (-1299.248) (-1299.403) * [-1299.192] (-1307.921) (-1296.556) (-1298.565) -- 0:02:26
      141000 -- (-1299.225) [-1293.005] (-1311.190) (-1305.621) * (-1297.575) (-1300.458) [-1300.504] (-1297.222) -- 0:02:26
      141500 -- (-1303.661) [-1298.941] (-1301.934) (-1299.462) * (-1301.737) [-1296.413] (-1300.454) (-1299.104) -- 0:02:25
      142000 -- [-1298.935] (-1300.969) (-1299.125) (-1300.230) * (-1301.214) (-1310.348) [-1301.477] (-1301.544) -- 0:02:25
      142500 -- (-1300.255) (-1293.230) (-1299.257) [-1296.609] * (-1297.860) [-1298.093] (-1298.526) (-1298.548) -- 0:02:24
      143000 -- (-1298.858) [-1294.884] (-1300.354) (-1300.586) * (-1302.943) (-1297.437) (-1301.282) [-1297.765] -- 0:02:23
      143500 -- (-1301.415) [-1299.239] (-1298.270) (-1300.755) * (-1308.091) (-1295.943) [-1301.193] (-1293.966) -- 0:02:23
      144000 -- (-1301.327) (-1294.283) (-1300.721) [-1299.602] * (-1310.102) (-1296.474) [-1296.878] (-1297.097) -- 0:02:22
      144500 -- (-1298.982) (-1300.477) [-1299.011] (-1298.559) * (-1310.486) (-1294.387) (-1299.471) [-1296.394] -- 0:02:22
      145000 -- (-1302.006) (-1302.964) (-1296.764) [-1300.251] * [-1311.094] (-1302.931) (-1298.075) (-1298.372) -- 0:02:27

      Average standard deviation of split frequencies: 0.003229

      145500 -- (-1305.239) (-1297.770) [-1296.156] (-1307.269) * (-1304.270) [-1298.899] (-1295.703) (-1297.113) -- 0:02:26
      146000 -- (-1298.806) (-1296.396) [-1297.919] (-1303.225) * (-1306.510) (-1299.222) (-1295.752) [-1294.537] -- 0:02:26
      146500 -- (-1295.655) (-1299.575) [-1302.382] (-1299.595) * (-1309.549) [-1293.939] (-1295.130) (-1297.835) -- 0:02:25
      147000 -- [-1297.588] (-1295.772) (-1299.105) (-1296.430) * (-1306.732) [-1296.337] (-1298.468) (-1300.849) -- 0:02:25
      147500 -- (-1296.395) [-1302.658] (-1299.985) (-1302.860) * (-1312.303) [-1296.186] (-1294.402) (-1297.993) -- 0:02:24
      148000 -- (-1296.056) [-1296.034] (-1298.360) (-1303.748) * (-1306.689) (-1296.805) (-1301.157) [-1298.405] -- 0:02:23
      148500 -- [-1292.995] (-1296.100) (-1300.816) (-1299.339) * (-1302.427) (-1300.297) [-1297.658] (-1299.187) -- 0:02:23
      149000 -- (-1295.973) (-1293.840) [-1300.581] (-1299.992) * (-1312.796) (-1303.611) [-1299.410] (-1291.250) -- 0:02:22
      149500 -- (-1298.524) (-1297.530) (-1302.287) [-1299.897] * (-1297.549) (-1307.469) [-1296.830] (-1296.798) -- 0:02:22
      150000 -- (-1296.748) (-1296.692) (-1297.885) [-1293.239] * (-1294.838) (-1299.395) [-1297.111] (-1299.499) -- 0:02:21

      Average standard deviation of split frequencies: 0.003129

      150500 -- (-1298.908) [-1304.925] (-1298.462) (-1298.257) * (-1295.224) [-1298.335] (-1298.926) (-1302.770) -- 0:02:21
      151000 -- (-1297.433) (-1299.928) [-1294.719] (-1292.045) * (-1301.238) (-1310.493) (-1299.869) [-1292.337] -- 0:02:26
      151500 -- (-1304.649) (-1299.708) (-1305.348) [-1295.188] * (-1301.992) (-1304.113) [-1296.739] (-1296.636) -- 0:02:25
      152000 -- (-1299.316) (-1296.089) [-1302.240] (-1298.017) * (-1299.311) [-1298.074] (-1300.532) (-1296.795) -- 0:02:25
      152500 -- (-1302.788) (-1302.434) [-1304.024] (-1293.670) * [-1295.882] (-1302.364) (-1296.433) (-1302.353) -- 0:02:24
      153000 -- (-1300.812) (-1297.280) (-1301.827) [-1296.361] * (-1312.583) (-1302.166) [-1298.640] (-1297.338) -- 0:02:23
      153500 -- (-1306.126) [-1296.642] (-1297.023) (-1298.028) * [-1299.386] (-1301.512) (-1295.218) (-1299.040) -- 0:02:23
      154000 -- (-1296.387) (-1297.693) [-1300.792] (-1295.478) * (-1302.395) (-1298.672) (-1298.877) [-1299.752] -- 0:02:22
      154500 -- (-1304.339) [-1296.111] (-1297.423) (-1299.553) * (-1301.834) (-1303.849) [-1297.401] (-1295.738) -- 0:02:22
      155000 -- (-1302.922) [-1300.002] (-1298.769) (-1298.739) * [-1297.585] (-1300.172) (-1299.024) (-1297.173) -- 0:02:21

      Average standard deviation of split frequencies: 0.004533

      155500 -- (-1297.630) (-1299.603) (-1301.181) [-1300.397] * (-1301.607) (-1294.996) (-1295.385) [-1294.373] -- 0:02:21
      156000 -- [-1301.389] (-1295.331) (-1295.566) (-1301.556) * (-1299.966) [-1294.104] (-1295.133) (-1299.252) -- 0:02:20
      156500 -- [-1294.917] (-1295.720) (-1297.461) (-1298.313) * (-1306.086) (-1308.468) [-1300.676] (-1297.892) -- 0:02:25
      157000 -- [-1301.378] (-1296.500) (-1295.432) (-1296.255) * (-1301.521) (-1296.466) [-1298.687] (-1294.767) -- 0:02:24
      157500 -- (-1304.098) (-1295.512) [-1299.115] (-1299.282) * (-1298.938) (-1303.395) (-1297.935) [-1298.316] -- 0:02:24
      158000 -- (-1301.133) (-1299.511) (-1299.752) [-1296.670] * (-1302.984) (-1309.612) [-1296.949] (-1293.219) -- 0:02:23
      158500 -- (-1295.818) (-1298.888) [-1296.362] (-1297.092) * (-1296.533) [-1296.133] (-1305.552) (-1294.498) -- 0:02:23
      159000 -- (-1298.896) (-1307.936) (-1297.618) [-1293.240] * (-1296.111) (-1296.688) [-1297.247] (-1297.369) -- 0:02:22
      159500 -- (-1296.384) (-1299.238) (-1300.125) [-1296.776] * (-1295.893) (-1300.015) [-1297.944] (-1297.415) -- 0:02:22
      160000 -- (-1295.838) [-1302.187] (-1300.306) (-1298.217) * [-1299.809] (-1298.711) (-1303.468) (-1298.585) -- 0:02:21

      Average standard deviation of split frequencies: 0.004401

      160500 -- [-1295.122] (-1302.611) (-1299.801) (-1296.587) * (-1297.005) (-1297.900) (-1302.062) [-1296.903] -- 0:02:21
      161000 -- (-1300.967) (-1298.020) [-1300.085] (-1299.651) * (-1297.320) (-1299.976) (-1297.242) [-1295.288] -- 0:02:20
      161500 -- (-1301.492) (-1295.912) (-1297.342) [-1299.997] * (-1296.727) [-1299.866] (-1294.045) (-1295.575) -- 0:02:20
      162000 -- (-1295.811) (-1296.691) (-1301.344) [-1297.643] * (-1299.131) (-1300.399) (-1298.876) [-1297.945] -- 0:02:19
      162500 -- (-1295.004) (-1305.194) (-1301.529) [-1296.728] * [-1297.888] (-1302.067) (-1302.760) (-1302.782) -- 0:02:24
      163000 -- (-1298.763) (-1301.083) (-1303.828) [-1294.562] * [-1293.207] (-1294.015) (-1305.455) (-1299.783) -- 0:02:23
      163500 -- (-1293.560) (-1297.203) [-1307.137] (-1293.889) * (-1297.524) [-1295.942] (-1299.510) (-1297.815) -- 0:02:23
      164000 -- (-1293.477) [-1298.627] (-1308.588) (-1295.179) * (-1298.389) (-1295.224) [-1296.913] (-1299.033) -- 0:02:22
      164500 -- (-1299.450) (-1302.969) (-1302.346) [-1298.435] * (-1303.642) (-1298.343) (-1295.116) [-1295.025] -- 0:02:22
      165000 -- (-1301.273) (-1298.527) (-1309.083) [-1300.470] * [-1297.705] (-1297.273) (-1296.295) (-1300.789) -- 0:02:21

      Average standard deviation of split frequencies: 0.004260

      165500 -- (-1305.114) (-1299.389) (-1301.544) [-1299.131] * (-1293.809) (-1297.473) (-1298.313) [-1299.576] -- 0:02:21
      166000 -- (-1304.333) [-1297.113] (-1303.301) (-1302.080) * [-1302.358] (-1297.626) (-1296.090) (-1304.042) -- 0:02:20
      166500 -- [-1301.514] (-1298.534) (-1307.799) (-1297.874) * [-1298.693] (-1296.633) (-1302.807) (-1307.630) -- 0:02:20
      167000 -- (-1302.445) [-1298.570] (-1303.588) (-1298.213) * [-1293.586] (-1297.867) (-1296.153) (-1299.011) -- 0:02:19
      167500 -- (-1299.338) (-1309.116) (-1299.549) [-1294.586] * (-1299.262) [-1295.918] (-1299.336) (-1298.931) -- 0:02:19
      168000 -- (-1303.620) [-1301.702] (-1299.930) (-1295.047) * (-1298.002) (-1295.718) [-1305.725] (-1296.118) -- 0:02:18
      168500 -- (-1298.924) [-1297.098] (-1307.475) (-1302.952) * (-1302.254) [-1292.802] (-1298.992) (-1300.807) -- 0:02:23
      169000 -- [-1294.918] (-1301.215) (-1301.843) (-1301.289) * (-1305.911) [-1292.602] (-1309.086) (-1305.675) -- 0:02:22
      169500 -- (-1301.316) (-1301.263) [-1298.118] (-1295.500) * (-1297.290) [-1300.494] (-1307.314) (-1297.480) -- 0:02:22
      170000 -- (-1300.877) (-1294.411) (-1299.209) [-1295.216] * (-1298.007) (-1295.506) (-1295.001) [-1294.111] -- 0:02:21

      Average standard deviation of split frequencies: 0.004143

      170500 -- (-1294.852) [-1294.020] (-1302.682) (-1296.326) * (-1304.882) [-1294.258] (-1296.506) (-1298.551) -- 0:02:21
      171000 -- [-1303.253] (-1301.430) (-1302.816) (-1302.916) * (-1299.190) (-1300.472) [-1295.370] (-1297.323) -- 0:02:20
      171500 -- (-1307.603) [-1300.224] (-1303.635) (-1295.503) * (-1301.401) (-1302.357) [-1295.989] (-1301.578) -- 0:02:20
      172000 -- (-1294.348) (-1299.342) (-1296.789) [-1297.280] * (-1305.097) (-1295.389) [-1296.083] (-1293.367) -- 0:02:19
      172500 -- (-1300.999) (-1300.442) [-1302.031] (-1303.591) * (-1302.226) [-1294.239] (-1304.971) (-1296.596) -- 0:02:19
      173000 -- (-1294.790) (-1296.068) [-1299.931] (-1300.856) * (-1296.508) (-1294.305) (-1300.297) [-1296.664] -- 0:02:18
      173500 -- (-1299.610) (-1296.866) (-1300.008) [-1303.801] * (-1299.212) (-1293.992) [-1304.123] (-1305.067) -- 0:02:18
      174000 -- (-1307.590) [-1299.477] (-1300.712) (-1295.855) * (-1299.300) (-1302.224) (-1297.313) [-1295.241] -- 0:02:22
      174500 -- (-1299.310) (-1300.382) [-1297.898] (-1299.630) * (-1295.188) [-1299.726] (-1305.475) (-1299.961) -- 0:02:21
      175000 -- (-1300.923) [-1294.413] (-1299.865) (-1295.964) * (-1301.423) (-1299.448) (-1305.344) [-1297.602] -- 0:02:21

      Average standard deviation of split frequencies: 0.004018

      175500 -- (-1297.747) (-1293.391) [-1301.378] (-1301.597) * (-1301.436) (-1293.358) [-1299.309] (-1301.867) -- 0:02:20
      176000 -- (-1308.241) (-1296.601) [-1301.014] (-1298.521) * (-1304.889) (-1297.209) [-1300.116] (-1300.298) -- 0:02:20
      176500 -- (-1299.690) (-1294.145) [-1299.169] (-1298.956) * [-1302.572] (-1302.225) (-1300.303) (-1300.318) -- 0:02:19
      177000 -- (-1297.020) (-1298.396) [-1301.813] (-1299.670) * [-1302.364] (-1301.440) (-1307.354) (-1300.066) -- 0:02:19
      177500 -- (-1302.358) (-1300.351) [-1297.975] (-1303.572) * (-1295.523) (-1293.612) [-1293.955] (-1296.685) -- 0:02:19
      178000 -- [-1298.440] (-1298.356) (-1298.890) (-1294.652) * (-1296.365) (-1298.767) (-1300.969) [-1301.311] -- 0:02:18
      178500 -- (-1307.068) [-1294.870] (-1296.917) (-1297.914) * [-1292.792] (-1300.965) (-1297.957) (-1299.158) -- 0:02:18
      179000 -- (-1297.396) [-1298.640] (-1301.874) (-1296.316) * (-1296.240) (-1303.705) (-1295.695) [-1293.264] -- 0:02:17
      179500 -- (-1301.788) [-1294.938] (-1309.277) (-1296.264) * [-1295.289] (-1300.886) (-1297.268) (-1300.170) -- 0:02:17
      180000 -- (-1302.840) (-1294.717) (-1299.362) [-1297.952] * (-1299.892) (-1295.100) (-1299.865) [-1297.136] -- 0:02:21

      Average standard deviation of split frequencies: 0.003914

      180500 -- (-1302.977) (-1296.101) [-1302.469] (-1299.006) * (-1300.205) (-1302.937) [-1296.361] (-1298.075) -- 0:02:20
      181000 -- (-1300.477) (-1297.530) (-1300.410) [-1295.823] * [-1296.239] (-1299.846) (-1298.585) (-1299.684) -- 0:02:20
      181500 -- (-1304.125) (-1298.228) [-1296.888] (-1300.055) * (-1307.953) [-1300.724] (-1296.873) (-1295.023) -- 0:02:19
      182000 -- (-1301.877) (-1299.396) (-1297.242) [-1300.509] * [-1302.262] (-1300.587) (-1297.453) (-1297.034) -- 0:02:19
      182500 -- (-1302.706) (-1297.045) (-1295.312) [-1295.998] * (-1297.108) [-1297.296] (-1300.802) (-1295.101) -- 0:02:18
      183000 -- (-1309.406) [-1302.839] (-1299.201) (-1298.056) * [-1303.884] (-1298.344) (-1297.030) (-1300.343) -- 0:02:18
      183500 -- (-1299.063) [-1299.037] (-1299.568) (-1294.126) * (-1294.060) (-1303.909) (-1301.152) [-1295.323] -- 0:02:17
      184000 -- [-1301.936] (-1304.952) (-1301.208) (-1296.981) * (-1300.521) (-1303.195) [-1296.825] (-1300.104) -- 0:02:17
      184500 -- (-1296.266) (-1295.289) [-1299.367] (-1305.461) * (-1300.776) (-1298.224) (-1300.290) [-1296.241] -- 0:02:17
      185000 -- (-1297.525) (-1296.700) [-1298.127] (-1293.890) * (-1300.355) (-1300.612) (-1296.488) [-1294.966] -- 0:02:16

      Average standard deviation of split frequencies: 0.003802

      185500 -- (-1299.537) (-1302.308) (-1298.052) [-1294.621] * (-1303.396) (-1301.146) [-1299.438] (-1297.657) -- 0:02:20
      186000 -- (-1304.842) (-1301.593) (-1298.821) [-1297.805] * (-1299.339) (-1299.108) (-1293.274) [-1296.312] -- 0:02:20
      186500 -- (-1301.126) (-1295.546) (-1299.274) [-1297.357] * (-1299.655) (-1300.635) [-1295.939] (-1298.238) -- 0:02:19
      187000 -- (-1299.635) (-1293.633) [-1296.074] (-1296.341) * (-1295.243) (-1313.571) [-1297.627] (-1298.111) -- 0:02:19
      187500 -- [-1300.587] (-1301.186) (-1296.421) (-1295.030) * (-1296.695) [-1294.639] (-1298.671) (-1293.323) -- 0:02:18
      188000 -- (-1298.120) (-1299.574) (-1306.261) [-1294.342] * (-1301.214) (-1299.016) (-1300.779) [-1303.114] -- 0:02:18
      188500 -- (-1296.649) (-1298.755) (-1295.516) [-1297.285] * (-1302.448) (-1301.191) (-1299.776) [-1302.552] -- 0:02:17
      189000 -- (-1300.479) [-1302.318] (-1296.656) (-1298.175) * (-1299.080) [-1298.498] (-1299.921) (-1302.208) -- 0:02:17
      189500 -- (-1295.560) (-1295.669) [-1295.810] (-1300.219) * (-1301.148) (-1301.440) [-1297.715] (-1298.096) -- 0:02:16
      190000 -- [-1301.042] (-1297.090) (-1304.875) (-1296.149) * (-1298.310) [-1297.602] (-1294.285) (-1303.397) -- 0:02:16

      Average standard deviation of split frequencies: 0.003709

      190500 -- (-1295.611) (-1298.109) [-1301.637] (-1297.307) * (-1296.920) (-1295.885) [-1296.934] (-1296.192) -- 0:02:15
      191000 -- (-1295.961) [-1298.222] (-1302.587) (-1294.333) * [-1297.430] (-1301.533) (-1293.188) (-1300.753) -- 0:02:15
      191500 -- [-1298.849] (-1294.510) (-1300.385) (-1297.802) * [-1301.763] (-1302.264) (-1302.923) (-1303.115) -- 0:02:19
      192000 -- (-1294.575) (-1295.117) (-1301.986) [-1296.902] * (-1303.950) (-1301.066) (-1299.331) [-1297.502] -- 0:02:18
      192500 -- [-1298.436] (-1299.993) (-1301.178) (-1303.314) * (-1300.823) (-1303.785) [-1296.823] (-1293.999) -- 0:02:18
      193000 -- (-1299.715) (-1296.472) (-1296.607) [-1299.271] * (-1299.518) (-1300.855) (-1294.886) [-1294.800] -- 0:02:17
      193500 -- (-1307.430) (-1293.312) (-1294.415) [-1304.267] * (-1298.906) (-1298.432) (-1302.117) [-1299.117] -- 0:02:17
      194000 -- (-1301.549) (-1298.974) [-1297.026] (-1297.298) * (-1297.964) (-1299.722) (-1300.475) [-1300.688] -- 0:02:17
      194500 -- (-1298.165) (-1299.665) (-1295.034) [-1294.961] * [-1294.577] (-1293.167) (-1293.045) (-1296.720) -- 0:02:16
      195000 -- (-1295.008) (-1297.084) (-1297.670) [-1297.838] * (-1300.410) [-1290.924] (-1301.909) (-1294.950) -- 0:02:16

      Average standard deviation of split frequencies: 0.003608

      195500 -- [-1295.569] (-1298.350) (-1299.962) (-1299.875) * (-1301.700) [-1299.313] (-1294.230) (-1293.559) -- 0:02:15
      196000 -- (-1302.027) (-1296.977) (-1301.232) [-1298.627] * (-1294.540) (-1297.141) [-1297.288] (-1298.895) -- 0:02:15
      196500 -- (-1298.891) (-1295.734) (-1304.323) [-1299.409] * (-1303.784) (-1299.346) (-1292.035) [-1295.747] -- 0:02:14
      197000 -- (-1300.784) [-1298.538] (-1297.977) (-1299.600) * (-1301.954) [-1294.173] (-1295.152) (-1296.173) -- 0:02:14
      197500 -- [-1298.014] (-1302.289) (-1298.374) (-1304.324) * (-1303.730) [-1297.048] (-1295.226) (-1298.766) -- 0:02:18
      198000 -- [-1295.382] (-1299.608) (-1293.955) (-1306.072) * [-1302.945] (-1299.446) (-1298.753) (-1300.238) -- 0:02:17
      198500 -- (-1297.042) (-1299.473) [-1291.958] (-1303.133) * (-1308.366) [-1298.843] (-1298.346) (-1300.799) -- 0:02:17
      199000 -- (-1302.573) (-1298.791) (-1299.553) [-1294.691] * [-1303.164] (-1301.040) (-1296.619) (-1303.792) -- 0:02:16
      199500 -- (-1298.226) (-1298.443) (-1302.093) [-1296.830] * (-1298.250) [-1297.299] (-1302.301) (-1307.942) -- 0:02:16
      200000 -- (-1301.946) (-1294.491) (-1297.859) [-1298.083] * [-1300.242] (-1297.706) (-1302.471) (-1299.674) -- 0:02:16

      Average standard deviation of split frequencies: 0.003524

      200500 -- (-1303.032) [-1295.728] (-1296.455) (-1298.942) * (-1300.934) (-1296.133) [-1296.471] (-1302.045) -- 0:02:15
      201000 -- (-1303.894) [-1292.852] (-1297.648) (-1304.228) * (-1295.489) [-1296.936] (-1301.009) (-1299.230) -- 0:02:15
      201500 -- (-1300.593) (-1299.010) [-1296.281] (-1295.188) * [-1303.567] (-1306.505) (-1299.437) (-1307.643) -- 0:02:14
      202000 -- (-1301.268) (-1300.619) (-1295.944) [-1296.986] * (-1299.593) (-1299.326) [-1294.185] (-1301.367) -- 0:02:14
      202500 -- (-1299.702) (-1299.838) (-1299.254) [-1301.090] * (-1293.140) [-1298.769] (-1304.749) (-1299.404) -- 0:02:13
      203000 -- (-1297.465) [-1299.293] (-1295.166) (-1294.752) * (-1295.395) [-1298.795] (-1307.769) (-1300.103) -- 0:02:17
      203500 -- [-1300.894] (-1299.715) (-1297.289) (-1291.567) * [-1295.881] (-1301.995) (-1302.064) (-1306.790) -- 0:02:16
      204000 -- (-1299.873) (-1300.860) (-1296.526) [-1298.416] * (-1296.903) (-1296.392) [-1301.442] (-1312.501) -- 0:02:16
      204500 -- (-1302.704) [-1293.873] (-1295.156) (-1302.048) * (-1299.152) [-1297.430] (-1300.931) (-1307.327) -- 0:02:16
      205000 -- (-1298.129) (-1293.894) (-1299.815) [-1297.323] * (-1302.168) (-1300.992) (-1297.996) [-1301.611] -- 0:02:15

      Average standard deviation of split frequencies: 0.003433

      205500 -- (-1302.880) [-1296.930] (-1297.797) (-1301.241) * (-1300.040) [-1300.175] (-1293.353) (-1308.956) -- 0:02:15
      206000 -- (-1299.599) (-1301.588) [-1293.431] (-1304.392) * (-1292.979) (-1299.859) [-1295.707] (-1300.251) -- 0:02:14
      206500 -- (-1295.172) (-1299.432) (-1295.239) [-1299.208] * [-1296.964] (-1297.808) (-1304.999) (-1296.575) -- 0:02:14
      207000 -- (-1293.552) [-1299.325] (-1298.255) (-1296.727) * (-1299.071) [-1295.923] (-1310.284) (-1299.686) -- 0:02:14
      207500 -- (-1297.395) (-1294.777) (-1296.806) [-1295.533] * [-1299.511] (-1297.876) (-1300.713) (-1296.537) -- 0:02:13
      208000 -- [-1296.627] (-1295.100) (-1298.777) (-1301.049) * [-1301.716] (-1296.577) (-1297.606) (-1297.171) -- 0:02:13
      208500 -- (-1295.265) (-1299.077) (-1293.009) [-1297.991] * (-1302.953) [-1297.670] (-1303.453) (-1299.723) -- 0:02:12
      209000 -- [-1297.324] (-1298.411) (-1298.539) (-1297.715) * (-1296.118) [-1295.734] (-1297.464) (-1298.860) -- 0:02:16
      209500 -- (-1296.248) [-1294.884] (-1294.892) (-1308.979) * (-1303.125) [-1294.485] (-1304.327) (-1294.915) -- 0:02:15
      210000 -- [-1296.877] (-1298.003) (-1295.183) (-1299.055) * [-1308.291] (-1294.956) (-1296.753) (-1296.577) -- 0:02:15

      Average standard deviation of split frequencies: 0.003357

      210500 -- [-1294.197] (-1297.662) (-1298.703) (-1301.640) * (-1309.356) [-1297.071] (-1301.453) (-1308.083) -- 0:02:15
      211000 -- (-1294.683) [-1298.027] (-1295.028) (-1296.832) * (-1307.966) (-1302.538) [-1297.013] (-1296.177) -- 0:02:14
      211500 -- (-1300.398) (-1306.696) (-1292.492) [-1302.027] * (-1299.464) (-1303.024) [-1293.283] (-1297.715) -- 0:02:14
      212000 -- [-1295.437] (-1299.749) (-1294.829) (-1301.252) * (-1299.360) (-1297.100) [-1297.213] (-1298.241) -- 0:02:13
      212500 -- [-1295.734] (-1297.479) (-1305.168) (-1296.951) * [-1300.774] (-1297.385) (-1299.877) (-1299.234) -- 0:02:13
      213000 -- (-1299.489) (-1303.420) (-1304.939) [-1295.508] * (-1304.697) (-1305.070) (-1296.332) [-1292.984] -- 0:02:13
      213500 -- [-1292.189] (-1298.108) (-1312.559) (-1296.925) * (-1307.809) [-1297.247] (-1299.012) (-1295.149) -- 0:02:12
      214000 -- (-1301.156) [-1300.030] (-1307.258) (-1300.029) * (-1295.117) [-1299.173] (-1300.042) (-1297.865) -- 0:02:12
      214500 -- (-1297.865) [-1299.898] (-1301.953) (-1303.730) * (-1295.133) [-1295.172] (-1305.360) (-1296.866) -- 0:02:15
      215000 -- [-1309.470] (-1297.648) (-1301.587) (-1299.600) * [-1298.523] (-1298.317) (-1309.701) (-1301.963) -- 0:02:15

      Average standard deviation of split frequencies: 0.004365

      215500 -- (-1298.064) (-1314.544) [-1296.361] (-1302.667) * (-1296.505) [-1295.568] (-1298.959) (-1298.421) -- 0:02:14
      216000 -- [-1299.572] (-1302.329) (-1298.855) (-1304.551) * (-1297.959) (-1297.551) [-1304.068] (-1295.024) -- 0:02:14
      216500 -- [-1297.170] (-1308.244) (-1303.299) (-1302.867) * (-1308.462) (-1296.896) (-1307.015) [-1294.353] -- 0:02:13
      217000 -- (-1297.258) (-1297.117) (-1304.749) [-1294.824] * (-1297.315) (-1303.743) [-1304.191] (-1296.192) -- 0:02:13
      217500 -- [-1296.707] (-1295.594) (-1298.022) (-1298.561) * [-1301.094] (-1307.396) (-1295.254) (-1299.687) -- 0:02:13
      218000 -- (-1296.872) [-1293.259] (-1308.857) (-1300.631) * (-1301.238) [-1305.965] (-1300.177) (-1299.681) -- 0:02:12
      218500 -- (-1302.049) (-1304.561) (-1309.016) [-1299.839] * (-1300.151) (-1302.469) [-1300.031] (-1301.990) -- 0:02:12
      219000 -- (-1303.363) [-1291.613] (-1305.831) (-1300.178) * [-1297.001] (-1301.640) (-1297.990) (-1304.159) -- 0:02:11
      219500 -- (-1299.271) [-1297.064] (-1299.951) (-1311.131) * (-1294.686) [-1299.405] (-1298.098) (-1303.682) -- 0:02:11
      220000 -- (-1303.878) (-1301.214) [-1299.623] (-1299.304) * [-1297.252] (-1304.592) (-1295.918) (-1302.820) -- 0:02:11

      Average standard deviation of split frequencies: 0.004273

      220500 -- [-1302.701] (-1299.995) (-1305.558) (-1299.776) * [-1299.146] (-1298.712) (-1296.172) (-1299.343) -- 0:02:14
      221000 -- (-1301.175) [-1298.900] (-1301.619) (-1303.106) * (-1306.045) (-1298.817) (-1299.503) [-1298.550] -- 0:02:13
      221500 -- (-1303.377) [-1301.683] (-1297.627) (-1301.498) * [-1295.640] (-1297.842) (-1300.358) (-1295.396) -- 0:02:13
      222000 -- [-1298.288] (-1299.947) (-1296.603) (-1297.167) * (-1299.097) (-1299.252) (-1305.827) [-1297.219] -- 0:02:13
      222500 -- [-1300.933] (-1300.874) (-1298.401) (-1296.781) * (-1299.303) (-1296.464) (-1297.311) [-1297.342] -- 0:02:12
      223000 -- [-1300.447] (-1300.099) (-1297.273) (-1305.509) * (-1302.193) (-1299.406) [-1294.175] (-1300.752) -- 0:02:12
      223500 -- (-1301.576) (-1299.641) [-1293.683] (-1303.349) * (-1300.746) (-1297.031) (-1297.642) [-1300.705] -- 0:02:12
      224000 -- (-1299.740) (-1299.508) [-1297.722] (-1304.869) * (-1299.360) [-1295.855] (-1298.759) (-1303.111) -- 0:02:11
      224500 -- (-1301.980) [-1300.070] (-1299.891) (-1302.668) * (-1299.675) [-1294.901] (-1296.899) (-1301.365) -- 0:02:11
      225000 -- (-1299.036) [-1301.205] (-1296.647) (-1305.521) * (-1306.271) (-1297.083) (-1301.830) [-1296.752] -- 0:02:10

      Average standard deviation of split frequencies: 0.004172

      225500 -- (-1300.357) [-1301.053] (-1300.900) (-1305.324) * (-1305.385) (-1296.725) (-1300.153) [-1299.968] -- 0:02:10
      226000 -- (-1297.523) [-1297.375] (-1298.501) (-1302.800) * (-1301.670) (-1300.595) (-1294.426) [-1299.681] -- 0:02:10
      226500 -- (-1296.850) (-1298.732) [-1298.835] (-1303.096) * (-1298.607) (-1299.659) [-1293.096] (-1298.755) -- 0:02:13
      227000 -- [-1296.683] (-1302.422) (-1298.454) (-1300.794) * [-1300.935] (-1296.096) (-1302.153) (-1295.968) -- 0:02:12
      227500 -- [-1301.407] (-1300.046) (-1299.643) (-1299.710) * (-1299.290) [-1297.197] (-1299.802) (-1298.246) -- 0:02:12
      228000 -- (-1299.337) (-1300.047) (-1299.126) [-1299.683] * [-1301.613] (-1295.985) (-1298.080) (-1301.840) -- 0:02:12
      228500 -- (-1296.281) (-1305.492) [-1306.152] (-1302.991) * (-1295.563) (-1294.062) (-1306.209) [-1296.103] -- 0:02:11
      229000 -- (-1294.938) (-1297.727) (-1300.728) [-1301.155] * (-1301.485) (-1295.403) (-1299.127) [-1304.202] -- 0:02:11
      229500 -- (-1305.114) (-1301.183) (-1299.781) [-1296.183] * (-1295.473) (-1298.223) [-1305.577] (-1297.371) -- 0:02:10
      230000 -- [-1297.669] (-1297.883) (-1301.039) (-1299.591) * [-1297.774] (-1293.677) (-1301.505) (-1303.175) -- 0:02:10

      Average standard deviation of split frequencies: 0.005109

      230500 -- [-1299.659] (-1300.053) (-1310.578) (-1299.965) * (-1299.110) (-1302.167) (-1301.801) [-1296.905] -- 0:02:10
      231000 -- (-1299.316) (-1295.724) [-1296.957] (-1306.322) * [-1298.547] (-1298.264) (-1297.737) (-1297.753) -- 0:02:09
      231500 -- (-1311.587) [-1295.906] (-1299.844) (-1299.771) * (-1296.648) (-1307.257) [-1297.410] (-1295.148) -- 0:02:09
      232000 -- [-1297.371] (-1298.806) (-1298.697) (-1306.978) * (-1298.295) (-1309.072) [-1301.566] (-1297.515) -- 0:02:12
      232500 -- (-1301.747) [-1295.770] (-1304.366) (-1297.015) * [-1298.098] (-1300.653) (-1305.553) (-1295.900) -- 0:02:12
      233000 -- (-1303.931) [-1300.129] (-1307.526) (-1299.020) * [-1302.614] (-1299.861) (-1302.853) (-1303.651) -- 0:02:11
      233500 -- (-1297.385) [-1297.390] (-1301.015) (-1303.900) * (-1300.279) (-1296.890) [-1297.207] (-1299.977) -- 0:02:11
      234000 -- (-1298.540) [-1298.160] (-1308.008) (-1297.225) * [-1294.351] (-1299.496) (-1299.855) (-1298.498) -- 0:02:10
      234500 -- [-1299.328] (-1295.654) (-1303.339) (-1302.185) * (-1296.128) (-1300.325) (-1294.256) [-1294.147] -- 0:02:10
      235000 -- (-1300.455) (-1297.797) (-1299.086) [-1297.671] * (-1293.986) [-1295.884] (-1293.386) (-1301.632) -- 0:02:10

      Average standard deviation of split frequencies: 0.004994

      235500 -- (-1297.921) [-1300.958] (-1295.498) (-1298.697) * (-1294.866) (-1298.471) [-1293.287] (-1298.575) -- 0:02:09
      236000 -- (-1296.299) (-1294.490) [-1296.400] (-1295.590) * (-1297.456) (-1296.291) [-1296.624] (-1300.690) -- 0:02:09
      236500 -- (-1294.977) (-1298.075) (-1296.378) [-1298.093] * (-1292.559) [-1299.820] (-1297.545) (-1301.428) -- 0:02:09
      237000 -- [-1305.657] (-1294.178) (-1303.974) (-1296.276) * (-1303.379) [-1294.996] (-1300.830) (-1298.711) -- 0:02:08
      237500 -- (-1294.999) (-1296.199) (-1299.705) [-1298.281] * (-1298.656) (-1295.810) (-1300.385) [-1299.624] -- 0:02:08
      238000 -- (-1296.973) [-1294.778] (-1298.484) (-1298.461) * [-1299.895] (-1296.181) (-1296.218) (-1301.356) -- 0:02:11
      238500 -- (-1302.587) [-1300.777] (-1304.149) (-1296.247) * [-1298.234] (-1293.515) (-1297.623) (-1297.787) -- 0:02:10
      239000 -- (-1295.667) (-1296.584) (-1299.466) [-1303.146] * (-1303.460) (-1297.940) [-1297.222] (-1296.450) -- 0:02:10
      239500 -- (-1296.600) [-1300.920] (-1300.493) (-1294.158) * (-1315.206) (-1293.322) (-1294.408) [-1295.629] -- 0:02:10
      240000 -- (-1296.319) (-1297.452) (-1299.390) [-1293.377] * (-1298.996) [-1299.874] (-1300.709) (-1298.973) -- 0:02:09

      Average standard deviation of split frequencies: 0.004897

      240500 -- (-1302.325) (-1298.072) [-1299.155] (-1298.611) * [-1298.090] (-1298.415) (-1300.990) (-1297.944) -- 0:02:09
      241000 -- [-1295.111] (-1298.050) (-1298.502) (-1301.156) * (-1305.960) (-1300.562) [-1295.330] (-1306.094) -- 0:02:09
      241500 -- (-1299.088) (-1297.599) (-1295.817) [-1296.431] * (-1297.978) (-1305.228) (-1300.818) [-1299.700] -- 0:02:08
      242000 -- (-1298.768) [-1300.265] (-1297.358) (-1298.608) * (-1303.464) (-1302.442) [-1295.661] (-1302.051) -- 0:02:08
      242500 -- (-1297.445) (-1295.890) (-1297.576) [-1298.236] * (-1307.188) [-1296.914] (-1297.073) (-1297.382) -- 0:02:08
      243000 -- (-1296.897) (-1298.483) [-1297.082] (-1302.963) * (-1301.953) (-1302.826) (-1298.518) [-1296.676] -- 0:02:10
      243500 -- (-1297.567) (-1298.296) (-1300.726) [-1290.370] * (-1300.722) (-1304.332) (-1309.577) [-1302.170] -- 0:02:10
      244000 -- (-1299.734) (-1301.790) [-1295.360] (-1300.480) * (-1299.288) (-1297.770) [-1298.571] (-1292.948) -- 0:02:10
      244500 -- (-1307.409) (-1299.828) [-1293.876] (-1302.350) * (-1297.400) (-1297.436) [-1296.948] (-1301.452) -- 0:02:09
      245000 -- (-1299.599) (-1296.150) [-1300.807] (-1300.526) * (-1299.360) [-1293.297] (-1301.017) (-1297.061) -- 0:02:09

      Average standard deviation of split frequencies: 0.004791

      245500 -- [-1299.684] (-1304.985) (-1298.375) (-1299.513) * (-1299.696) (-1303.071) (-1296.352) [-1296.009] -- 0:02:09
      246000 -- (-1299.542) (-1301.360) (-1296.000) [-1293.726] * (-1301.379) [-1298.070] (-1300.209) (-1303.338) -- 0:02:08
      246500 -- (-1295.852) (-1298.017) (-1298.526) [-1295.173] * (-1306.705) (-1298.784) [-1296.251] (-1295.540) -- 0:02:08
      247000 -- (-1301.184) (-1298.207) [-1301.656] (-1298.909) * (-1297.418) [-1296.832] (-1300.659) (-1297.099) -- 0:02:08
      247500 -- (-1303.581) [-1301.090] (-1301.095) (-1298.933) * [-1296.013] (-1299.685) (-1307.174) (-1299.298) -- 0:02:07
      248000 -- (-1298.750) (-1304.834) [-1299.234] (-1301.337) * (-1304.780) (-1296.497) (-1300.712) [-1301.272] -- 0:02:07
      248500 -- (-1300.857) (-1304.161) (-1295.941) [-1304.283] * (-1294.603) [-1298.083] (-1293.753) (-1299.450) -- 0:02:10
      249000 -- [-1301.597] (-1304.895) (-1299.216) (-1298.928) * (-1297.519) [-1302.549] (-1299.478) (-1297.014) -- 0:02:09
      249500 -- (-1300.210) (-1298.008) (-1301.104) [-1293.585] * [-1302.396] (-1296.985) (-1299.070) (-1293.063) -- 0:02:09
      250000 -- [-1299.901] (-1302.215) (-1300.831) (-1310.315) * [-1294.982] (-1305.442) (-1301.910) (-1299.827) -- 0:02:09

      Average standard deviation of split frequencies: 0.004702

      250500 -- (-1294.991) (-1294.642) (-1298.010) [-1300.554] * [-1300.533] (-1291.617) (-1296.636) (-1293.618) -- 0:02:08
      251000 -- [-1301.633] (-1298.870) (-1298.478) (-1307.692) * (-1303.882) (-1295.865) [-1304.845] (-1303.427) -- 0:02:08
      251500 -- (-1300.461) (-1301.549) (-1299.782) [-1304.056] * [-1307.693] (-1300.814) (-1301.898) (-1303.053) -- 0:02:07
      252000 -- (-1303.712) [-1301.953] (-1295.695) (-1304.768) * (-1300.394) [-1297.174] (-1293.833) (-1307.417) -- 0:02:07
      252500 -- (-1300.705) [-1296.047] (-1293.596) (-1301.148) * (-1301.588) (-1299.270) [-1299.091] (-1303.331) -- 0:02:07
      253000 -- (-1301.747) [-1296.596] (-1295.350) (-1299.972) * (-1300.518) (-1299.003) (-1302.394) [-1296.612] -- 0:02:06
      253500 -- (-1300.540) (-1307.349) (-1299.721) [-1301.829] * (-1298.781) (-1298.862) [-1296.733] (-1302.223) -- 0:02:06
      254000 -- (-1296.447) [-1297.235] (-1299.961) (-1296.793) * [-1299.446] (-1299.913) (-1296.035) (-1297.000) -- 0:02:06
      254500 -- (-1294.261) [-1297.429] (-1296.708) (-1309.286) * (-1306.755) (-1296.293) (-1301.001) [-1295.409] -- 0:02:08
      255000 -- (-1295.407) [-1296.409] (-1293.066) (-1299.603) * (-1306.457) (-1300.045) [-1296.834] (-1296.826) -- 0:02:08

      Average standard deviation of split frequencies: 0.004604

      255500 -- [-1297.247] (-1294.145) (-1300.125) (-1305.767) * (-1303.601) (-1297.218) (-1309.471) [-1300.380] -- 0:02:08
      256000 -- (-1295.570) (-1292.776) (-1293.687) [-1302.106] * [-1302.101] (-1300.852) (-1303.217) (-1296.400) -- 0:02:07
      256500 -- (-1299.193) (-1299.330) (-1299.320) [-1295.498] * (-1305.254) (-1300.726) [-1298.111] (-1301.097) -- 0:02:07
      257000 -- (-1299.224) (-1302.466) [-1294.518] (-1298.147) * (-1302.965) (-1300.342) (-1305.032) [-1293.116] -- 0:02:07
      257500 -- (-1298.534) (-1298.512) [-1297.861] (-1299.465) * [-1300.120] (-1296.842) (-1298.203) (-1305.437) -- 0:02:06
      258000 -- [-1294.243] (-1297.730) (-1297.877) (-1297.884) * (-1297.364) [-1298.594] (-1298.414) (-1298.353) -- 0:02:06
      258500 -- (-1302.358) (-1296.915) (-1296.916) [-1301.718] * (-1297.092) [-1297.164] (-1299.776) (-1299.427) -- 0:02:06
      259000 -- [-1298.285] (-1297.743) (-1300.773) (-1295.935) * [-1297.624] (-1302.927) (-1301.306) (-1301.292) -- 0:02:05
      259500 -- [-1294.260] (-1294.130) (-1301.693) (-1293.665) * (-1300.302) (-1302.445) [-1296.314] (-1301.578) -- 0:02:05
      260000 -- (-1295.288) [-1296.340] (-1300.687) (-1299.271) * (-1300.485) (-1299.082) [-1300.186] (-1300.342) -- 0:02:08

      Average standard deviation of split frequencies: 0.004521

      260500 -- [-1295.719] (-1296.499) (-1301.257) (-1298.025) * (-1299.946) [-1301.085] (-1296.847) (-1297.204) -- 0:02:07
      261000 -- (-1297.341) [-1299.004] (-1304.904) (-1306.878) * [-1298.032] (-1300.345) (-1301.875) (-1304.505) -- 0:02:07
      261500 -- (-1297.902) (-1296.434) [-1300.663] (-1300.582) * (-1300.477) (-1300.001) [-1298.648] (-1302.129) -- 0:02:07
      262000 -- (-1301.799) (-1295.045) [-1292.283] (-1296.146) * (-1293.859) [-1296.781] (-1297.194) (-1301.031) -- 0:02:06
      262500 -- (-1297.796) (-1298.829) [-1297.491] (-1297.981) * (-1302.318) [-1296.107] (-1311.115) (-1298.398) -- 0:02:06
      263000 -- (-1297.852) [-1298.537] (-1297.526) (-1300.716) * (-1294.453) [-1297.277] (-1303.361) (-1299.268) -- 0:02:06
      263500 -- [-1301.432] (-1298.942) (-1297.243) (-1294.188) * (-1299.220) (-1301.067) (-1299.846) [-1302.364] -- 0:02:05
      264000 -- (-1300.441) (-1303.842) (-1298.832) [-1297.250] * (-1295.733) [-1298.854] (-1302.823) (-1301.477) -- 0:02:05
      264500 -- [-1301.041] (-1295.057) (-1293.354) (-1297.091) * (-1295.821) (-1303.226) (-1296.172) [-1293.775] -- 0:02:05
      265000 -- (-1298.424) (-1304.335) (-1304.734) [-1298.801] * (-1294.873) (-1300.879) (-1293.638) [-1292.278] -- 0:02:07

      Average standard deviation of split frequencies: 0.004430

      265500 -- (-1299.022) (-1306.177) [-1301.644] (-1296.768) * (-1296.764) (-1299.640) (-1296.482) [-1297.269] -- 0:02:07
      266000 -- (-1301.567) (-1300.509) [-1293.525] (-1298.155) * (-1297.423) (-1314.334) (-1297.466) [-1297.309] -- 0:02:06
      266500 -- (-1295.865) (-1303.427) (-1296.641) [-1298.955] * (-1305.895) (-1300.408) [-1301.880] (-1302.118) -- 0:02:06
      267000 -- (-1295.850) (-1300.273) (-1302.927) [-1296.071] * (-1306.905) [-1298.754] (-1296.873) (-1295.990) -- 0:02:06
      267500 -- [-1297.723] (-1302.622) (-1297.271) (-1301.396) * (-1301.895) (-1299.711) (-1297.609) [-1301.126] -- 0:02:05
      268000 -- (-1298.814) (-1301.436) (-1295.300) [-1302.598] * [-1298.400] (-1305.732) (-1300.748) (-1298.348) -- 0:02:05
      268500 -- (-1307.215) (-1308.293) (-1296.064) [-1298.344] * (-1301.029) [-1296.143] (-1302.736) (-1303.520) -- 0:02:05
      269000 -- (-1304.598) (-1300.773) [-1305.168] (-1300.221) * [-1299.612] (-1297.451) (-1303.523) (-1301.799) -- 0:02:05
      269500 -- (-1305.439) (-1299.194) (-1305.170) [-1297.239] * [-1301.875] (-1296.324) (-1299.211) (-1298.124) -- 0:02:04
      270000 -- (-1295.659) [-1301.551] (-1305.590) (-1296.443) * (-1297.818) (-1299.911) [-1299.978] (-1305.863) -- 0:02:04

      Average standard deviation of split frequencies: 0.004354

      270500 -- [-1297.464] (-1298.255) (-1301.516) (-1295.748) * (-1296.444) (-1297.000) [-1294.087] (-1300.640) -- 0:02:04
      271000 -- [-1297.024] (-1299.665) (-1300.907) (-1295.884) * [-1303.416] (-1298.872) (-1299.875) (-1300.335) -- 0:02:06
      271500 -- (-1296.243) (-1303.997) (-1303.085) [-1303.533] * (-1299.049) (-1293.650) (-1297.865) [-1301.511] -- 0:02:06
      272000 -- (-1294.168) (-1298.314) [-1297.631] (-1303.899) * (-1299.141) (-1296.420) [-1293.228] (-1299.331) -- 0:02:05
      272500 -- (-1294.307) (-1300.946) [-1300.109] (-1298.376) * (-1305.799) (-1297.217) [-1298.981] (-1305.259) -- 0:02:05
      273000 -- (-1298.397) (-1301.201) (-1303.067) [-1301.037] * [-1306.998] (-1293.512) (-1301.683) (-1299.800) -- 0:02:05
      273500 -- (-1298.968) [-1297.020] (-1304.882) (-1296.949) * (-1303.862) (-1297.113) (-1296.907) [-1298.287] -- 0:02:04
      274000 -- [-1298.340] (-1300.167) (-1300.751) (-1295.393) * [-1306.340] (-1296.122) (-1297.271) (-1303.986) -- 0:02:04
      274500 -- (-1307.754) [-1294.884] (-1299.433) (-1296.679) * (-1301.542) (-1300.912) (-1296.269) [-1296.339] -- 0:02:04
      275000 -- (-1301.362) [-1297.773] (-1297.174) (-1296.231) * [-1299.290] (-1298.555) (-1298.428) (-1301.365) -- 0:02:03

      Average standard deviation of split frequencies: 0.004270

      275500 -- (-1317.628) [-1294.520] (-1299.425) (-1298.129) * (-1305.449) (-1297.833) (-1300.867) [-1293.076] -- 0:02:03
      276000 -- (-1301.346) [-1299.257] (-1300.626) (-1299.555) * (-1296.469) (-1294.357) [-1295.418] (-1296.749) -- 0:02:03
      276500 -- (-1296.063) [-1296.362] (-1296.737) (-1296.833) * [-1299.425] (-1304.206) (-1295.126) (-1300.799) -- 0:02:02
      277000 -- (-1297.729) (-1306.953) [-1296.193] (-1298.777) * (-1298.240) (-1308.526) [-1301.315] (-1298.458) -- 0:02:05
      277500 -- (-1302.137) (-1304.232) (-1301.049) [-1294.880] * (-1297.086) (-1302.274) (-1295.959) [-1295.073] -- 0:02:04
      278000 -- (-1295.928) (-1301.454) [-1294.058] (-1298.607) * (-1298.972) [-1302.126] (-1294.041) (-1301.162) -- 0:02:04
      278500 -- (-1296.790) [-1297.945] (-1298.230) (-1297.741) * [-1295.433] (-1298.379) (-1298.364) (-1304.259) -- 0:02:04
      279000 -- (-1300.477) (-1297.766) (-1308.282) [-1294.973] * (-1293.086) (-1301.774) [-1297.301] (-1300.886) -- 0:02:04
      279500 -- [-1296.010] (-1295.153) (-1303.336) (-1294.290) * [-1295.705] (-1295.608) (-1294.952) (-1298.947) -- 0:02:03
      280000 -- (-1295.779) [-1290.091] (-1298.854) (-1297.628) * (-1293.010) (-1298.665) [-1296.346] (-1301.495) -- 0:02:03

      Average standard deviation of split frequencies: 0.004199

      280500 -- (-1297.798) (-1296.885) (-1299.365) [-1295.744] * (-1297.612) (-1304.473) [-1296.722] (-1298.737) -- 0:02:03
      281000 -- [-1295.346] (-1300.976) (-1301.272) (-1303.528) * [-1294.880] (-1298.986) (-1301.156) (-1303.537) -- 0:02:02
      281500 -- (-1297.437) (-1305.322) [-1299.373] (-1301.847) * (-1300.652) (-1300.453) [-1299.299] (-1304.374) -- 0:02:02
      282000 -- [-1297.347] (-1295.041) (-1297.312) (-1299.157) * (-1305.375) (-1301.351) (-1297.699) [-1296.876] -- 0:02:04
      282500 -- (-1295.493) [-1301.162] (-1298.944) (-1315.129) * [-1296.441] (-1303.073) (-1300.198) (-1298.120) -- 0:02:04
      283000 -- [-1298.039] (-1298.755) (-1306.574) (-1309.497) * (-1295.533) (-1300.138) [-1295.903] (-1302.269) -- 0:02:04
      283500 -- [-1297.930] (-1308.804) (-1307.438) (-1295.387) * [-1291.946] (-1300.681) (-1296.458) (-1297.371) -- 0:02:03
      284000 -- (-1304.020) (-1304.089) (-1296.728) [-1300.339] * [-1296.421] (-1300.556) (-1293.596) (-1296.332) -- 0:02:03
      284500 -- (-1304.114) (-1299.397) (-1298.355) [-1297.194] * (-1301.691) (-1297.479) (-1300.897) [-1304.791] -- 0:02:03
      285000 -- (-1300.364) [-1293.049] (-1297.470) (-1299.231) * (-1300.708) (-1298.738) [-1296.859] (-1301.583) -- 0:02:02

      Average standard deviation of split frequencies: 0.004121

      285500 -- (-1303.374) [-1305.855] (-1296.930) (-1295.891) * (-1301.123) (-1299.193) (-1299.118) [-1296.729] -- 0:02:02
      286000 -- (-1300.391) (-1299.072) (-1298.920) [-1298.513] * [-1302.772] (-1298.689) (-1301.723) (-1305.145) -- 0:02:02
      286500 -- (-1304.797) [-1300.009] (-1301.894) (-1299.281) * (-1302.406) (-1296.166) (-1296.362) [-1292.824] -- 0:02:02
      287000 -- (-1301.073) [-1297.494] (-1303.041) (-1297.205) * (-1294.602) [-1296.306] (-1300.061) (-1300.276) -- 0:02:01
      287500 -- (-1300.272) [-1296.363] (-1304.528) (-1302.682) * (-1299.894) (-1300.140) (-1295.996) [-1298.866] -- 0:02:03
      288000 -- (-1302.096) (-1302.848) (-1297.442) [-1295.723] * [-1302.315] (-1304.753) (-1302.552) (-1292.028) -- 0:02:03
      288500 -- (-1298.503) (-1295.443) [-1295.451] (-1303.985) * (-1300.728) (-1294.884) (-1302.742) [-1298.230] -- 0:02:03
      289000 -- (-1302.713) (-1300.777) (-1300.211) [-1299.867] * (-1299.196) [-1301.257] (-1311.408) (-1300.355) -- 0:02:03
      289500 -- (-1297.715) [-1296.684] (-1302.794) (-1297.296) * (-1298.690) (-1301.329) (-1306.666) [-1298.769] -- 0:02:02
      290000 -- (-1304.638) (-1296.421) (-1305.311) [-1295.822] * (-1295.413) (-1300.169) [-1295.487] (-1299.441) -- 0:02:02

      Average standard deviation of split frequencies: 0.004055

      290500 -- (-1306.843) (-1295.546) [-1297.704] (-1294.131) * (-1293.952) (-1299.654) [-1300.046] (-1296.702) -- 0:02:02
      291000 -- [-1304.287] (-1298.369) (-1295.876) (-1298.483) * (-1297.249) [-1295.931] (-1302.034) (-1302.581) -- 0:02:01
      291500 -- (-1299.408) [-1298.701] (-1295.539) (-1300.690) * (-1294.313) [-1296.136] (-1298.870) (-1301.101) -- 0:02:01
      292000 -- [-1297.583] (-1297.873) (-1295.120) (-1296.806) * (-1300.114) [-1294.720] (-1299.979) (-1297.479) -- 0:02:01
      292500 -- (-1301.342) (-1298.196) (-1295.935) [-1299.552] * (-1298.112) (-1297.321) [-1299.310] (-1300.830) -- 0:02:00
      293000 -- (-1302.155) (-1304.689) [-1300.870] (-1310.040) * (-1297.678) [-1293.649] (-1300.578) (-1299.527) -- 0:02:03
      293500 -- (-1306.541) (-1304.858) [-1300.864] (-1306.357) * (-1306.686) (-1297.608) (-1297.271) [-1298.464] -- 0:02:02
      294000 -- (-1304.402) (-1298.524) (-1301.267) [-1297.901] * (-1299.680) (-1297.152) (-1302.247) [-1297.017] -- 0:02:02
      294500 -- (-1303.571) (-1301.125) [-1300.494] (-1300.511) * [-1298.674] (-1300.462) (-1294.576) (-1297.991) -- 0:02:02
      295000 -- (-1302.046) (-1300.788) [-1296.661] (-1296.318) * (-1291.405) (-1303.886) (-1293.968) [-1300.696] -- 0:02:01

      Average standard deviation of split frequencies: 0.003981

      295500 -- (-1302.440) [-1297.287] (-1297.414) (-1297.429) * [-1299.454] (-1300.489) (-1294.895) (-1299.295) -- 0:02:01
      296000 -- (-1310.087) [-1301.548] (-1298.538) (-1297.410) * (-1295.443) (-1301.946) (-1304.923) [-1300.755] -- 0:02:01
      296500 -- [-1299.324] (-1302.916) (-1297.416) (-1295.125) * [-1299.235] (-1299.356) (-1298.981) (-1303.612) -- 0:02:01
      297000 -- (-1306.165) (-1297.887) [-1300.948] (-1302.096) * (-1297.792) (-1301.068) [-1296.605] (-1310.352) -- 0:02:00
      297500 -- (-1303.998) (-1303.851) [-1296.047] (-1302.145) * (-1309.783) [-1296.771] (-1295.991) (-1306.486) -- 0:02:00
      298000 -- [-1300.816] (-1299.135) (-1297.578) (-1302.323) * [-1298.601] (-1301.181) (-1305.087) (-1304.806) -- 0:02:00
      298500 -- (-1295.339) [-1298.688] (-1298.418) (-1301.578) * (-1295.148) (-1300.730) [-1296.620] (-1306.834) -- 0:01:59
      299000 -- (-1306.141) [-1294.286] (-1295.036) (-1300.580) * (-1300.450) [-1297.043] (-1299.240) (-1303.353) -- 0:02:01
      299500 -- (-1304.886) [-1296.641] (-1300.885) (-1301.142) * (-1305.365) (-1300.375) (-1300.812) [-1298.250] -- 0:02:01
      300000 -- (-1303.729) [-1296.696] (-1292.303) (-1296.210) * [-1301.790] (-1295.379) (-1305.240) (-1301.224) -- 0:02:01

      Average standard deviation of split frequencies: 0.003920

      300500 -- (-1314.356) (-1299.058) (-1298.059) [-1294.541] * (-1293.706) (-1300.940) [-1295.707] (-1301.502) -- 0:02:01
      301000 -- (-1308.209) [-1307.541] (-1298.647) (-1303.166) * [-1296.763] (-1299.910) (-1297.046) (-1301.660) -- 0:02:00
      301500 -- (-1303.682) [-1304.892] (-1301.977) (-1293.349) * (-1308.401) [-1300.261] (-1298.406) (-1296.060) -- 0:02:00
      302000 -- (-1303.916) (-1306.305) (-1297.101) [-1294.744] * [-1303.704] (-1303.197) (-1297.239) (-1304.042) -- 0:02:00
      302500 -- [-1306.508] (-1305.354) (-1300.299) (-1294.723) * (-1307.619) (-1300.148) (-1299.250) [-1298.774] -- 0:01:59
      303000 -- [-1301.207] (-1302.353) (-1300.007) (-1296.321) * (-1303.107) (-1309.482) (-1296.195) [-1297.774] -- 0:01:59
      303500 -- (-1299.571) (-1299.731) [-1299.408] (-1308.630) * (-1299.259) [-1301.902] (-1296.975) (-1295.916) -- 0:01:59
      304000 -- [-1302.527] (-1298.761) (-1297.911) (-1295.783) * [-1300.406] (-1300.596) (-1299.231) (-1293.495) -- 0:01:59
      304500 -- (-1312.753) (-1300.710) [-1300.956] (-1299.263) * (-1301.274) (-1297.848) [-1305.900] (-1297.989) -- 0:02:01
      305000 -- (-1304.573) [-1297.881] (-1293.135) (-1301.098) * (-1298.339) (-1300.371) [-1299.393] (-1296.712) -- 0:02:00

      Average standard deviation of split frequencies: 0.003851

      305500 -- [-1304.514] (-1298.107) (-1296.777) (-1301.692) * (-1298.113) (-1293.146) (-1297.877) [-1300.181] -- 0:02:00
      306000 -- [-1302.019] (-1312.914) (-1300.739) (-1294.376) * (-1294.993) (-1303.195) [-1298.425] (-1301.269) -- 0:02:00
      306500 -- (-1301.767) (-1297.171) [-1299.659] (-1294.214) * (-1303.007) (-1300.715) (-1305.038) [-1304.579] -- 0:01:59
      307000 -- (-1299.337) (-1301.286) (-1295.623) [-1296.896] * (-1294.328) (-1296.129) [-1295.387] (-1302.759) -- 0:01:59
      307500 -- (-1303.221) (-1298.341) [-1296.979] (-1302.369) * (-1301.390) (-1305.530) [-1300.520] (-1301.912) -- 0:01:59
      308000 -- (-1302.075) [-1296.770] (-1307.488) (-1296.218) * (-1293.031) (-1292.610) [-1297.096] (-1305.746) -- 0:01:59
      308500 -- (-1299.777) [-1297.906] (-1296.648) (-1299.215) * [-1295.966] (-1297.135) (-1297.147) (-1296.203) -- 0:01:58
      309000 -- (-1297.223) [-1295.204] (-1300.951) (-1300.720) * [-1297.013] (-1296.509) (-1296.144) (-1298.971) -- 0:01:58
      309500 -- (-1300.830) (-1301.944) [-1297.531] (-1297.706) * [-1297.454] (-1295.145) (-1301.078) (-1306.909) -- 0:01:58
      310000 -- [-1298.017] (-1298.704) (-1298.547) (-1307.823) * [-1297.175] (-1296.713) (-1296.167) (-1298.065) -- 0:01:57

      Average standard deviation of split frequencies: 0.004552

      310500 -- [-1294.606] (-1295.541) (-1296.986) (-1295.581) * (-1299.040) (-1303.304) [-1298.339] (-1296.354) -- 0:01:59
      311000 -- [-1293.904] (-1298.907) (-1309.594) (-1297.263) * (-1296.102) (-1299.861) (-1296.778) [-1304.049] -- 0:01:59
      311500 -- [-1294.098] (-1296.771) (-1304.419) (-1299.831) * (-1300.151) [-1300.159] (-1300.642) (-1303.295) -- 0:01:59
      312000 -- (-1296.608) [-1299.762] (-1303.351) (-1302.614) * (-1296.344) (-1299.395) [-1297.830] (-1299.388) -- 0:01:59
      312500 -- [-1297.664] (-1307.617) (-1304.070) (-1303.860) * (-1297.042) [-1297.696] (-1308.135) (-1298.144) -- 0:01:58
      313000 -- (-1299.375) [-1298.012] (-1298.486) (-1304.023) * (-1296.151) (-1299.495) [-1300.157] (-1297.335) -- 0:01:58
      313500 -- (-1301.356) [-1304.218] (-1298.164) (-1301.008) * [-1299.174] (-1300.753) (-1302.564) (-1295.421) -- 0:01:58
      314000 -- (-1295.043) (-1302.563) [-1300.208] (-1301.488) * (-1298.110) (-1301.076) (-1302.178) [-1292.885] -- 0:01:57
      314500 -- (-1303.515) (-1302.371) (-1298.379) [-1305.759] * (-1298.866) (-1300.775) (-1300.503) [-1295.626] -- 0:01:57
      315000 -- (-1297.902) (-1302.467) [-1297.406] (-1303.725) * (-1298.930) (-1300.261) (-1300.523) [-1295.082] -- 0:01:57

      Average standard deviation of split frequencies: 0.004475

      315500 -- (-1302.392) [-1299.300] (-1296.398) (-1299.648) * (-1294.524) (-1293.439) [-1298.550] (-1308.593) -- 0:01:57
      316000 -- (-1302.215) (-1295.750) (-1299.645) [-1298.094] * (-1301.972) (-1304.231) (-1298.213) [-1297.905] -- 0:01:56
      316500 -- (-1299.472) [-1298.403] (-1305.359) (-1299.649) * [-1299.494] (-1304.444) (-1295.188) (-1299.928) -- 0:01:58
      317000 -- (-1298.127) (-1296.441) (-1295.029) [-1296.026] * [-1308.360] (-1302.925) (-1295.950) (-1298.654) -- 0:01:58
      317500 -- [-1296.416] (-1306.780) (-1297.478) (-1295.157) * (-1301.597) [-1302.659] (-1296.895) (-1301.496) -- 0:01:58
      318000 -- (-1301.101) (-1298.513) (-1296.316) [-1301.662] * (-1300.648) (-1301.058) (-1294.787) [-1302.424] -- 0:01:57
      318500 -- (-1297.901) (-1300.459) (-1297.263) [-1295.912] * (-1299.236) (-1295.961) [-1297.989] (-1300.527) -- 0:01:57
      319000 -- (-1300.547) (-1306.399) [-1298.938] (-1301.288) * (-1298.343) (-1296.596) (-1298.017) [-1298.514] -- 0:01:57
      319500 -- (-1296.720) (-1300.753) [-1300.191] (-1298.407) * (-1309.071) [-1295.067] (-1296.544) (-1303.320) -- 0:01:57
      320000 -- (-1297.198) (-1304.540) [-1300.824] (-1299.940) * [-1298.613] (-1294.376) (-1295.814) (-1303.657) -- 0:01:56

      Average standard deviation of split frequencies: 0.003675

      320500 -- (-1297.807) [-1300.280] (-1298.831) (-1301.802) * (-1299.293) (-1302.904) [-1298.233] (-1301.923) -- 0:01:56
      321000 -- (-1300.902) (-1298.705) [-1296.582] (-1294.609) * (-1299.270) [-1299.491] (-1298.665) (-1301.747) -- 0:01:56
      321500 -- (-1296.577) (-1296.425) [-1299.415] (-1298.841) * (-1303.284) (-1307.556) [-1298.000] (-1301.156) -- 0:01:56
      322000 -- (-1297.761) (-1298.506) (-1298.883) [-1295.874] * (-1301.977) (-1298.513) [-1294.888] (-1300.314) -- 0:01:55
      322500 -- [-1294.107] (-1304.760) (-1301.187) (-1297.492) * (-1303.037) (-1297.061) (-1291.843) [-1300.725] -- 0:01:57
      323000 -- [-1294.010] (-1296.028) (-1296.411) (-1299.141) * (-1301.102) (-1300.756) [-1295.002] (-1297.373) -- 0:01:57
      323500 -- (-1295.216) [-1295.914] (-1305.801) (-1295.137) * (-1296.454) (-1307.745) [-1294.690] (-1299.585) -- 0:01:57
      324000 -- (-1294.736) (-1300.232) [-1296.689] (-1302.135) * (-1298.910) (-1300.423) [-1296.286] (-1294.797) -- 0:01:56
      324500 -- (-1295.465) (-1299.745) (-1298.566) [-1300.765] * (-1296.073) (-1297.449) [-1297.331] (-1298.254) -- 0:01:56
      325000 -- (-1296.247) [-1296.825] (-1296.542) (-1304.262) * (-1310.469) (-1299.966) (-1295.400) [-1300.684] -- 0:01:56

      Average standard deviation of split frequencies: 0.003615

      325500 -- (-1299.234) (-1297.069) (-1302.662) [-1295.476] * (-1297.727) (-1297.805) [-1300.337] (-1299.846) -- 0:01:56
      326000 -- [-1300.125] (-1296.931) (-1300.523) (-1296.036) * (-1298.179) (-1299.732) [-1293.985] (-1300.747) -- 0:01:55
      326500 -- (-1299.089) (-1298.123) (-1301.400) [-1302.989] * (-1296.672) [-1296.300] (-1296.800) (-1303.099) -- 0:01:55
      327000 -- (-1301.854) (-1312.207) (-1302.347) [-1298.919] * (-1295.605) (-1298.898) [-1298.304] (-1305.321) -- 0:01:57
      327500 -- (-1300.304) (-1301.093) [-1296.122] (-1295.609) * (-1299.226) [-1299.049] (-1296.906) (-1302.983) -- 0:01:57
      328000 -- [-1298.360] (-1305.176) (-1301.389) (-1294.262) * [-1298.952] (-1300.927) (-1294.886) (-1305.228) -- 0:01:56
      328500 -- (-1297.842) [-1295.177] (-1294.702) (-1299.741) * (-1298.399) (-1300.193) (-1302.264) [-1296.015] -- 0:01:56
      329000 -- [-1299.476] (-1296.994) (-1298.156) (-1295.220) * (-1298.227) (-1301.483) (-1304.960) [-1299.264] -- 0:01:56
      329500 -- (-1302.952) (-1304.348) (-1297.838) [-1300.700] * (-1297.447) (-1303.035) (-1299.441) [-1296.442] -- 0:01:55
      330000 -- (-1294.940) (-1303.256) (-1299.948) [-1300.618] * (-1294.707) (-1297.984) [-1300.855] (-1306.312) -- 0:01:55

      Average standard deviation of split frequencies: 0.003564

      330500 -- [-1298.024] (-1297.768) (-1304.102) (-1298.332) * (-1300.309) [-1297.698] (-1298.092) (-1302.600) -- 0:01:55
      331000 -- (-1294.442) (-1299.194) (-1296.415) [-1297.538] * (-1294.152) [-1307.121] (-1298.277) (-1303.462) -- 0:01:55
      331500 -- (-1301.854) [-1303.701] (-1297.577) (-1297.303) * [-1301.614] (-1304.439) (-1305.104) (-1305.272) -- 0:01:54
      332000 -- [-1296.842] (-1303.344) (-1297.524) (-1297.725) * (-1303.380) (-1295.070) [-1292.279] (-1311.493) -- 0:01:54
      332500 -- [-1303.038] (-1293.545) (-1298.956) (-1299.812) * [-1298.705] (-1301.444) (-1296.016) (-1300.354) -- 0:01:54
      333000 -- (-1302.966) (-1295.590) (-1295.370) [-1300.390] * (-1297.533) [-1298.998] (-1294.458) (-1299.479) -- 0:01:56
      333500 -- (-1299.428) (-1294.623) [-1296.970] (-1307.204) * (-1305.073) [-1296.065] (-1302.116) (-1296.644) -- 0:01:55
      334000 -- (-1297.460) (-1291.925) (-1300.150) [-1300.406] * (-1300.233) [-1302.173] (-1293.061) (-1298.247) -- 0:01:55
      334500 -- (-1297.700) [-1296.977] (-1298.238) (-1295.607) * (-1302.796) [-1301.090] (-1291.153) (-1297.685) -- 0:01:55
      335000 -- (-1302.213) [-1297.066] (-1295.658) (-1299.833) * [-1301.761] (-1297.177) (-1300.188) (-1301.670) -- 0:01:55

      Average standard deviation of split frequencies: 0.003507

      335500 -- [-1300.824] (-1297.491) (-1300.832) (-1295.782) * (-1298.959) (-1297.204) (-1305.380) [-1299.923] -- 0:01:54
      336000 -- (-1310.756) (-1295.550) (-1301.274) [-1294.605] * (-1301.476) [-1301.183] (-1297.879) (-1303.754) -- 0:01:54
      336500 -- (-1301.803) [-1302.716] (-1298.775) (-1296.624) * (-1299.659) (-1300.067) [-1296.492] (-1300.849) -- 0:01:54
      337000 -- [-1301.171] (-1301.892) (-1295.998) (-1302.161) * (-1300.930) [-1297.606] (-1299.158) (-1297.539) -- 0:01:54
      337500 -- (-1302.487) (-1307.134) (-1312.666) [-1298.820] * [-1296.413] (-1296.331) (-1300.223) (-1300.049) -- 0:01:53
      338000 -- [-1306.307] (-1302.470) (-1308.036) (-1297.446) * [-1300.969] (-1293.784) (-1300.241) (-1298.065) -- 0:01:53
      338500 -- (-1300.233) (-1292.584) (-1302.308) [-1295.818] * [-1298.034] (-1303.788) (-1308.121) (-1299.667) -- 0:01:55
      339000 -- (-1298.904) [-1294.276] (-1299.006) (-1294.367) * (-1296.995) [-1295.095] (-1310.574) (-1299.975) -- 0:01:55
      339500 -- [-1301.371] (-1304.785) (-1297.100) (-1298.912) * [-1302.989] (-1304.113) (-1305.287) (-1316.456) -- 0:01:54
      340000 -- (-1298.469) (-1301.656) [-1301.081] (-1306.439) * (-1298.258) (-1296.239) (-1302.179) [-1295.982] -- 0:01:54

      Average standard deviation of split frequencies: 0.004151

      340500 -- (-1297.858) (-1299.704) [-1296.874] (-1295.332) * (-1301.497) (-1296.274) (-1303.515) [-1294.228] -- 0:01:54
      341000 -- [-1296.590] (-1297.182) (-1298.678) (-1296.874) * [-1296.069] (-1296.806) (-1293.891) (-1298.653) -- 0:01:54
      341500 -- [-1294.813] (-1303.998) (-1297.915) (-1300.625) * (-1297.057) [-1294.519] (-1298.183) (-1292.572) -- 0:01:53
      342000 -- [-1297.925] (-1301.098) (-1300.032) (-1292.243) * [-1302.368] (-1299.939) (-1299.511) (-1296.420) -- 0:01:53
      342500 -- (-1301.084) (-1297.845) (-1303.519) [-1296.240] * (-1297.846) (-1305.730) (-1300.623) [-1294.767] -- 0:01:53
      343000 -- (-1294.842) [-1303.861] (-1297.907) (-1305.908) * (-1303.669) [-1297.965] (-1300.658) (-1300.028) -- 0:01:53
      343500 -- [-1295.988] (-1300.522) (-1297.945) (-1298.336) * [-1298.006] (-1308.937) (-1301.737) (-1296.157) -- 0:01:54
      344000 -- (-1298.153) (-1300.876) (-1298.847) [-1298.854] * (-1303.585) [-1297.992] (-1299.040) (-1301.433) -- 0:01:54
      344500 -- (-1304.113) [-1300.182] (-1303.314) (-1299.206) * (-1297.349) (-1302.091) (-1301.215) [-1299.053] -- 0:01:54
      345000 -- (-1308.303) (-1298.533) (-1303.286) [-1298.107] * (-1301.216) (-1297.868) [-1294.429] (-1298.938) -- 0:01:53

      Average standard deviation of split frequencies: 0.004087

      345500 -- (-1301.295) (-1296.303) [-1301.574] (-1297.115) * (-1299.671) (-1302.342) [-1300.947] (-1299.396) -- 0:01:53
      346000 -- (-1299.368) (-1305.641) (-1300.859) [-1295.690] * (-1303.499) (-1304.133) [-1291.962] (-1306.805) -- 0:01:53
      346500 -- (-1298.048) [-1298.844] (-1303.658) (-1301.881) * (-1305.261) [-1308.726] (-1296.064) (-1299.904) -- 0:01:53
      347000 -- (-1299.425) (-1304.114) (-1303.502) [-1300.076] * (-1302.790) (-1297.186) [-1297.821] (-1301.535) -- 0:01:52
      347500 -- (-1297.226) (-1296.803) [-1300.634] (-1297.643) * (-1302.782) (-1301.437) (-1299.993) [-1299.728] -- 0:01:52
      348000 -- (-1295.207) (-1297.722) (-1295.038) [-1300.684] * (-1298.971) [-1298.921] (-1302.034) (-1300.467) -- 0:01:52
      348500 -- [-1295.160] (-1300.464) (-1297.017) (-1295.015) * (-1296.979) (-1294.388) (-1303.958) [-1302.399] -- 0:01:52
      349000 -- (-1303.743) (-1301.072) [-1295.753] (-1300.843) * [-1298.861] (-1296.788) (-1303.840) (-1293.542) -- 0:01:53
      349500 -- (-1294.072) (-1295.982) [-1295.415] (-1303.992) * (-1296.467) (-1298.812) (-1300.101) [-1295.517] -- 0:01:53
      350000 -- (-1292.427) (-1298.944) (-1299.297) [-1300.559] * [-1295.749] (-1307.386) (-1296.787) (-1295.990) -- 0:01:53

      Average standard deviation of split frequencies: 0.004033

      350500 -- [-1296.846] (-1300.498) (-1298.938) (-1305.694) * [-1297.470] (-1308.324) (-1298.609) (-1297.979) -- 0:01:53
      351000 -- [-1292.602] (-1294.136) (-1296.678) (-1303.505) * (-1298.278) (-1300.300) (-1298.960) [-1293.079] -- 0:01:52
      351500 -- (-1297.951) (-1296.618) (-1297.941) [-1298.120] * [-1297.656] (-1294.592) (-1299.495) (-1295.575) -- 0:01:52
      352000 -- (-1295.361) [-1297.056] (-1296.726) (-1298.245) * (-1296.914) (-1299.841) (-1295.253) [-1293.846] -- 0:01:52
      352500 -- (-1295.209) (-1294.399) [-1300.106] (-1298.118) * (-1295.781) [-1299.257] (-1302.278) (-1294.679) -- 0:01:52
      353000 -- (-1296.831) [-1296.157] (-1305.176) (-1295.347) * (-1295.405) (-1298.088) (-1294.348) [-1298.783] -- 0:01:51
      353500 -- [-1302.503] (-1297.004) (-1301.006) (-1292.994) * (-1298.299) (-1301.733) [-1299.144] (-1295.708) -- 0:01:51
      354000 -- (-1296.416) [-1294.319] (-1295.307) (-1300.507) * (-1301.025) (-1297.278) (-1293.616) [-1294.965] -- 0:01:53
      354500 -- [-1300.852] (-1298.050) (-1304.412) (-1295.524) * (-1298.111) (-1297.173) [-1295.166] (-1298.127) -- 0:01:52
      355000 -- (-1298.860) (-1307.321) (-1301.815) [-1296.270] * (-1297.831) (-1295.608) (-1299.283) [-1295.822] -- 0:01:52

      Average standard deviation of split frequencies: 0.003973

      355500 -- (-1297.282) [-1308.281] (-1301.359) (-1291.683) * (-1303.245) (-1296.720) (-1295.728) [-1299.285] -- 0:01:52
      356000 -- (-1300.047) (-1305.231) (-1300.292) [-1296.435] * [-1296.229] (-1296.296) (-1295.281) (-1306.933) -- 0:01:52
      356500 -- (-1298.805) (-1295.144) [-1298.674] (-1295.413) * (-1300.851) (-1298.537) [-1296.265] (-1301.742) -- 0:01:51
      357000 -- (-1296.446) (-1304.241) [-1299.439] (-1302.160) * (-1298.616) (-1304.160) (-1294.628) [-1295.726] -- 0:01:51
      357500 -- (-1296.506) (-1301.288) (-1297.764) [-1301.315] * (-1301.576) [-1293.535] (-1302.189) (-1295.892) -- 0:01:51
      358000 -- (-1296.884) (-1300.279) [-1293.487] (-1296.250) * (-1299.745) (-1298.620) [-1298.011] (-1298.954) -- 0:01:51
      358500 -- [-1293.360] (-1304.192) (-1297.810) (-1301.342) * (-1301.362) [-1294.211] (-1297.921) (-1292.548) -- 0:01:52
      359000 -- (-1294.699) (-1298.459) [-1296.292] (-1302.601) * [-1293.980] (-1296.116) (-1301.277) (-1297.086) -- 0:01:52
      359500 -- (-1297.188) (-1296.634) (-1303.990) [-1299.174] * [-1296.839] (-1296.926) (-1297.134) (-1300.727) -- 0:01:52
      360000 -- (-1304.741) (-1298.603) [-1300.513] (-1295.838) * (-1301.490) [-1293.190] (-1308.319) (-1303.386) -- 0:01:52

      Average standard deviation of split frequencies: 0.003921

      360500 -- [-1297.205] (-1294.394) (-1295.198) (-1295.144) * [-1294.924] (-1299.157) (-1297.514) (-1300.576) -- 0:01:51
      361000 -- (-1294.682) (-1297.350) [-1300.212] (-1301.341) * [-1295.734] (-1299.619) (-1299.382) (-1292.842) -- 0:01:51
      361500 -- (-1300.893) (-1294.432) (-1300.317) [-1299.861] * (-1300.267) (-1302.465) [-1296.417] (-1298.371) -- 0:01:51
      362000 -- (-1303.675) [-1292.743] (-1297.464) (-1305.087) * (-1297.938) (-1299.499) [-1299.336] (-1297.323) -- 0:01:51
      362500 -- (-1301.489) [-1294.743] (-1292.128) (-1302.030) * (-1297.024) [-1299.303] (-1302.999) (-1298.217) -- 0:01:50
      363000 -- (-1302.488) [-1299.273] (-1300.050) (-1296.551) * (-1316.745) (-1299.577) (-1299.320) [-1296.138] -- 0:01:50
      363500 -- (-1303.094) (-1294.878) (-1296.657) [-1294.607] * (-1303.394) (-1300.439) [-1298.740] (-1302.583) -- 0:01:50
      364000 -- [-1297.541] (-1306.127) (-1296.583) (-1294.425) * (-1294.350) [-1296.254] (-1304.127) (-1297.203) -- 0:01:50
      364500 -- (-1298.619) (-1302.320) (-1297.536) [-1301.470] * (-1298.266) [-1300.697] (-1301.118) (-1296.965) -- 0:01:51
      365000 -- [-1295.440] (-1301.625) (-1301.393) (-1293.509) * [-1293.543] (-1303.119) (-1299.530) (-1299.888) -- 0:01:51

      Average standard deviation of split frequencies: 0.003864

      365500 -- (-1296.486) (-1301.866) (-1306.811) [-1295.940] * (-1298.142) (-1306.646) [-1297.933] (-1292.132) -- 0:01:51
      366000 -- (-1294.978) (-1305.381) (-1306.590) [-1299.947] * (-1296.742) [-1299.526] (-1293.322) (-1297.091) -- 0:01:50
      366500 -- [-1295.365] (-1304.496) (-1296.635) (-1304.974) * (-1302.411) (-1301.538) [-1293.094] (-1305.268) -- 0:01:50
      367000 -- (-1298.473) [-1301.541] (-1301.147) (-1296.185) * (-1298.905) (-1304.500) (-1299.650) [-1296.861] -- 0:01:50
      367500 -- (-1304.498) (-1303.103) (-1298.636) [-1298.516] * [-1295.045] (-1298.785) (-1299.631) (-1298.850) -- 0:01:50
      368000 -- [-1294.214] (-1309.097) (-1300.017) (-1296.069) * (-1302.542) (-1298.135) (-1295.054) [-1296.802] -- 0:01:49
      368500 -- (-1308.145) (-1303.981) [-1295.786] (-1300.880) * (-1304.268) [-1297.599] (-1295.309) (-1302.294) -- 0:01:49
      369000 -- [-1296.395] (-1296.945) (-1301.259) (-1295.691) * (-1301.506) (-1298.660) [-1302.154] (-1295.045) -- 0:01:49
      369500 -- (-1304.604) [-1299.754] (-1300.356) (-1296.617) * [-1301.387] (-1297.173) (-1297.163) (-1299.526) -- 0:01:49
      370000 -- (-1298.294) (-1300.572) [-1295.625] (-1294.506) * (-1293.594) (-1295.691) (-1301.296) [-1297.466] -- 0:01:50

      Average standard deviation of split frequencies: 0.003815

      370500 -- (-1299.835) (-1301.032) [-1297.963] (-1299.984) * (-1302.274) (-1295.532) (-1299.657) [-1297.203] -- 0:01:50
      371000 -- (-1299.773) (-1298.953) (-1298.688) [-1297.689] * (-1300.755) (-1298.257) [-1301.278] (-1302.714) -- 0:01:50
      371500 -- (-1299.810) (-1304.173) (-1296.386) [-1297.346] * [-1303.706] (-1298.457) (-1303.069) (-1300.210) -- 0:01:49
      372000 -- (-1296.590) [-1293.779] (-1298.409) (-1295.133) * (-1301.339) (-1300.710) (-1306.290) [-1297.350] -- 0:01:49
      372500 -- (-1296.604) (-1300.521) [-1293.957] (-1295.099) * (-1297.129) [-1296.096] (-1297.210) (-1297.729) -- 0:01:49
      373000 -- (-1297.044) (-1306.043) [-1295.535] (-1302.506) * [-1295.698] (-1299.994) (-1296.607) (-1297.304) -- 0:01:49
      373500 -- (-1297.501) (-1299.730) [-1305.371] (-1294.178) * (-1302.885) (-1306.153) [-1301.024] (-1305.091) -- 0:01:49
      374000 -- [-1299.514] (-1297.045) (-1297.017) (-1296.211) * (-1298.387) (-1305.055) (-1300.045) [-1298.996] -- 0:01:48
      374500 -- (-1300.799) [-1294.378] (-1300.494) (-1302.618) * (-1299.898) (-1302.465) [-1297.726] (-1298.775) -- 0:01:48
      375000 -- (-1303.613) (-1299.240) [-1298.890] (-1302.123) * (-1303.389) [-1296.531] (-1299.875) (-1302.891) -- 0:01:50

      Average standard deviation of split frequencies: 0.003761

      375500 -- (-1292.453) (-1298.035) (-1299.945) [-1300.594] * (-1296.789) (-1299.579) [-1295.563] (-1298.796) -- 0:01:49
      376000 -- [-1296.103] (-1296.537) (-1293.753) (-1299.657) * (-1297.327) (-1301.739) [-1297.863] (-1303.200) -- 0:01:49
      376500 -- (-1302.124) [-1300.020] (-1297.946) (-1303.065) * [-1300.350] (-1304.657) (-1298.229) (-1306.880) -- 0:01:49
      377000 -- (-1301.187) (-1296.259) (-1301.885) [-1298.656] * [-1299.340] (-1303.716) (-1299.065) (-1302.547) -- 0:01:49
      377500 -- (-1298.592) [-1298.252] (-1307.850) (-1298.125) * (-1304.590) (-1298.213) [-1298.263] (-1299.688) -- 0:01:48
      378000 -- (-1298.967) [-1295.589] (-1305.216) (-1303.549) * (-1303.651) (-1301.392) [-1294.048] (-1301.088) -- 0:01:48
      378500 -- (-1297.490) [-1296.093] (-1295.199) (-1301.591) * (-1299.900) (-1297.660) (-1303.464) [-1301.834] -- 0:01:48
      379000 -- [-1297.709] (-1298.049) (-1300.410) (-1297.759) * [-1296.834] (-1297.772) (-1301.722) (-1298.777) -- 0:01:48
      379500 -- (-1298.887) [-1297.116] (-1299.766) (-1294.759) * [-1299.692] (-1302.443) (-1306.024) (-1298.387) -- 0:01:47
      380000 -- (-1294.292) (-1301.375) [-1293.238] (-1300.254) * [-1296.583] (-1299.608) (-1299.605) (-1305.885) -- 0:01:47

      Average standard deviation of split frequencies: 0.003096

      380500 -- (-1297.970) (-1304.323) (-1303.265) [-1298.989] * (-1303.001) (-1298.848) (-1303.521) [-1298.602] -- 0:01:47
      381000 -- [-1298.185] (-1297.458) (-1297.745) (-1301.610) * (-1304.287) (-1303.031) [-1297.025] (-1297.754) -- 0:01:48
      381500 -- [-1295.922] (-1303.045) (-1295.347) (-1299.042) * (-1299.362) [-1298.264] (-1300.997) (-1298.166) -- 0:01:48
      382000 -- (-1293.066) (-1299.427) (-1297.888) [-1294.972] * (-1300.248) (-1300.174) (-1299.943) [-1294.674] -- 0:01:48
      382500 -- (-1292.035) [-1297.886] (-1302.357) (-1298.920) * [-1298.086] (-1300.684) (-1296.326) (-1307.878) -- 0:01:48
      383000 -- (-1299.932) (-1302.044) (-1301.851) [-1295.128] * [-1298.182] (-1298.574) (-1304.814) (-1301.846) -- 0:01:47
      383500 -- [-1294.105] (-1299.163) (-1297.104) (-1297.345) * (-1298.424) (-1302.546) [-1292.616] (-1298.490) -- 0:01:47
      384000 -- (-1294.400) (-1299.364) [-1294.211] (-1305.627) * [-1301.190] (-1302.370) (-1296.804) (-1299.057) -- 0:01:47
      384500 -- (-1307.721) (-1300.888) (-1296.640) [-1295.255] * (-1298.633) [-1296.519] (-1303.082) (-1300.295) -- 0:01:47
      385000 -- (-1304.986) (-1305.576) [-1293.507] (-1292.777) * [-1293.113] (-1304.478) (-1300.092) (-1293.921) -- 0:01:47

      Average standard deviation of split frequencies: 0.003053

      385500 -- (-1301.556) [-1294.668] (-1301.642) (-1302.762) * (-1307.026) (-1300.913) (-1293.041) [-1295.932] -- 0:01:46
      386000 -- (-1298.291) (-1300.219) [-1300.044] (-1305.189) * [-1299.409] (-1293.669) (-1295.825) (-1296.982) -- 0:01:46
      386500 -- (-1300.263) (-1301.400) (-1295.691) [-1298.214] * (-1295.644) (-1293.717) [-1299.876] (-1302.906) -- 0:01:46
      387000 -- [-1298.232] (-1298.233) (-1293.679) (-1309.646) * (-1302.396) (-1295.807) [-1294.396] (-1303.321) -- 0:01:47
      387500 -- [-1303.725] (-1300.960) (-1294.571) (-1300.611) * (-1300.403) (-1298.100) [-1297.096] (-1295.185) -- 0:01:47
      388000 -- (-1299.811) (-1296.297) [-1293.433] (-1300.914) * [-1303.726] (-1297.157) (-1296.386) (-1301.948) -- 0:01:47
      388500 -- [-1292.481] (-1298.652) (-1295.454) (-1304.461) * (-1296.435) (-1298.987) [-1299.959] (-1301.587) -- 0:01:47
      389000 -- (-1299.728) [-1295.224] (-1298.380) (-1303.211) * (-1300.498) (-1295.615) [-1298.114] (-1301.107) -- 0:01:46
      389500 -- [-1294.901] (-1299.763) (-1309.005) (-1300.952) * (-1298.826) (-1301.578) (-1298.091) [-1297.064] -- 0:01:46
      390000 -- (-1303.585) (-1297.917) [-1297.155] (-1300.737) * (-1292.563) (-1303.308) [-1297.574] (-1301.467) -- 0:01:46

      Average standard deviation of split frequencies: 0.003017

      390500 -- (-1290.740) [-1298.441] (-1299.445) (-1296.610) * (-1300.999) (-1304.294) (-1309.032) [-1311.230] -- 0:01:46
      391000 -- (-1296.155) [-1293.408] (-1296.215) (-1298.226) * (-1303.542) [-1301.717] (-1301.962) (-1294.116) -- 0:01:45
      391500 -- [-1303.515] (-1296.872) (-1300.086) (-1298.791) * (-1305.795) (-1299.932) [-1298.241] (-1297.202) -- 0:01:45
      392000 -- [-1298.498] (-1304.727) (-1295.151) (-1296.992) * (-1298.645) (-1303.024) (-1296.013) [-1294.197] -- 0:01:45
      392500 -- (-1296.077) (-1294.987) (-1298.040) [-1297.627] * [-1294.556] (-1301.188) (-1294.612) (-1296.851) -- 0:01:46
      393000 -- (-1296.090) (-1300.000) (-1300.193) [-1294.955] * [-1294.721] (-1303.705) (-1304.364) (-1297.404) -- 0:01:46
      393500 -- (-1307.784) (-1293.609) (-1298.468) [-1293.869] * (-1295.084) (-1293.910) (-1299.140) [-1302.628] -- 0:01:46
      394000 -- (-1299.809) [-1294.623] (-1302.301) (-1294.006) * (-1302.850) (-1297.742) [-1292.278] (-1297.197) -- 0:01:46
      394500 -- (-1296.264) (-1299.433) [-1305.406] (-1301.143) * (-1299.266) [-1295.574] (-1295.748) (-1298.877) -- 0:01:45
      395000 -- (-1298.041) (-1298.866) [-1304.053] (-1300.521) * (-1297.640) [-1297.913] (-1304.901) (-1298.383) -- 0:01:45

      Average standard deviation of split frequencies: 0.002976

      395500 -- (-1297.193) (-1300.360) (-1297.247) [-1300.036] * (-1300.650) [-1297.334] (-1297.134) (-1297.968) -- 0:01:45
      396000 -- (-1299.403) [-1298.454] (-1302.737) (-1303.197) * (-1301.659) (-1296.256) (-1302.182) [-1301.161] -- 0:01:45
      396500 -- (-1301.140) (-1315.059) [-1296.565] (-1298.166) * [-1296.959] (-1299.892) (-1309.419) (-1297.614) -- 0:01:45
      397000 -- (-1309.844) (-1303.893) [-1297.956] (-1301.264) * [-1295.461] (-1300.119) (-1301.354) (-1294.067) -- 0:01:44
      397500 -- [-1298.602] (-1303.855) (-1298.405) (-1303.727) * (-1299.882) (-1298.775) (-1298.875) [-1295.348] -- 0:01:44
      398000 -- (-1308.322) [-1300.852] (-1295.681) (-1301.525) * [-1296.892] (-1302.924) (-1308.040) (-1298.374) -- 0:01:45
      398500 -- (-1300.502) [-1298.489] (-1299.937) (-1301.813) * (-1302.424) [-1307.378] (-1298.775) (-1295.667) -- 0:01:45
      399000 -- (-1302.658) (-1295.991) [-1299.818] (-1298.468) * (-1295.540) (-1302.246) (-1305.079) [-1296.268] -- 0:01:45
      399500 -- (-1302.985) (-1299.274) [-1302.577] (-1297.298) * (-1302.491) (-1296.867) [-1301.932] (-1298.860) -- 0:01:45
      400000 -- (-1301.782) (-1303.554) (-1297.339) [-1298.808] * [-1297.571] (-1297.693) (-1294.222) (-1294.927) -- 0:01:45

      Average standard deviation of split frequencies: 0.002941

      400500 -- (-1296.874) (-1304.187) [-1292.661] (-1302.245) * (-1300.222) (-1293.964) (-1303.390) [-1299.435] -- 0:01:44
      401000 -- (-1306.148) (-1297.566) (-1297.227) [-1298.133] * (-1299.775) (-1300.624) [-1295.962] (-1301.563) -- 0:01:44
      401500 -- (-1299.781) (-1298.566) (-1294.313) [-1296.854] * [-1297.297] (-1306.228) (-1298.686) (-1295.034) -- 0:01:44
      402000 -- (-1296.721) [-1297.806] (-1297.738) (-1300.963) * [-1296.348] (-1298.521) (-1303.352) (-1302.430) -- 0:01:44
      402500 -- (-1296.597) (-1293.210) [-1298.671] (-1301.992) * (-1293.833) (-1297.497) (-1300.625) [-1297.032] -- 0:01:43
      403000 -- (-1295.810) (-1297.436) [-1294.707] (-1299.237) * (-1296.164) [-1296.150] (-1297.621) (-1301.558) -- 0:01:45
      403500 -- [-1294.087] (-1295.023) (-1294.827) (-1301.983) * (-1297.871) (-1295.562) [-1296.542] (-1302.204) -- 0:01:44
      404000 -- [-1294.765] (-1299.214) (-1299.658) (-1300.817) * [-1294.274] (-1295.802) (-1297.490) (-1298.150) -- 0:01:44
      404500 -- [-1298.322] (-1299.218) (-1298.802) (-1303.012) * (-1299.573) [-1296.789] (-1299.751) (-1292.985) -- 0:01:44
      405000 -- [-1296.935] (-1300.815) (-1295.483) (-1304.756) * (-1298.637) (-1295.217) (-1299.283) [-1294.209] -- 0:01:44

      Average standard deviation of split frequencies: 0.002903

      405500 -- (-1299.785) (-1296.313) [-1299.651] (-1304.375) * [-1298.984] (-1301.268) (-1292.663) (-1298.146) -- 0:01:44
      406000 -- (-1296.628) [-1294.719] (-1300.725) (-1310.043) * (-1300.550) [-1297.463] (-1292.738) (-1295.351) -- 0:01:43
      406500 -- (-1300.267) (-1297.692) [-1299.001] (-1298.513) * [-1297.436] (-1298.580) (-1294.727) (-1296.255) -- 0:01:43
      407000 -- (-1294.353) (-1298.540) [-1294.959] (-1297.364) * (-1299.762) (-1300.012) (-1298.956) [-1296.126] -- 0:01:43
      407500 -- (-1302.309) [-1295.930] (-1304.363) (-1302.514) * [-1295.433] (-1302.504) (-1297.433) (-1298.972) -- 0:01:43
      408000 -- [-1295.037] (-1296.823) (-1300.049) (-1295.360) * (-1296.661) [-1298.214] (-1294.975) (-1301.827) -- 0:01:43
      408500 -- [-1299.360] (-1298.059) (-1298.042) (-1300.906) * [-1299.161] (-1303.566) (-1300.121) (-1298.254) -- 0:01:42
      409000 -- (-1297.557) [-1297.479] (-1300.934) (-1301.914) * [-1293.937] (-1304.063) (-1304.342) (-1300.021) -- 0:01:44
      409500 -- (-1296.841) (-1296.829) (-1304.199) [-1304.047] * (-1299.146) (-1296.663) (-1294.042) [-1301.896] -- 0:01:43
      410000 -- (-1305.010) (-1298.222) [-1294.782] (-1298.927) * (-1297.332) [-1293.733] (-1300.332) (-1300.799) -- 0:01:43

      Average standard deviation of split frequencies: 0.002870

      410500 -- (-1293.886) [-1297.483] (-1298.816) (-1296.815) * (-1299.897) [-1303.320] (-1297.530) (-1302.988) -- 0:01:43
      411000 -- (-1299.740) (-1300.582) [-1300.015] (-1298.275) * (-1305.294) (-1295.415) [-1298.435] (-1297.034) -- 0:01:43
      411500 -- [-1300.398] (-1297.974) (-1297.536) (-1302.645) * (-1295.164) (-1296.486) (-1302.835) [-1295.392] -- 0:01:42
      412000 -- [-1304.554] (-1298.078) (-1297.167) (-1297.189) * [-1297.357] (-1294.973) (-1303.369) (-1303.034) -- 0:01:42
      412500 -- (-1294.918) (-1298.266) (-1298.571) [-1296.680] * (-1296.512) (-1297.758) [-1302.503] (-1310.241) -- 0:01:42
      413000 -- (-1299.205) (-1300.494) [-1306.213] (-1309.332) * [-1298.864] (-1298.051) (-1301.425) (-1301.159) -- 0:01:42
      413500 -- (-1295.679) [-1295.990] (-1299.493) (-1296.210) * [-1304.519] (-1301.379) (-1302.368) (-1307.707) -- 0:01:42
      414000 -- (-1302.607) [-1298.838] (-1303.784) (-1295.951) * (-1300.925) [-1296.553] (-1302.631) (-1311.413) -- 0:01:41
      414500 -- (-1295.739) (-1290.360) [-1300.794] (-1307.029) * (-1299.837) (-1294.277) (-1299.802) [-1298.219] -- 0:01:41
      415000 -- (-1303.650) (-1300.556) (-1303.000) [-1295.745] * (-1298.070) (-1296.675) (-1308.731) [-1292.145] -- 0:01:42

      Average standard deviation of split frequencies: 0.002833

      415500 -- (-1301.725) (-1295.285) (-1299.821) [-1295.431] * (-1307.227) (-1302.407) [-1300.043] (-1299.733) -- 0:01:42
      416000 -- (-1296.972) (-1305.187) [-1297.278] (-1298.664) * (-1301.316) [-1293.852] (-1298.193) (-1301.276) -- 0:01:42
      416500 -- (-1297.621) (-1308.260) [-1300.993] (-1296.581) * (-1298.401) [-1294.734] (-1302.992) (-1296.349) -- 0:01:42
      417000 -- (-1299.587) (-1301.532) [-1297.047] (-1295.762) * (-1298.954) (-1296.775) [-1298.389] (-1304.116) -- 0:01:42
      417500 -- (-1295.053) [-1305.316] (-1306.257) (-1293.320) * (-1301.006) (-1303.576) [-1297.205] (-1299.258) -- 0:01:41
      418000 -- (-1305.923) (-1299.994) (-1292.998) [-1295.398] * (-1298.885) [-1298.547] (-1308.927) (-1306.476) -- 0:01:41
      418500 -- (-1298.723) [-1295.453] (-1299.577) (-1293.878) * (-1302.650) (-1294.648) [-1298.408] (-1298.068) -- 0:01:41
      419000 -- (-1306.055) (-1299.602) (-1298.061) [-1298.193] * (-1296.574) (-1307.132) [-1299.131] (-1304.171) -- 0:01:41
      419500 -- (-1295.341) (-1296.595) [-1299.103] (-1299.206) * (-1304.358) (-1299.133) (-1297.257) [-1296.305] -- 0:01:41
      420000 -- (-1294.671) (-1296.717) (-1309.709) [-1299.501] * [-1298.269] (-1295.045) (-1295.170) (-1295.150) -- 0:01:40

      Average standard deviation of split frequencies: 0.002802

      420500 -- [-1292.993] (-1299.499) (-1303.622) (-1295.230) * (-1304.232) [-1295.066] (-1301.799) (-1299.087) -- 0:01:41
      421000 -- [-1302.307] (-1298.625) (-1300.149) (-1295.903) * (-1306.949) [-1301.124] (-1296.716) (-1300.737) -- 0:01:41
      421500 -- (-1298.904) (-1308.932) [-1294.954] (-1299.287) * [-1297.364] (-1300.156) (-1301.938) (-1295.534) -- 0:01:41
      422000 -- (-1301.861) (-1294.953) (-1298.325) [-1295.168] * (-1300.611) (-1301.720) (-1301.415) [-1300.704] -- 0:01:41
      422500 -- (-1296.107) [-1297.243] (-1294.023) (-1296.406) * (-1304.413) (-1298.996) [-1298.928] (-1296.717) -- 0:01:41
      423000 -- (-1301.363) [-1293.229] (-1304.149) (-1292.754) * (-1295.749) [-1296.631] (-1304.692) (-1296.777) -- 0:01:40
      423500 -- (-1298.234) (-1296.827) [-1294.958] (-1297.409) * (-1302.626) (-1295.874) (-1300.964) [-1305.379] -- 0:01:40
      424000 -- [-1297.203] (-1304.751) (-1300.595) (-1299.107) * (-1300.225) [-1298.497] (-1304.543) (-1295.192) -- 0:01:40
      424500 -- (-1298.720) (-1300.972) [-1293.451] (-1298.170) * (-1297.283) (-1298.389) [-1295.666] (-1298.167) -- 0:01:40
      425000 -- (-1298.090) (-1293.664) [-1300.262] (-1297.721) * (-1303.784) [-1297.592] (-1299.443) (-1294.402) -- 0:01:40

      Average standard deviation of split frequencies: 0.002766

      425500 -- (-1294.163) (-1295.577) (-1301.833) [-1297.739] * (-1299.889) (-1294.074) [-1293.648] (-1296.540) -- 0:01:39
      426000 -- (-1296.734) (-1291.911) [-1301.305] (-1299.194) * (-1301.914) (-1296.753) [-1299.357] (-1299.005) -- 0:01:39
      426500 -- (-1296.433) (-1307.439) (-1300.300) [-1298.045] * (-1298.965) (-1299.707) [-1299.807] (-1299.174) -- 0:01:40
      427000 -- (-1295.452) (-1296.038) (-1302.798) [-1299.887] * (-1296.072) (-1299.824) [-1295.709] (-1301.167) -- 0:01:40
      427500 -- (-1303.167) [-1297.353] (-1292.594) (-1296.907) * [-1293.814] (-1298.483) (-1296.844) (-1300.024) -- 0:01:40
      428000 -- (-1293.151) [-1296.657] (-1294.553) (-1301.035) * (-1293.029) [-1301.163] (-1300.462) (-1307.336) -- 0:01:40
      428500 -- [-1299.398] (-1304.833) (-1309.825) (-1296.981) * (-1302.882) (-1301.944) [-1293.396] (-1301.204) -- 0:01:40
      429000 -- [-1294.604] (-1304.031) (-1298.109) (-1297.185) * (-1298.883) (-1296.243) (-1302.827) [-1297.749] -- 0:01:39
      429500 -- (-1298.975) (-1294.503) [-1298.181] (-1305.260) * (-1300.480) [-1299.582] (-1295.381) (-1302.778) -- 0:01:39
      430000 -- (-1305.753) [-1293.534] (-1305.309) (-1299.209) * (-1299.195) (-1292.308) (-1300.298) [-1297.016] -- 0:01:39

      Average standard deviation of split frequencies: 0.002736

      430500 -- [-1294.823] (-1300.750) (-1293.583) (-1302.489) * (-1301.519) (-1294.794) (-1296.582) [-1298.828] -- 0:01:39
      431000 -- [-1298.278] (-1297.306) (-1302.965) (-1298.724) * (-1299.248) (-1294.673) (-1300.894) [-1293.721] -- 0:01:39
      431500 -- [-1295.361] (-1300.445) (-1301.871) (-1302.934) * (-1298.531) (-1298.338) (-1298.742) [-1298.349] -- 0:01:38
      432000 -- (-1298.221) (-1304.468) (-1302.715) [-1302.940] * (-1298.573) [-1297.896] (-1302.027) (-1299.332) -- 0:01:38
      432500 -- (-1297.599) (-1300.950) [-1301.714] (-1300.314) * (-1297.299) (-1300.162) [-1296.502] (-1294.004) -- 0:01:39
      433000 -- (-1300.427) [-1299.957] (-1296.997) (-1301.664) * (-1299.338) (-1297.315) (-1299.114) [-1292.088] -- 0:01:39
      433500 -- (-1300.443) [-1299.136] (-1293.265) (-1302.155) * (-1296.441) [-1300.024] (-1295.626) (-1298.449) -- 0:01:39
      434000 -- (-1299.351) (-1298.261) (-1295.923) [-1299.250] * (-1296.517) (-1299.957) [-1297.005] (-1299.873) -- 0:01:39
      434500 -- (-1295.317) (-1301.105) [-1298.955] (-1299.205) * (-1293.779) (-1297.280) (-1298.401) [-1296.308] -- 0:01:38
      435000 -- (-1301.289) (-1301.259) (-1292.977) [-1297.518] * (-1298.693) (-1299.492) (-1305.292) [-1294.047] -- 0:01:38

      Average standard deviation of split frequencies: 0.002703

      435500 -- [-1297.562] (-1298.830) (-1299.114) (-1293.949) * (-1299.325) (-1299.731) [-1293.916] (-1299.043) -- 0:01:38
      436000 -- [-1298.464] (-1295.944) (-1297.149) (-1300.626) * [-1296.866] (-1306.197) (-1301.875) (-1296.072) -- 0:01:38
      436500 -- (-1294.508) (-1299.391) (-1296.177) [-1295.657] * (-1304.686) [-1298.755] (-1300.274) (-1297.404) -- 0:01:38
      437000 -- [-1296.158] (-1296.929) (-1299.360) (-1300.934) * [-1298.592] (-1298.271) (-1300.355) (-1301.505) -- 0:01:37
      437500 -- (-1298.061) (-1302.132) (-1297.351) [-1301.419] * (-1294.751) (-1300.559) [-1296.979] (-1302.857) -- 0:01:37
      438000 -- [-1293.860] (-1303.710) (-1298.009) (-1299.690) * (-1301.010) [-1297.418] (-1297.223) (-1303.021) -- 0:01:37
      438500 -- (-1294.414) (-1298.551) (-1294.864) [-1301.397] * [-1300.835] (-1297.713) (-1294.480) (-1300.181) -- 0:01:38
      439000 -- (-1295.630) [-1303.224] (-1302.260) (-1302.711) * (-1298.129) (-1293.631) [-1295.504] (-1301.001) -- 0:01:38
      439500 -- (-1303.603) (-1299.213) (-1301.410) [-1300.074] * (-1295.348) [-1295.412] (-1299.577) (-1304.317) -- 0:01:38
      440000 -- [-1294.697] (-1294.363) (-1298.210) (-1296.526) * [-1298.855] (-1296.906) (-1303.837) (-1303.919) -- 0:01:38

      Average standard deviation of split frequencies: 0.002674

      440500 -- (-1297.266) (-1298.209) (-1295.483) [-1301.146] * (-1302.891) (-1298.636) [-1296.603] (-1294.203) -- 0:01:37
      441000 -- [-1295.062] (-1298.497) (-1312.846) (-1300.404) * [-1302.063] (-1302.438) (-1303.277) (-1295.649) -- 0:01:37
      441500 -- [-1303.012] (-1301.942) (-1301.381) (-1303.113) * [-1294.232] (-1296.265) (-1298.595) (-1294.345) -- 0:01:37
      442000 -- (-1301.839) [-1299.878] (-1294.662) (-1293.288) * [-1295.535] (-1294.701) (-1294.437) (-1294.970) -- 0:01:37
      442500 -- [-1299.824] (-1302.302) (-1297.057) (-1297.557) * (-1299.099) [-1295.494] (-1296.415) (-1302.556) -- 0:01:37
      443000 -- [-1297.043] (-1304.620) (-1295.556) (-1292.862) * [-1303.564] (-1299.895) (-1296.303) (-1296.356) -- 0:01:36
      443500 -- (-1299.490) (-1306.508) (-1295.498) [-1296.016] * [-1294.862] (-1306.543) (-1293.579) (-1297.237) -- 0:01:36
      444000 -- [-1299.261] (-1303.221) (-1296.229) (-1295.115) * (-1299.140) (-1300.508) [-1297.673] (-1304.640) -- 0:01:37
      444500 -- (-1299.586) (-1297.812) [-1302.145] (-1295.628) * (-1292.031) [-1294.472] (-1296.239) (-1303.582) -- 0:01:37
      445000 -- (-1303.016) (-1302.703) [-1295.692] (-1296.896) * [-1294.489] (-1298.916) (-1296.793) (-1298.015) -- 0:01:37

      Average standard deviation of split frequencies: 0.002642

      445500 -- (-1299.798) (-1296.423) [-1293.630] (-1303.309) * (-1296.535) (-1294.561) (-1296.694) [-1302.635] -- 0:01:37
      446000 -- (-1296.864) (-1298.164) [-1295.245] (-1295.193) * (-1305.868) (-1301.549) (-1291.939) [-1302.186] -- 0:01:36
      446500 -- (-1302.052) (-1298.664) (-1293.005) [-1292.545] * (-1299.342) (-1300.102) [-1298.600] (-1296.897) -- 0:01:36
      447000 -- (-1300.122) (-1298.687) (-1295.106) [-1296.469] * (-1302.037) [-1299.638] (-1297.846) (-1301.693) -- 0:01:36
      447500 -- (-1305.664) (-1298.627) [-1295.501] (-1294.991) * (-1300.801) (-1296.413) [-1300.060] (-1297.975) -- 0:01:36
      448000 -- (-1296.950) [-1293.434] (-1298.803) (-1301.484) * (-1302.909) (-1299.620) [-1296.406] (-1298.569) -- 0:01:36
      448500 -- [-1298.826] (-1294.627) (-1304.453) (-1301.840) * (-1295.492) (-1296.606) (-1296.759) [-1294.594] -- 0:01:35
      449000 -- (-1299.440) (-1298.335) [-1300.660] (-1302.838) * [-1311.118] (-1304.140) (-1300.593) (-1298.448) -- 0:01:35
      449500 -- [-1300.038] (-1298.962) (-1301.477) (-1301.846) * (-1300.443) [-1295.340] (-1298.842) (-1294.755) -- 0:01:35
      450000 -- [-1295.951] (-1302.368) (-1296.523) (-1300.089) * (-1303.537) [-1298.206] (-1293.438) (-1294.852) -- 0:01:36

      Average standard deviation of split frequencies: 0.002615

      450500 -- (-1297.119) (-1301.818) (-1301.397) [-1298.675] * (-1299.686) (-1296.164) [-1297.732] (-1298.424) -- 0:01:36
      451000 -- [-1297.154] (-1301.910) (-1301.993) (-1303.079) * (-1305.564) [-1295.539] (-1303.128) (-1297.510) -- 0:01:36
      451500 -- (-1299.219) (-1298.611) (-1301.293) [-1296.406] * [-1292.972] (-1303.236) (-1296.258) (-1297.968) -- 0:01:35
      452000 -- (-1303.569) (-1303.101) [-1296.680] (-1297.323) * (-1291.821) (-1296.525) (-1298.777) [-1295.819] -- 0:01:35
      452500 -- (-1316.893) (-1302.811) (-1299.307) [-1302.824] * (-1297.054) [-1295.329] (-1300.175) (-1298.907) -- 0:01:35
      453000 -- (-1304.566) (-1297.389) [-1299.074] (-1293.583) * (-1306.173) (-1296.331) [-1299.704] (-1306.082) -- 0:01:35
      453500 -- (-1301.669) (-1299.087) (-1296.196) [-1301.086] * (-1301.336) [-1299.909] (-1301.759) (-1301.903) -- 0:01:35
      454000 -- (-1296.708) (-1298.473) (-1302.922) [-1298.216] * [-1296.811] (-1296.580) (-1297.899) (-1299.306) -- 0:01:35
      454500 -- (-1304.801) (-1299.525) [-1295.580] (-1302.240) * (-1296.807) [-1298.887] (-1293.535) (-1298.707) -- 0:01:34
      455000 -- (-1298.551) [-1300.959] (-1294.000) (-1301.638) * (-1294.756) (-1304.927) [-1298.862] (-1298.901) -- 0:01:34

      Average standard deviation of split frequencies: 0.002068

      455500 -- (-1301.681) [-1299.235] (-1292.873) (-1298.860) * (-1301.169) [-1299.805] (-1298.108) (-1295.621) -- 0:01:34
      456000 -- (-1297.704) (-1299.005) [-1298.632] (-1296.873) * (-1299.794) (-1297.812) [-1299.966] (-1301.940) -- 0:01:35
      456500 -- (-1298.864) [-1296.370] (-1304.105) (-1296.182) * [-1297.365] (-1301.827) (-1296.919) (-1298.970) -- 0:01:35
      457000 -- (-1295.572) [-1295.212] (-1305.552) (-1295.734) * (-1297.733) (-1302.379) [-1297.289] (-1307.813) -- 0:01:35
      457500 -- [-1295.343] (-1301.035) (-1303.480) (-1296.504) * [-1297.486] (-1307.410) (-1299.182) (-1305.945) -- 0:01:34
      458000 -- [-1297.842] (-1302.776) (-1297.048) (-1296.183) * (-1296.984) (-1303.671) [-1297.452] (-1297.522) -- 0:01:34
      458500 -- [-1302.550] (-1297.542) (-1297.920) (-1299.013) * (-1300.223) (-1298.933) [-1298.105] (-1295.530) -- 0:01:34
      459000 -- (-1299.657) (-1307.407) (-1300.132) [-1299.533] * (-1309.091) (-1297.355) (-1296.592) [-1294.897] -- 0:01:34
      459500 -- (-1299.603) (-1310.472) [-1295.804] (-1297.626) * [-1297.405] (-1301.143) (-1298.586) (-1299.058) -- 0:01:34
      460000 -- [-1294.001] (-1305.617) (-1298.911) (-1299.297) * (-1298.471) [-1301.044] (-1301.754) (-1299.680) -- 0:01:33

      Average standard deviation of split frequencies: 0.002047

      460500 -- [-1297.463] (-1303.824) (-1297.889) (-1295.348) * (-1295.640) [-1301.178] (-1304.392) (-1301.898) -- 0:01:33
      461000 -- [-1298.476] (-1304.120) (-1302.248) (-1302.098) * (-1300.456) (-1299.374) (-1303.404) [-1295.251] -- 0:01:33
      461500 -- (-1297.385) (-1303.895) (-1301.826) [-1298.732] * (-1305.468) (-1299.691) (-1300.247) [-1299.787] -- 0:01:34
      462000 -- (-1295.760) [-1299.147] (-1303.941) (-1308.646) * (-1297.642) (-1294.101) [-1297.830] (-1296.558) -- 0:01:34
      462500 -- (-1296.540) (-1300.167) [-1306.025] (-1296.506) * [-1295.964] (-1303.263) (-1300.866) (-1308.301) -- 0:01:34
      463000 -- (-1299.791) (-1295.860) (-1304.328) [-1297.756] * [-1297.272] (-1304.822) (-1300.177) (-1322.259) -- 0:01:33
      463500 -- (-1295.042) [-1300.506] (-1298.309) (-1297.918) * [-1298.670] (-1302.327) (-1304.458) (-1304.853) -- 0:01:33
      464000 -- (-1300.998) (-1300.827) [-1294.911] (-1298.903) * (-1295.920) [-1300.095] (-1301.453) (-1299.159) -- 0:01:33
      464500 -- (-1302.880) (-1297.899) [-1296.472] (-1290.958) * (-1302.034) [-1305.015] (-1295.040) (-1300.610) -- 0:01:33
      465000 -- (-1306.676) (-1298.541) (-1298.710) [-1300.406] * (-1305.923) (-1297.158) (-1295.811) [-1301.926] -- 0:01:33

      Average standard deviation of split frequencies: 0.002023

      465500 -- (-1298.806) (-1296.851) [-1300.414] (-1295.596) * (-1297.018) [-1295.857] (-1295.846) (-1301.496) -- 0:01:33
      466000 -- [-1299.559] (-1298.744) (-1297.211) (-1306.646) * (-1301.718) (-1311.174) (-1295.959) [-1296.191] -- 0:01:32
      466500 -- [-1295.472] (-1297.564) (-1295.550) (-1303.524) * (-1301.384) (-1298.513) [-1298.877] (-1302.034) -- 0:01:32
      467000 -- (-1297.397) [-1298.753] (-1298.220) (-1303.314) * (-1298.717) [-1295.560] (-1298.419) (-1307.379) -- 0:01:32
      467500 -- (-1297.778) [-1292.484] (-1301.135) (-1298.079) * (-1300.111) (-1299.470) (-1295.901) [-1303.943] -- 0:01:33
      468000 -- (-1299.517) (-1305.844) [-1297.887] (-1304.746) * (-1297.512) [-1297.298] (-1301.043) (-1299.706) -- 0:01:33
      468500 -- [-1296.432] (-1295.339) (-1296.608) (-1301.785) * (-1301.358) [-1292.362] (-1299.686) (-1296.941) -- 0:01:33
      469000 -- (-1304.893) [-1294.933] (-1300.119) (-1305.845) * (-1296.948) [-1295.708] (-1297.820) (-1292.804) -- 0:01:32
      469500 -- [-1302.281] (-1296.658) (-1301.259) (-1298.787) * (-1294.816) [-1295.171] (-1300.893) (-1298.381) -- 0:01:32
      470000 -- (-1299.622) (-1297.770) [-1299.663] (-1298.866) * (-1294.440) [-1298.349] (-1302.313) (-1294.608) -- 0:01:32

      Average standard deviation of split frequencies: 0.002003

      470500 -- (-1299.549) [-1296.700] (-1297.687) (-1300.165) * (-1298.869) (-1301.600) [-1295.857] (-1302.971) -- 0:01:32
      471000 -- (-1297.307) (-1294.578) [-1293.749] (-1300.652) * [-1297.808] (-1295.049) (-1299.616) (-1299.606) -- 0:01:32
      471500 -- (-1296.608) (-1295.297) [-1294.975] (-1302.043) * (-1299.326) [-1295.145] (-1295.367) (-1298.740) -- 0:01:31
      472000 -- (-1301.126) [-1296.786] (-1307.490) (-1297.416) * (-1294.923) (-1298.795) (-1303.611) [-1296.324] -- 0:01:31
      472500 -- [-1299.406] (-1297.582) (-1294.700) (-1306.324) * [-1296.575] (-1295.851) (-1298.884) (-1297.977) -- 0:01:31
      473000 -- [-1299.988] (-1301.354) (-1297.242) (-1300.391) * (-1305.848) (-1293.392) (-1298.272) [-1298.144] -- 0:01:31
      473500 -- [-1300.588] (-1298.395) (-1298.358) (-1295.737) * [-1302.715] (-1296.600) (-1295.472) (-1297.282) -- 0:01:32
      474000 -- [-1296.703] (-1296.453) (-1297.828) (-1293.925) * (-1304.812) (-1301.476) (-1295.111) [-1293.827] -- 0:01:32
      474500 -- (-1295.758) [-1296.116] (-1295.809) (-1296.853) * (-1297.272) (-1306.521) [-1301.831] (-1298.137) -- 0:01:31
      475000 -- (-1295.737) (-1292.036) (-1300.692) [-1295.555] * [-1295.880] (-1300.935) (-1296.701) (-1303.537) -- 0:01:31

      Average standard deviation of split frequencies: 0.001981

      475500 -- [-1294.966] (-1301.819) (-1308.363) (-1300.692) * (-1296.806) (-1302.731) [-1299.085] (-1304.345) -- 0:01:31
      476000 -- (-1296.641) (-1300.277) (-1305.776) [-1295.374] * (-1300.382) (-1302.486) [-1296.620] (-1298.968) -- 0:01:31
      476500 -- (-1300.219) (-1300.511) (-1300.830) [-1300.527] * (-1301.228) (-1297.745) (-1299.077) [-1296.939] -- 0:01:31
      477000 -- (-1297.463) [-1294.660] (-1311.607) (-1298.522) * (-1301.831) (-1298.997) (-1304.353) [-1298.299] -- 0:01:31
      477500 -- (-1297.148) (-1302.108) (-1296.470) [-1298.807] * [-1297.716] (-1303.804) (-1300.253) (-1298.221) -- 0:01:30
      478000 -- [-1293.441] (-1298.242) (-1299.737) (-1308.917) * [-1296.275] (-1296.824) (-1304.856) (-1303.831) -- 0:01:30
      478500 -- (-1295.861) (-1297.884) [-1297.047] (-1296.582) * (-1296.480) [-1293.362] (-1301.130) (-1298.862) -- 0:01:30
      479000 -- (-1292.992) (-1303.612) (-1297.037) [-1298.202] * [-1299.050] (-1297.507) (-1295.270) (-1300.456) -- 0:01:31
      479500 -- (-1302.776) (-1297.263) [-1295.092] (-1296.702) * (-1301.221) (-1294.586) (-1306.850) [-1296.981] -- 0:01:31
      480000 -- (-1294.400) (-1299.720) [-1292.251] (-1296.092) * (-1300.757) (-1296.873) [-1296.521] (-1297.293) -- 0:01:31

      Average standard deviation of split frequencies: 0.001961

      480500 -- [-1301.469] (-1299.254) (-1293.392) (-1301.852) * (-1306.707) (-1299.931) (-1306.369) [-1295.201] -- 0:01:30
      481000 -- (-1296.402) [-1298.539] (-1299.556) (-1304.397) * (-1301.817) [-1298.068] (-1311.503) (-1295.437) -- 0:01:30
      481500 -- (-1299.685) (-1298.394) [-1298.923] (-1299.284) * (-1296.056) [-1296.345] (-1300.044) (-1299.337) -- 0:01:30
      482000 -- (-1298.313) (-1302.131) [-1301.174] (-1301.420) * [-1293.532] (-1304.015) (-1298.720) (-1302.566) -- 0:01:30
      482500 -- (-1292.720) [-1303.587] (-1302.331) (-1305.985) * (-1297.150) [-1301.773] (-1298.113) (-1294.096) -- 0:01:30
      483000 -- (-1298.511) (-1305.222) [-1294.138] (-1300.360) * [-1294.464] (-1304.827) (-1301.884) (-1295.390) -- 0:01:29
      483500 -- (-1300.401) [-1297.315] (-1305.369) (-1299.731) * (-1297.847) (-1305.187) (-1300.648) [-1293.030] -- 0:01:29
      484000 -- (-1297.299) (-1299.256) (-1297.111) [-1297.588] * (-1298.287) (-1305.622) [-1296.654] (-1304.823) -- 0:01:29
      484500 -- (-1296.259) (-1301.051) (-1301.212) [-1297.952] * (-1294.048) (-1300.221) (-1308.164) [-1294.962] -- 0:01:29
      485000 -- (-1295.764) [-1298.061] (-1302.959) (-1296.076) * (-1295.718) [-1297.095] (-1302.708) (-1298.771) -- 0:01:30

      Average standard deviation of split frequencies: 0.001940

      485500 -- (-1297.413) (-1303.069) [-1301.561] (-1299.405) * (-1300.951) [-1301.054] (-1298.646) (-1299.681) -- 0:01:30
      486000 -- [-1293.147] (-1295.925) (-1303.336) (-1302.315) * (-1296.767) (-1299.005) (-1298.984) [-1301.543] -- 0:01:29
      486500 -- [-1296.013] (-1294.922) (-1313.474) (-1299.909) * (-1303.768) [-1295.760] (-1299.760) (-1299.064) -- 0:01:29
      487000 -- (-1302.104) (-1302.578) (-1300.649) [-1296.974] * (-1305.350) (-1305.921) [-1296.340] (-1297.945) -- 0:01:29
      487500 -- (-1298.405) [-1297.672] (-1302.792) (-1297.227) * (-1305.745) [-1301.170] (-1295.224) (-1295.431) -- 0:01:29
      488000 -- (-1300.355) [-1299.529] (-1302.875) (-1300.905) * [-1297.695] (-1296.539) (-1295.034) (-1300.279) -- 0:01:29
      488500 -- (-1300.532) (-1295.109) [-1297.274] (-1297.814) * [-1298.151] (-1294.007) (-1299.372) (-1298.546) -- 0:01:29
      489000 -- (-1293.650) (-1296.347) [-1301.941] (-1296.882) * (-1299.059) [-1299.388] (-1304.107) (-1294.541) -- 0:01:28
      489500 -- (-1302.158) (-1303.295) [-1300.168] (-1299.443) * (-1296.204) (-1302.501) (-1306.567) [-1301.093] -- 0:01:28
      490000 -- (-1296.914) (-1297.810) (-1295.592) [-1294.002] * (-1300.492) [-1297.730] (-1302.641) (-1301.218) -- 0:01:28

      Average standard deviation of split frequencies: 0.001921

      490500 -- [-1301.794] (-1303.174) (-1304.378) (-1297.220) * (-1298.240) (-1294.234) [-1298.521] (-1295.117) -- 0:01:28
      491000 -- [-1301.044] (-1304.761) (-1295.302) (-1304.018) * (-1298.709) [-1297.498] (-1299.269) (-1294.428) -- 0:01:29
      491500 -- (-1295.805) (-1300.655) [-1299.350] (-1300.350) * [-1298.542] (-1295.757) (-1297.940) (-1302.461) -- 0:01:28
      492000 -- [-1302.737] (-1298.761) (-1302.124) (-1306.458) * [-1295.469] (-1293.863) (-1292.914) (-1299.820) -- 0:01:28
      492500 -- [-1298.143] (-1296.999) (-1296.757) (-1299.696) * (-1301.521) (-1296.732) [-1297.006] (-1302.121) -- 0:01:28
      493000 -- (-1302.302) [-1297.350] (-1300.698) (-1294.633) * (-1296.568) (-1296.948) [-1298.076] (-1298.972) -- 0:01:28
      493500 -- (-1295.714) (-1301.721) (-1301.378) [-1292.440] * (-1297.601) (-1297.543) [-1299.546] (-1301.420) -- 0:01:28
      494000 -- (-1304.741) (-1301.925) (-1295.575) [-1295.923] * (-1300.604) [-1300.430] (-1297.042) (-1299.934) -- 0:01:28
      494500 -- (-1298.335) (-1300.333) (-1297.395) [-1296.616] * [-1298.028] (-1297.281) (-1301.595) (-1297.627) -- 0:01:27
      495000 -- (-1294.332) [-1304.736] (-1295.516) (-1294.258) * (-1299.233) [-1292.847] (-1304.119) (-1299.214) -- 0:01:27

      Average standard deviation of split frequencies: 0.001901

      495500 -- (-1297.808) (-1303.310) [-1296.240] (-1296.800) * [-1306.217] (-1297.499) (-1298.325) (-1299.798) -- 0:01:27
      496000 -- (-1294.847) (-1295.912) [-1300.360] (-1308.097) * (-1300.031) [-1293.652] (-1300.301) (-1304.989) -- 0:01:27
      496500 -- (-1297.261) (-1305.172) (-1299.878) [-1297.087] * (-1300.457) (-1298.271) (-1304.347) [-1297.923] -- 0:01:28
      497000 -- (-1305.444) [-1300.027] (-1293.264) (-1298.846) * (-1294.705) [-1298.108] (-1303.426) (-1304.246) -- 0:01:28
      497500 -- (-1298.038) (-1295.735) [-1298.088] (-1300.089) * (-1295.505) (-1302.094) (-1306.879) [-1303.053] -- 0:01:27
      498000 -- (-1294.262) [-1299.699] (-1301.444) (-1299.025) * [-1299.036] (-1298.613) (-1304.072) (-1299.639) -- 0:01:27
      498500 -- [-1291.744] (-1298.690) (-1304.257) (-1297.075) * (-1301.370) (-1298.545) [-1301.095] (-1302.904) -- 0:01:27
      499000 -- (-1299.267) (-1299.232) (-1300.272) [-1300.005] * [-1295.902] (-1300.742) (-1298.506) (-1300.827) -- 0:01:27
      499500 -- [-1299.547] (-1296.475) (-1308.522) (-1300.444) * (-1293.174) (-1307.341) (-1303.702) [-1298.566] -- 0:01:27
      500000 -- (-1296.871) [-1299.032] (-1304.619) (-1301.033) * (-1299.151) (-1298.160) (-1304.256) [-1296.788] -- 0:01:27

      Average standard deviation of split frequencies: 0.001883

      500500 -- [-1295.575] (-1300.619) (-1305.692) (-1298.059) * (-1296.252) [-1294.629] (-1310.224) (-1305.523) -- 0:01:26
      501000 -- (-1293.855) (-1301.391) [-1299.563] (-1301.187) * [-1295.312] (-1295.583) (-1297.886) (-1297.321) -- 0:01:26
      501500 -- (-1301.756) (-1295.684) [-1300.513] (-1300.067) * (-1306.710) [-1296.933] (-1297.990) (-1299.542) -- 0:01:26
      502000 -- (-1300.929) [-1298.276] (-1304.949) (-1301.055) * (-1304.053) (-1297.129) [-1300.256] (-1303.769) -- 0:01:26
      502500 -- (-1297.666) [-1295.999] (-1296.096) (-1304.172) * (-1303.429) (-1302.442) (-1308.754) [-1300.400] -- 0:01:27
      503000 -- (-1295.661) [-1294.695] (-1298.512) (-1296.750) * (-1298.079) [-1295.353] (-1301.951) (-1298.594) -- 0:01:26
      503500 -- (-1298.437) [-1297.713] (-1300.369) (-1296.228) * (-1296.435) [-1298.770] (-1299.170) (-1301.744) -- 0:01:26
      504000 -- [-1295.429] (-1302.670) (-1299.080) (-1298.610) * (-1298.488) (-1297.284) (-1299.539) [-1297.077] -- 0:01:26
      504500 -- [-1301.124] (-1303.048) (-1303.479) (-1303.264) * (-1294.588) [-1293.557] (-1295.443) (-1303.596) -- 0:01:26
      505000 -- (-1295.764) (-1297.057) [-1295.696] (-1297.698) * [-1297.135] (-1298.788) (-1295.083) (-1304.201) -- 0:01:26

      Average standard deviation of split frequencies: 0.001863

      505500 -- (-1297.347) (-1293.033) [-1299.111] (-1297.394) * (-1298.595) [-1295.724] (-1299.619) (-1301.073) -- 0:01:26
      506000 -- (-1296.172) (-1293.799) (-1297.540) [-1298.431] * (-1300.723) (-1295.010) [-1294.893] (-1297.720) -- 0:01:25
      506500 -- (-1306.085) [-1294.512] (-1305.879) (-1308.446) * (-1296.807) (-1302.845) (-1300.210) [-1296.957] -- 0:01:25
      507000 -- [-1302.524] (-1304.158) (-1302.177) (-1305.370) * (-1299.630) [-1294.732] (-1297.818) (-1296.314) -- 0:01:25
      507500 -- (-1302.846) (-1303.745) (-1296.666) [-1298.255] * (-1305.376) (-1296.943) (-1301.113) [-1297.546] -- 0:01:25
      508000 -- (-1301.348) [-1297.398] (-1300.958) (-1297.144) * (-1302.866) (-1297.537) [-1294.687] (-1304.963) -- 0:01:25
      508500 -- [-1296.605] (-1301.993) (-1304.282) (-1296.090) * (-1300.620) [-1295.865] (-1296.887) (-1296.871) -- 0:01:26
      509000 -- (-1304.004) (-1299.361) [-1300.826] (-1300.287) * (-1301.013) (-1296.130) [-1301.805] (-1295.740) -- 0:01:25
      509500 -- [-1296.562] (-1294.969) (-1299.457) (-1297.759) * (-1299.526) [-1297.292] (-1298.387) (-1295.205) -- 0:01:25
      510000 -- (-1297.614) (-1298.688) (-1298.532) [-1298.031] * [-1299.194] (-1295.285) (-1295.572) (-1294.597) -- 0:01:25

      Average standard deviation of split frequencies: 0.001385

      510500 -- (-1295.437) (-1298.006) (-1302.038) [-1295.150] * (-1304.555) (-1295.709) [-1298.164] (-1295.870) -- 0:01:25
      511000 -- (-1295.865) (-1298.050) (-1300.591) [-1299.630] * (-1298.272) [-1293.904] (-1299.477) (-1297.732) -- 0:01:25
      511500 -- (-1296.275) [-1292.765] (-1297.627) (-1295.878) * (-1301.192) [-1292.187] (-1306.106) (-1303.032) -- 0:01:24
      512000 -- [-1297.651] (-1297.121) (-1298.940) (-1294.669) * (-1297.335) [-1296.274] (-1294.511) (-1300.581) -- 0:01:24
      512500 -- [-1295.778] (-1300.946) (-1298.907) (-1299.941) * (-1299.261) (-1303.147) [-1299.143] (-1295.843) -- 0:01:24
      513000 -- (-1298.158) (-1299.126) [-1301.091] (-1292.216) * (-1297.779) (-1296.382) [-1300.618] (-1295.019) -- 0:01:24
      513500 -- (-1304.296) (-1300.558) [-1295.609] (-1296.611) * (-1296.976) (-1300.484) (-1305.324) [-1293.119] -- 0:01:24
      514000 -- (-1298.878) [-1295.072] (-1294.954) (-1300.774) * (-1306.112) (-1311.610) (-1297.013) [-1300.723] -- 0:01:25
      514500 -- (-1302.326) (-1295.918) (-1299.914) [-1295.331] * (-1302.811) (-1298.941) (-1300.175) [-1295.006] -- 0:01:24
      515000 -- (-1301.930) (-1296.330) (-1296.996) [-1298.922] * [-1297.140] (-1300.954) (-1296.995) (-1294.286) -- 0:01:24

      Average standard deviation of split frequencies: 0.001370

      515500 -- [-1298.253] (-1297.058) (-1299.775) (-1303.179) * (-1299.232) (-1302.740) [-1298.373] (-1294.392) -- 0:01:24
      516000 -- (-1301.741) (-1301.912) [-1296.879] (-1313.002) * (-1295.042) [-1298.805] (-1300.586) (-1301.474) -- 0:01:24
      516500 -- (-1295.507) [-1294.899] (-1300.651) (-1313.905) * (-1296.717) (-1302.689) (-1302.112) [-1301.940] -- 0:01:24
      517000 -- (-1297.803) [-1298.026] (-1301.720) (-1302.202) * (-1297.475) [-1297.430] (-1297.649) (-1300.147) -- 0:01:24
      517500 -- [-1304.680] (-1301.470) (-1313.330) (-1303.839) * (-1300.930) (-1300.613) [-1303.328] (-1300.545) -- 0:01:23
      518000 -- (-1300.494) (-1294.786) (-1300.241) [-1295.460] * [-1301.459] (-1297.930) (-1303.658) (-1299.418) -- 0:01:23
      518500 -- [-1305.027] (-1296.836) (-1295.914) (-1302.699) * (-1311.925) (-1301.963) [-1296.227] (-1299.361) -- 0:01:23
      519000 -- (-1304.235) (-1302.694) (-1297.444) [-1295.814] * (-1298.302) (-1306.473) (-1299.098) [-1299.164] -- 0:01:23
      519500 -- (-1298.792) [-1297.852] (-1300.562) (-1297.582) * (-1293.332) (-1304.449) [-1293.935] (-1295.577) -- 0:01:23
      520000 -- [-1296.470] (-1300.316) (-1304.386) (-1302.752) * [-1293.723] (-1296.714) (-1296.214) (-1301.200) -- 0:01:24

      Average standard deviation of split frequencies: 0.001358

      520500 -- [-1292.788] (-1307.392) (-1297.950) (-1300.502) * (-1296.265) (-1293.491) [-1294.426] (-1302.204) -- 0:01:23
      521000 -- (-1299.012) (-1297.306) [-1302.013] (-1296.901) * (-1305.570) [-1297.938] (-1294.239) (-1295.226) -- 0:01:23
      521500 -- (-1303.271) [-1304.094] (-1297.864) (-1299.664) * (-1302.867) [-1299.681] (-1295.543) (-1297.800) -- 0:01:23
      522000 -- (-1300.131) (-1295.182) [-1292.604] (-1299.186) * [-1295.868] (-1304.440) (-1301.211) (-1297.073) -- 0:01:23
      522500 -- (-1295.457) (-1295.920) [-1297.898] (-1296.935) * (-1295.148) [-1299.537] (-1303.128) (-1309.231) -- 0:01:23
      523000 -- (-1296.011) (-1298.135) [-1294.047] (-1299.889) * [-1295.225] (-1295.833) (-1306.864) (-1307.191) -- 0:01:22
      523500 -- (-1305.511) (-1306.106) (-1300.169) [-1296.028] * [-1298.192] (-1295.198) (-1298.293) (-1298.440) -- 0:01:22
      524000 -- (-1300.179) (-1302.088) (-1302.170) [-1295.108] * (-1294.040) (-1298.371) (-1304.030) [-1300.856] -- 0:01:22
      524500 -- (-1301.625) (-1295.503) [-1294.448] (-1302.591) * (-1298.524) [-1294.097] (-1297.094) (-1300.559) -- 0:01:22
      525000 -- (-1304.505) [-1298.172] (-1296.986) (-1296.693) * (-1302.881) (-1295.843) (-1306.357) [-1293.876] -- 0:01:22

      Average standard deviation of split frequencies: 0.001344

      525500 -- (-1297.273) (-1296.337) (-1303.229) [-1302.936] * (-1297.199) (-1297.644) (-1301.772) [-1297.532] -- 0:01:22
      526000 -- (-1303.187) [-1296.597] (-1294.043) (-1304.068) * (-1295.406) (-1295.542) [-1294.043] (-1303.594) -- 0:01:22
      526500 -- (-1302.035) (-1299.398) [-1297.455] (-1297.621) * (-1297.211) (-1299.780) [-1292.958] (-1297.655) -- 0:01:22
      527000 -- (-1294.717) [-1298.831] (-1299.714) (-1297.166) * (-1298.917) (-1301.913) (-1295.423) [-1297.706] -- 0:01:22
      527500 -- [-1302.237] (-1293.756) (-1295.247) (-1296.832) * (-1292.340) (-1303.659) (-1303.920) [-1300.258] -- 0:01:22
      528000 -- [-1296.569] (-1304.250) (-1299.834) (-1298.409) * (-1295.308) (-1297.607) (-1297.346) [-1300.683] -- 0:01:22
      528500 -- (-1296.679) [-1299.679] (-1296.571) (-1305.734) * (-1298.825) (-1300.556) (-1303.178) [-1295.491] -- 0:01:22
      529000 -- [-1297.364] (-1295.330) (-1299.465) (-1302.571) * (-1298.261) (-1303.241) [-1298.976] (-1293.397) -- 0:01:21
      529500 -- (-1294.450) [-1294.999] (-1293.876) (-1299.966) * (-1299.891) [-1297.080] (-1297.400) (-1302.246) -- 0:01:21
      530000 -- (-1298.499) (-1298.981) (-1298.189) [-1300.054] * (-1296.736) (-1300.652) [-1302.274] (-1302.155) -- 0:01:21

      Average standard deviation of split frequencies: 0.001332

      530500 -- (-1300.734) (-1295.319) (-1293.429) [-1303.571] * (-1298.220) (-1301.496) (-1303.342) [-1293.433] -- 0:01:21
      531000 -- (-1299.236) (-1298.880) (-1293.751) [-1300.430] * (-1298.041) [-1293.666] (-1296.222) (-1303.027) -- 0:01:21
      531500 -- (-1298.483) [-1294.881] (-1298.197) (-1302.438) * (-1302.015) [-1294.115] (-1294.996) (-1296.820) -- 0:01:21
      532000 -- (-1299.515) (-1300.115) (-1300.019) [-1296.632] * (-1299.998) [-1293.665] (-1292.121) (-1296.200) -- 0:01:21
      532500 -- [-1295.050] (-1294.058) (-1298.298) (-1296.082) * [-1300.071] (-1296.851) (-1297.612) (-1295.908) -- 0:01:21
      533000 -- (-1293.152) [-1295.140] (-1303.485) (-1292.850) * [-1305.776] (-1294.889) (-1303.001) (-1300.859) -- 0:01:21
      533500 -- (-1298.010) (-1300.137) (-1302.860) [-1292.991] * (-1294.397) (-1299.630) (-1297.319) [-1299.474] -- 0:01:21
      534000 -- (-1310.084) (-1294.850) [-1296.778] (-1299.131) * (-1299.226) (-1298.724) [-1296.461] (-1301.820) -- 0:01:21
      534500 -- (-1296.620) (-1295.788) (-1293.089) [-1303.220] * (-1301.451) (-1295.857) [-1296.454] (-1303.379) -- 0:01:20
      535000 -- (-1298.390) (-1302.680) (-1294.110) [-1295.348] * (-1297.396) [-1296.674] (-1301.824) (-1300.224) -- 0:01:20

      Average standard deviation of split frequencies: 0.001319

      535500 -- (-1300.610) (-1297.876) [-1295.610] (-1297.975) * [-1296.480] (-1298.680) (-1303.286) (-1300.812) -- 0:01:20
      536000 -- (-1306.442) (-1299.280) (-1300.832) [-1301.716] * (-1297.032) [-1294.331] (-1299.920) (-1295.946) -- 0:01:20
      536500 -- (-1292.862) [-1298.460] (-1302.489) (-1299.544) * [-1296.835] (-1296.496) (-1297.889) (-1306.648) -- 0:01:20
      537000 -- (-1301.845) (-1298.262) (-1299.104) [-1298.456] * [-1293.167] (-1298.057) (-1297.777) (-1301.723) -- 0:01:20
      537500 -- [-1297.688] (-1296.420) (-1299.725) (-1294.923) * (-1306.451) [-1300.166] (-1301.063) (-1307.171) -- 0:01:20
      538000 -- [-1294.780] (-1309.341) (-1296.294) (-1297.906) * (-1302.912) [-1298.184] (-1297.922) (-1300.203) -- 0:01:20
      538500 -- (-1297.150) (-1308.138) [-1299.670] (-1294.142) * [-1296.201] (-1301.490) (-1294.033) (-1307.396) -- 0:01:20
      539000 -- (-1306.890) (-1302.820) [-1292.863] (-1303.353) * (-1294.466) (-1299.593) [-1291.901] (-1295.759) -- 0:01:20
      539500 -- (-1304.473) (-1304.224) [-1295.807] (-1301.765) * [-1295.031] (-1298.555) (-1296.818) (-1300.803) -- 0:01:20
      540000 -- [-1296.556] (-1297.187) (-1302.604) (-1299.304) * (-1296.243) (-1298.997) (-1298.325) [-1296.429] -- 0:01:20

      Average standard deviation of split frequencies: 0.001308

      540500 -- (-1296.630) [-1302.256] (-1300.393) (-1307.389) * (-1299.037) [-1300.465] (-1300.714) (-1299.815) -- 0:01:19
      541000 -- (-1295.894) (-1293.874) [-1301.061] (-1293.269) * (-1297.168) (-1298.935) (-1300.529) [-1295.447] -- 0:01:19
      541500 -- [-1300.337] (-1304.529) (-1296.616) (-1299.917) * (-1299.228) (-1297.367) [-1301.152] (-1296.707) -- 0:01:19
      542000 -- [-1296.004] (-1307.060) (-1303.762) (-1298.989) * (-1298.131) (-1294.045) [-1306.715] (-1303.047) -- 0:01:19
      542500 -- [-1295.582] (-1300.793) (-1300.694) (-1298.684) * (-1308.693) (-1301.095) (-1310.239) [-1297.218] -- 0:01:19
      543000 -- (-1300.271) (-1304.048) (-1294.373) [-1295.056] * (-1299.170) [-1296.646] (-1300.944) (-1304.194) -- 0:01:19
      543500 -- (-1304.098) (-1303.480) (-1296.451) [-1301.207] * [-1301.024] (-1300.302) (-1303.023) (-1297.569) -- 0:01:19
      544000 -- (-1300.175) (-1302.987) (-1295.464) [-1300.245] * [-1294.711] (-1303.912) (-1296.832) (-1300.826) -- 0:01:19
      544500 -- (-1300.125) (-1303.447) (-1304.120) [-1298.999] * (-1300.752) (-1296.349) (-1307.530) [-1299.919] -- 0:01:19
      545000 -- (-1302.164) (-1306.293) [-1298.188] (-1301.306) * (-1300.308) (-1296.504) (-1296.567) [-1298.289] -- 0:01:19

      Average standard deviation of split frequencies: 0.001295

      545500 -- [-1300.776] (-1302.773) (-1300.021) (-1297.792) * [-1297.613] (-1301.440) (-1301.595) (-1295.332) -- 0:01:19
      546000 -- (-1305.855) [-1300.182] (-1297.446) (-1297.748) * [-1301.566] (-1313.800) (-1300.234) (-1297.568) -- 0:01:18
      546500 -- (-1306.032) (-1299.351) (-1301.041) [-1299.664] * [-1301.833] (-1296.641) (-1294.633) (-1298.463) -- 0:01:18
      547000 -- (-1304.532) (-1308.676) (-1304.541) [-1297.063] * (-1298.032) (-1295.895) (-1303.627) [-1296.509] -- 0:01:18
      547500 -- [-1299.868] (-1292.556) (-1303.412) (-1303.152) * (-1300.232) [-1293.804] (-1297.741) (-1298.336) -- 0:01:18
      548000 -- (-1298.268) (-1296.530) (-1300.118) [-1298.968] * [-1297.772] (-1297.190) (-1304.365) (-1300.754) -- 0:01:18
      548500 -- (-1305.680) (-1296.174) (-1312.012) [-1298.534] * [-1296.094] (-1300.072) (-1301.512) (-1300.138) -- 0:01:18
      549000 -- [-1301.942] (-1299.896) (-1301.266) (-1295.033) * [-1297.233] (-1298.333) (-1307.853) (-1305.454) -- 0:01:18
      549500 -- (-1299.251) (-1305.860) [-1296.663] (-1296.878) * [-1294.903] (-1302.120) (-1300.059) (-1299.470) -- 0:01:18
      550000 -- (-1295.926) (-1300.991) [-1296.829] (-1298.552) * (-1296.977) (-1307.997) (-1301.745) [-1296.808] -- 0:01:18

      Average standard deviation of split frequencies: 0.001284

      550500 -- [-1297.723] (-1296.789) (-1293.544) (-1296.210) * [-1294.640] (-1298.219) (-1300.291) (-1306.722) -- 0:01:18
      551000 -- (-1298.801) (-1302.869) (-1302.991) [-1294.806] * (-1296.685) (-1294.517) (-1301.185) [-1300.457] -- 0:01:18
      551500 -- (-1303.240) [-1298.118] (-1299.582) (-1299.751) * (-1297.818) (-1300.462) (-1295.882) [-1295.255] -- 0:01:18
      552000 -- [-1298.159] (-1304.367) (-1297.983) (-1300.218) * (-1298.628) (-1301.759) [-1299.861] (-1296.979) -- 0:01:17
      552500 -- (-1298.616) (-1297.009) (-1296.892) [-1296.682] * (-1294.649) (-1295.285) [-1295.728] (-1306.090) -- 0:01:17
      553000 -- (-1303.294) (-1303.276) (-1298.811) [-1295.250] * (-1295.315) [-1294.394] (-1295.510) (-1305.407) -- 0:01:17
      553500 -- (-1301.964) (-1305.302) (-1303.547) [-1296.511] * (-1302.519) (-1298.613) [-1297.405] (-1297.870) -- 0:01:17
      554000 -- (-1302.127) (-1294.499) (-1305.623) [-1293.969] * (-1294.937) [-1298.826] (-1300.576) (-1301.864) -- 0:01:17
      554500 -- (-1302.651) (-1299.256) (-1301.985) [-1297.149] * (-1294.718) [-1294.018] (-1299.861) (-1302.730) -- 0:01:17
      555000 -- (-1302.833) (-1298.127) [-1296.555] (-1296.239) * (-1299.841) (-1300.282) [-1299.382] (-1294.428) -- 0:01:17

      Average standard deviation of split frequencies: 0.001272

      555500 -- (-1299.065) [-1296.793] (-1296.764) (-1303.790) * (-1298.290) (-1299.683) (-1294.660) [-1299.672] -- 0:01:17
      556000 -- [-1302.445] (-1300.287) (-1300.851) (-1301.009) * (-1299.179) [-1303.113] (-1301.117) (-1298.648) -- 0:01:17
      556500 -- (-1300.134) (-1301.579) (-1298.539) [-1302.463] * (-1301.344) [-1296.547] (-1294.404) (-1296.518) -- 0:01:17
      557000 -- [-1297.188] (-1302.176) (-1298.438) (-1300.891) * (-1304.540) (-1297.797) (-1296.236) [-1295.733] -- 0:01:17
      557500 -- (-1296.696) (-1302.182) (-1296.791) [-1297.723] * (-1297.570) (-1293.390) [-1301.155] (-1295.384) -- 0:01:16
      558000 -- (-1299.830) (-1297.122) (-1299.217) [-1300.624] * (-1297.201) (-1296.875) (-1302.251) [-1299.886] -- 0:01:16
      558500 -- (-1296.028) [-1297.751] (-1300.723) (-1300.017) * [-1295.047] (-1296.250) (-1303.147) (-1296.867) -- 0:01:16
      559000 -- (-1300.380) (-1295.593) (-1301.712) [-1295.985] * (-1299.408) (-1298.790) (-1296.662) [-1297.971] -- 0:01:16
      559500 -- [-1300.312] (-1294.804) (-1303.281) (-1297.485) * (-1297.358) (-1296.404) [-1296.504] (-1303.457) -- 0:01:16
      560000 -- (-1300.376) [-1294.331] (-1296.761) (-1297.287) * (-1306.764) [-1298.609] (-1297.601) (-1298.643) -- 0:01:16

      Average standard deviation of split frequencies: 0.001261

      560500 -- (-1303.180) (-1298.570) [-1295.613] (-1298.551) * (-1301.422) [-1292.103] (-1297.678) (-1304.145) -- 0:01:16
      561000 -- (-1298.412) [-1298.731] (-1304.536) (-1304.567) * (-1301.224) [-1293.961] (-1295.990) (-1300.246) -- 0:01:16
      561500 -- (-1303.795) [-1299.442] (-1305.439) (-1300.129) * (-1298.380) (-1297.800) [-1297.416] (-1298.653) -- 0:01:16
      562000 -- (-1299.816) (-1301.821) [-1302.865] (-1299.850) * (-1297.689) (-1298.516) (-1297.377) [-1293.480] -- 0:01:16
      562500 -- (-1300.454) (-1299.066) (-1296.175) [-1296.534] * (-1297.654) (-1301.821) (-1299.362) [-1294.593] -- 0:01:16
      563000 -- (-1304.767) (-1302.323) [-1294.560] (-1305.465) * (-1301.880) (-1306.248) (-1299.252) [-1296.080] -- 0:01:16
      563500 -- (-1308.285) [-1294.407] (-1300.588) (-1295.299) * (-1298.317) (-1298.088) (-1298.974) [-1298.136] -- 0:01:15
      564000 -- (-1306.917) [-1298.156] (-1297.359) (-1302.526) * (-1298.466) (-1302.758) (-1299.425) [-1299.064] -- 0:01:15
      564500 -- [-1301.531] (-1298.594) (-1299.310) (-1297.387) * (-1299.483) (-1302.889) [-1296.382] (-1306.245) -- 0:01:15
      565000 -- (-1297.919) (-1298.672) (-1301.804) [-1292.425] * [-1299.361] (-1303.998) (-1299.680) (-1302.707) -- 0:01:15

      Average standard deviation of split frequencies: 0.001249

      565500 -- (-1299.198) [-1294.071] (-1304.689) (-1305.381) * (-1298.326) (-1299.103) [-1303.134] (-1298.564) -- 0:01:15
      566000 -- (-1296.960) (-1297.675) (-1298.936) [-1302.677] * (-1301.351) [-1299.690] (-1298.127) (-1305.877) -- 0:01:15
      566500 -- (-1301.221) (-1301.330) (-1305.086) [-1299.250] * (-1300.310) (-1299.538) (-1295.273) [-1295.995] -- 0:01:14
      567000 -- (-1298.118) (-1298.431) (-1298.877) [-1295.127] * (-1295.971) (-1302.758) [-1295.002] (-1299.103) -- 0:01:15
      567500 -- (-1302.924) (-1300.169) [-1302.234] (-1298.484) * (-1306.722) (-1300.116) [-1295.879] (-1302.944) -- 0:01:15
      568000 -- [-1302.292] (-1294.067) (-1299.393) (-1299.656) * (-1304.521) (-1303.037) [-1298.326] (-1301.838) -- 0:01:15
      568500 -- (-1296.365) (-1297.427) (-1297.415) [-1303.853] * (-1302.238) (-1301.504) (-1298.014) [-1293.626] -- 0:01:15
      569000 -- (-1296.280) (-1308.978) [-1296.575] (-1299.853) * (-1296.834) [-1296.605] (-1302.314) (-1293.739) -- 0:01:14
      569500 -- (-1295.737) (-1307.290) [-1293.568] (-1296.658) * (-1292.921) [-1294.465] (-1296.435) (-1299.192) -- 0:01:14
      570000 -- [-1300.928] (-1294.919) (-1293.595) (-1299.312) * [-1293.539] (-1298.053) (-1303.948) (-1307.342) -- 0:01:14

      Average standard deviation of split frequencies: 0.001239

      570500 -- (-1304.278) (-1295.538) [-1299.070] (-1298.857) * (-1298.298) [-1298.609] (-1300.000) (-1303.331) -- 0:01:14
      571000 -- (-1305.773) [-1298.699] (-1298.142) (-1305.916) * [-1300.075] (-1299.810) (-1297.823) (-1301.787) -- 0:01:14
      571500 -- (-1304.764) [-1292.598] (-1304.073) (-1303.698) * (-1297.092) (-1295.670) [-1299.271] (-1297.442) -- 0:01:14
      572000 -- (-1303.338) [-1293.489] (-1297.334) (-1299.632) * [-1299.983] (-1305.329) (-1303.764) (-1295.789) -- 0:01:14
      572500 -- (-1299.836) (-1293.728) (-1296.331) [-1294.978] * (-1299.749) (-1299.971) (-1306.757) [-1300.499] -- 0:01:14
      573000 -- (-1301.945) [-1295.735] (-1304.403) (-1296.037) * [-1297.862] (-1299.014) (-1303.740) (-1294.906) -- 0:01:14
      573500 -- [-1301.705] (-1295.277) (-1299.489) (-1297.218) * (-1300.731) (-1299.727) [-1295.589] (-1297.215) -- 0:01:14
      574000 -- (-1302.630) [-1296.998] (-1304.349) (-1299.861) * (-1295.441) (-1297.651) (-1298.309) [-1295.370] -- 0:01:14
      574500 -- (-1298.998) (-1297.741) (-1301.136) [-1293.334] * [-1309.785] (-1297.010) (-1294.059) (-1302.690) -- 0:01:14
      575000 -- (-1303.755) (-1296.579) (-1295.656) [-1295.842] * (-1309.699) [-1296.805] (-1299.819) (-1295.806) -- 0:01:13

      Average standard deviation of split frequencies: 0.001228

      575500 -- (-1299.310) (-1306.404) [-1300.017] (-1302.695) * (-1299.196) [-1302.944] (-1297.333) (-1307.661) -- 0:01:13
      576000 -- [-1297.985] (-1303.744) (-1298.717) (-1302.323) * [-1297.454] (-1299.407) (-1296.574) (-1300.741) -- 0:01:13
      576500 -- (-1294.288) (-1301.488) (-1303.548) [-1299.955] * (-1303.976) [-1293.577] (-1299.960) (-1303.036) -- 0:01:13
      577000 -- [-1293.810] (-1302.183) (-1299.218) (-1300.337) * (-1301.958) [-1298.693] (-1302.915) (-1296.294) -- 0:01:13
      577500 -- [-1298.561] (-1298.123) (-1306.062) (-1293.047) * (-1294.638) (-1295.818) [-1300.046] (-1298.019) -- 0:01:13
      578000 -- (-1300.890) (-1301.435) [-1295.182] (-1302.595) * (-1299.453) [-1297.099] (-1302.398) (-1297.354) -- 0:01:13
      578500 -- (-1298.677) (-1297.147) [-1297.966] (-1298.662) * (-1301.840) (-1292.005) (-1312.609) [-1295.753] -- 0:01:13
      579000 -- (-1305.756) [-1297.605] (-1294.270) (-1297.343) * (-1298.828) [-1292.916] (-1305.901) (-1301.092) -- 0:01:13
      579500 -- [-1299.007] (-1301.056) (-1297.155) (-1295.610) * [-1296.017] (-1295.812) (-1305.391) (-1299.050) -- 0:01:13
      580000 -- [-1301.425] (-1305.062) (-1299.701) (-1301.582) * (-1300.459) (-1301.821) (-1305.861) [-1298.290] -- 0:01:13

      Average standard deviation of split frequencies: 0.001218

      580500 -- [-1297.103] (-1296.560) (-1298.685) (-1304.577) * (-1303.782) (-1299.720) (-1303.158) [-1296.596] -- 0:01:12
      581000 -- (-1300.116) (-1300.516) [-1298.401] (-1303.708) * (-1305.944) (-1301.559) (-1297.760) [-1296.414] -- 0:01:12
      581500 -- (-1294.934) (-1297.833) (-1295.624) [-1296.735] * (-1298.692) (-1301.499) (-1293.964) [-1297.013] -- 0:01:12
      582000 -- (-1296.074) [-1299.290] (-1295.017) (-1300.133) * (-1297.638) [-1305.114] (-1299.320) (-1299.278) -- 0:01:12
      582500 -- [-1294.069] (-1301.859) (-1303.546) (-1298.356) * (-1301.782) (-1297.922) [-1298.214] (-1296.264) -- 0:01:12
      583000 -- [-1295.259] (-1296.927) (-1296.239) (-1295.257) * (-1296.299) [-1297.889] (-1308.175) (-1300.658) -- 0:01:12
      583500 -- (-1292.989) [-1296.933] (-1300.628) (-1303.626) * [-1300.167] (-1291.878) (-1298.780) (-1300.169) -- 0:01:12
      584000 -- (-1296.476) (-1293.153) (-1298.216) [-1302.008] * (-1304.228) [-1296.812] (-1294.731) (-1299.567) -- 0:01:11
      584500 -- (-1295.095) [-1302.178] (-1299.880) (-1300.314) * (-1294.132) (-1297.519) (-1298.032) [-1292.274] -- 0:01:12
      585000 -- [-1296.277] (-1306.090) (-1296.605) (-1303.897) * (-1296.970) (-1296.144) [-1297.156] (-1303.604) -- 0:01:12

      Average standard deviation of split frequencies: 0.001207

      585500 -- (-1300.713) (-1303.416) (-1299.753) [-1297.893] * (-1297.487) [-1300.481] (-1294.797) (-1304.511) -- 0:01:12
      586000 -- (-1298.342) (-1299.117) [-1296.491] (-1293.869) * (-1294.412) (-1299.235) [-1301.602] (-1295.474) -- 0:01:12
      586500 -- (-1292.007) (-1298.826) (-1297.183) [-1296.630] * [-1299.745] (-1300.797) (-1300.104) (-1295.946) -- 0:01:11
      587000 -- [-1291.589] (-1301.150) (-1301.957) (-1297.168) * (-1297.915) (-1295.352) (-1305.181) [-1298.152] -- 0:01:11
      587500 -- [-1294.175] (-1303.941) (-1297.292) (-1296.882) * (-1298.849) [-1301.108] (-1300.932) (-1301.421) -- 0:01:11
      588000 -- [-1301.274] (-1294.662) (-1296.641) (-1296.844) * (-1297.123) (-1301.840) (-1300.191) [-1300.006] -- 0:01:11
      588500 -- [-1296.192] (-1303.135) (-1295.089) (-1295.614) * (-1301.226) (-1309.499) [-1297.275] (-1298.235) -- 0:01:11
      589000 -- (-1299.406) (-1300.091) [-1293.416] (-1301.173) * (-1297.314) (-1296.864) (-1300.617) [-1297.982] -- 0:01:11
      589500 -- (-1297.728) [-1297.556] (-1297.619) (-1299.244) * (-1304.185) (-1296.457) (-1300.530) [-1297.855] -- 0:01:11
      590000 -- [-1301.353] (-1296.214) (-1294.441) (-1296.858) * (-1299.400) [-1294.338] (-1296.221) (-1295.342) -- 0:01:11

      Average standard deviation of split frequencies: 0.001197

      590500 -- [-1295.620] (-1307.060) (-1302.689) (-1300.942) * (-1303.458) (-1298.601) [-1301.461] (-1294.207) -- 0:01:11
      591000 -- (-1299.819) [-1302.005] (-1296.250) (-1305.010) * (-1298.860) (-1296.267) (-1296.334) [-1296.889] -- 0:01:11
      591500 -- (-1305.873) (-1299.163) (-1303.124) [-1297.789] * (-1299.612) (-1297.614) [-1296.195] (-1298.678) -- 0:01:11
      592000 -- (-1299.485) [-1298.434] (-1298.806) (-1298.673) * [-1296.728] (-1300.066) (-1301.099) (-1300.842) -- 0:01:10
      592500 -- (-1302.162) (-1300.672) [-1295.290] (-1298.196) * (-1298.668) (-1301.315) [-1299.931] (-1304.599) -- 0:01:10
      593000 -- (-1294.736) (-1298.375) [-1295.263] (-1297.856) * [-1293.172] (-1297.570) (-1299.876) (-1298.002) -- 0:01:10
      593500 -- [-1296.299] (-1305.615) (-1295.783) (-1299.022) * (-1292.704) (-1296.543) (-1293.322) [-1295.894] -- 0:01:10
      594000 -- (-1303.238) (-1300.122) [-1297.897] (-1305.761) * [-1298.547] (-1300.562) (-1298.882) (-1302.369) -- 0:01:10
      594500 -- (-1296.253) (-1297.984) (-1304.196) [-1295.591] * [-1296.397] (-1296.561) (-1303.619) (-1306.668) -- 0:01:10
      595000 -- (-1299.763) (-1299.311) (-1302.660) [-1295.144] * (-1298.567) [-1298.006] (-1301.274) (-1299.101) -- 0:01:10

      Average standard deviation of split frequencies: 0.001186

      595500 -- (-1305.222) [-1295.881] (-1303.039) (-1295.842) * (-1296.189) [-1298.533] (-1301.032) (-1302.248) -- 0:01:09
      596000 -- (-1303.815) (-1295.124) (-1302.563) [-1297.255] * (-1304.373) [-1299.486] (-1300.159) (-1297.240) -- 0:01:10
      596500 -- (-1299.970) (-1299.223) (-1301.951) [-1294.513] * [-1303.428] (-1298.865) (-1296.304) (-1302.258) -- 0:01:10
      597000 -- (-1302.715) [-1294.442] (-1307.163) (-1298.858) * [-1302.824] (-1297.076) (-1303.522) (-1302.944) -- 0:01:10
      597500 -- (-1303.454) (-1300.853) (-1309.118) [-1298.098] * [-1299.062] (-1296.287) (-1297.480) (-1301.173) -- 0:01:10
      598000 -- (-1300.014) (-1304.023) (-1300.189) [-1294.785] * (-1296.211) (-1299.348) [-1299.166] (-1298.540) -- 0:01:09
      598500 -- [-1297.441] (-1302.053) (-1299.425) (-1298.255) * (-1300.186) (-1298.880) [-1295.522] (-1300.990) -- 0:01:09
      599000 -- (-1303.633) (-1295.847) (-1295.319) [-1300.273] * (-1297.311) (-1300.298) [-1292.960] (-1303.449) -- 0:01:09
      599500 -- (-1303.352) (-1303.073) [-1298.636] (-1300.140) * (-1301.619) (-1302.118) [-1293.060] (-1293.010) -- 0:01:09
      600000 -- (-1305.610) [-1298.926] (-1299.905) (-1297.205) * [-1294.393] (-1298.554) (-1292.873) (-1309.616) -- 0:01:09

      Average standard deviation of split frequencies: 0.001177

      600500 -- (-1299.738) [-1296.316] (-1313.909) (-1301.815) * [-1297.660] (-1305.559) (-1295.905) (-1297.739) -- 0:01:09
      601000 -- (-1298.637) (-1301.001) (-1298.409) [-1293.895] * (-1299.173) (-1297.905) (-1296.853) [-1297.122] -- 0:01:09
      601500 -- (-1296.504) (-1298.405) [-1296.078] (-1301.995) * (-1300.638) (-1298.916) [-1294.814] (-1298.834) -- 0:01:08
      602000 -- [-1293.627] (-1297.512) (-1294.744) (-1298.573) * (-1298.589) (-1305.533) [-1294.503] (-1302.706) -- 0:01:09
      602500 -- [-1302.164] (-1300.126) (-1295.923) (-1297.112) * (-1301.688) [-1297.022] (-1300.217) (-1299.505) -- 0:01:09
      603000 -- (-1302.638) (-1298.169) (-1300.275) [-1295.843] * (-1302.811) (-1304.693) (-1293.543) [-1297.556] -- 0:01:09
      603500 -- (-1301.043) (-1298.036) (-1298.524) [-1293.037] * (-1303.376) (-1311.640) [-1295.632] (-1298.820) -- 0:01:08
      604000 -- (-1298.808) (-1301.079) [-1296.399] (-1295.696) * (-1301.455) [-1296.594] (-1297.903) (-1302.426) -- 0:01:08
      604500 -- [-1295.560] (-1294.703) (-1297.924) (-1296.654) * (-1298.467) (-1301.886) [-1298.746] (-1301.064) -- 0:01:08
      605000 -- (-1301.270) [-1299.276] (-1298.061) (-1307.166) * (-1305.350) [-1293.587] (-1302.036) (-1301.412) -- 0:01:08

      Average standard deviation of split frequencies: 0.001167

      605500 -- (-1299.937) (-1301.575) [-1297.024] (-1301.214) * (-1298.256) (-1305.163) [-1297.719] (-1302.483) -- 0:01:08
      606000 -- (-1301.963) (-1295.412) [-1295.271] (-1298.972) * [-1297.725] (-1300.685) (-1293.167) (-1302.104) -- 0:01:08
      606500 -- (-1298.572) (-1299.682) [-1294.393] (-1305.825) * [-1301.547] (-1298.181) (-1294.382) (-1293.611) -- 0:01:08
      607000 -- (-1296.996) (-1300.511) [-1296.639] (-1310.029) * (-1298.158) (-1299.823) (-1294.636) [-1296.035] -- 0:01:07
      607500 -- [-1298.316] (-1299.123) (-1296.442) (-1301.513) * [-1298.019] (-1299.106) (-1296.490) (-1304.364) -- 0:01:08
      608000 -- (-1304.243) (-1301.365) [-1296.354] (-1302.573) * (-1303.930) (-1298.303) (-1298.733) [-1297.958] -- 0:01:08
      608500 -- (-1298.348) (-1304.511) (-1298.412) [-1294.834] * (-1300.677) (-1298.355) (-1304.194) [-1294.990] -- 0:01:08
      609000 -- (-1306.530) [-1300.471] (-1299.131) (-1300.633) * [-1299.244] (-1299.470) (-1296.274) (-1297.405) -- 0:01:08
      609500 -- (-1303.625) (-1302.265) (-1300.134) [-1296.137] * (-1301.333) (-1304.480) [-1301.581] (-1302.797) -- 0:01:07
      610000 -- (-1304.904) (-1304.171) (-1304.272) [-1293.828] * (-1295.064) (-1306.905) (-1299.493) [-1299.785] -- 0:01:07

      Average standard deviation of split frequencies: 0.001158

      610500 -- [-1297.950] (-1298.459) (-1294.243) (-1297.324) * (-1299.554) (-1296.003) (-1303.475) [-1297.033] -- 0:01:07
      611000 -- [-1295.546] (-1300.267) (-1300.138) (-1293.829) * [-1296.163] (-1298.350) (-1305.163) (-1293.208) -- 0:01:07
      611500 -- (-1295.365) (-1305.895) (-1302.305) [-1297.373] * (-1297.166) (-1298.761) (-1294.646) [-1299.912] -- 0:01:07
      612000 -- [-1298.109] (-1301.299) (-1295.822) (-1298.500) * [-1296.124] (-1296.384) (-1297.331) (-1292.871) -- 0:01:07
      612500 -- (-1300.193) [-1299.847] (-1295.438) (-1298.322) * (-1301.878) (-1298.817) (-1298.171) [-1292.815] -- 0:01:07
      613000 -- [-1297.423] (-1304.114) (-1295.109) (-1304.897) * (-1297.932) [-1298.616] (-1298.425) (-1300.037) -- 0:01:06
      613500 -- (-1307.116) [-1295.559] (-1308.964) (-1299.532) * (-1296.537) (-1301.407) [-1297.458] (-1302.949) -- 0:01:07
      614000 -- (-1303.143) (-1304.005) [-1297.352] (-1294.340) * (-1295.751) (-1298.465) [-1299.395] (-1297.920) -- 0:01:07
      614500 -- [-1304.314] (-1304.421) (-1297.473) (-1297.147) * [-1294.141] (-1297.492) (-1298.254) (-1296.397) -- 0:01:07
      615000 -- (-1298.451) (-1302.491) (-1292.139) [-1302.213] * (-1300.559) (-1295.083) [-1294.484] (-1292.207) -- 0:01:06

      Average standard deviation of split frequencies: 0.001148

      615500 -- (-1297.120) [-1300.192] (-1291.666) (-1295.790) * (-1298.321) (-1307.153) [-1293.836] (-1302.459) -- 0:01:06
      616000 -- [-1296.020] (-1298.745) (-1302.698) (-1303.221) * (-1301.016) (-1304.012) (-1298.204) [-1301.501] -- 0:01:06
      616500 -- (-1298.077) (-1298.966) (-1297.355) [-1298.644] * (-1299.575) [-1301.588] (-1306.794) (-1303.618) -- 0:01:06
      617000 -- (-1299.261) [-1299.079] (-1298.912) (-1302.578) * (-1295.881) (-1298.752) (-1299.100) [-1296.688] -- 0:01:06
      617500 -- [-1300.251] (-1293.081) (-1298.724) (-1294.067) * (-1296.455) (-1299.150) (-1299.839) [-1299.069] -- 0:01:06
      618000 -- (-1299.236) (-1299.291) [-1300.332] (-1300.642) * (-1296.229) (-1302.038) [-1295.981] (-1297.130) -- 0:01:06
      618500 -- [-1299.053] (-1309.834) (-1298.735) (-1298.019) * [-1296.451] (-1302.300) (-1303.024) (-1300.381) -- 0:01:05
      619000 -- (-1297.843) (-1315.219) (-1297.928) [-1298.973] * (-1300.541) (-1300.345) (-1306.539) [-1301.693] -- 0:01:05
      619500 -- (-1298.185) (-1299.668) [-1304.227] (-1304.109) * (-1302.398) (-1305.026) (-1304.836) [-1300.928] -- 0:01:06
      620000 -- (-1299.098) (-1299.162) (-1300.209) [-1297.218] * (-1302.006) [-1296.872] (-1301.686) (-1296.970) -- 0:01:06

      Average standard deviation of split frequencies: 0.001139

      620500 -- [-1302.676] (-1300.364) (-1297.775) (-1299.432) * (-1305.256) [-1298.230] (-1294.532) (-1304.076) -- 0:01:06
      621000 -- (-1300.047) (-1301.764) (-1298.326) [-1306.953] * (-1295.025) [-1301.074] (-1295.889) (-1303.209) -- 0:01:05
      621500 -- [-1299.095] (-1304.224) (-1296.101) (-1297.340) * [-1300.619] (-1302.531) (-1298.654) (-1306.368) -- 0:01:05
      622000 -- [-1302.949] (-1298.819) (-1299.908) (-1297.777) * (-1296.059) (-1301.026) [-1294.192] (-1300.111) -- 0:01:05
      622500 -- [-1300.624] (-1299.516) (-1298.251) (-1298.943) * (-1299.626) (-1297.169) (-1300.352) [-1297.558] -- 0:01:05
      623000 -- (-1295.102) (-1299.017) [-1296.712] (-1296.892) * (-1299.352) (-1293.834) (-1296.653) [-1299.671] -- 0:01:05
      623500 -- (-1297.560) (-1300.447) (-1300.066) [-1296.379] * (-1299.291) (-1300.378) (-1301.061) [-1295.143] -- 0:01:05
      624000 -- (-1296.192) (-1291.846) [-1295.746] (-1295.626) * (-1297.042) (-1301.049) [-1299.568] (-1297.507) -- 0:01:05
      624500 -- (-1298.500) (-1294.707) [-1294.412] (-1302.486) * [-1295.861] (-1294.961) (-1303.501) (-1298.379) -- 0:01:04
      625000 -- [-1296.821] (-1297.118) (-1292.546) (-1294.911) * (-1301.042) [-1303.261] (-1306.781) (-1297.617) -- 0:01:04

      Average standard deviation of split frequencies: 0.001130

      625500 -- [-1295.886] (-1304.036) (-1307.256) (-1303.586) * (-1304.587) [-1296.326] (-1303.675) (-1298.304) -- 0:01:05
      626000 -- (-1294.225) (-1300.258) (-1296.331) [-1298.026] * (-1302.441) (-1297.085) [-1295.952] (-1303.649) -- 0:01:05
      626500 -- (-1303.708) (-1297.467) [-1301.023] (-1298.203) * (-1301.757) [-1302.326] (-1294.789) (-1304.867) -- 0:01:04
      627000 -- (-1307.486) (-1301.528) (-1298.586) [-1295.809] * (-1302.949) (-1306.784) [-1301.603] (-1300.618) -- 0:01:04
      627500 -- [-1299.968] (-1309.418) (-1294.072) (-1304.340) * (-1300.092) [-1296.924] (-1297.224) (-1297.781) -- 0:01:04
      628000 -- (-1297.124) [-1298.297] (-1294.819) (-1301.837) * (-1299.259) (-1294.145) [-1294.602] (-1298.984) -- 0:01:04
      628500 -- (-1294.646) (-1300.968) [-1300.649] (-1303.416) * (-1301.322) [-1296.632] (-1294.774) (-1298.982) -- 0:01:04
      629000 -- [-1294.463] (-1306.392) (-1292.905) (-1303.220) * (-1302.150) (-1296.280) [-1295.400] (-1304.446) -- 0:01:04
      629500 -- [-1299.116] (-1297.778) (-1299.497) (-1301.801) * (-1298.881) (-1296.100) [-1297.048] (-1307.583) -- 0:01:04
      630000 -- [-1298.999] (-1314.110) (-1302.888) (-1303.458) * (-1304.972) (-1300.723) [-1295.635] (-1297.132) -- 0:01:04

      Average standard deviation of split frequencies: 0.001121

      630500 -- (-1303.880) (-1301.738) [-1300.401] (-1296.694) * (-1301.964) (-1302.980) [-1297.332] (-1300.355) -- 0:01:03
      631000 -- [-1298.574] (-1301.179) (-1295.649) (-1296.797) * (-1297.268) (-1297.168) [-1295.325] (-1301.555) -- 0:01:04
      631500 -- (-1302.224) (-1299.844) (-1304.491) [-1298.537] * (-1303.724) (-1296.196) [-1298.855] (-1298.014) -- 0:01:04
      632000 -- (-1294.986) (-1296.150) (-1300.855) [-1295.363] * (-1300.091) (-1297.744) (-1295.638) [-1297.822] -- 0:01:04
      632500 -- (-1296.518) [-1298.829] (-1301.210) (-1299.173) * (-1303.309) (-1292.380) (-1297.737) [-1296.629] -- 0:01:03
      633000 -- (-1303.365) (-1300.883) [-1296.786] (-1299.377) * (-1299.545) (-1300.830) [-1295.402] (-1304.210) -- 0:01:03
      633500 -- (-1297.980) [-1302.053] (-1298.887) (-1303.983) * [-1293.603] (-1304.355) (-1295.181) (-1296.213) -- 0:01:03
      634000 -- (-1306.286) (-1297.802) [-1298.006] (-1296.284) * (-1298.775) [-1300.587] (-1297.194) (-1297.262) -- 0:01:03
      634500 -- (-1292.393) (-1300.508) [-1294.022] (-1300.822) * [-1300.490] (-1301.649) (-1301.333) (-1299.745) -- 0:01:03
      635000 -- (-1301.663) (-1304.809) [-1297.422] (-1294.371) * (-1297.110) (-1302.815) [-1298.630] (-1299.067) -- 0:01:03

      Average standard deviation of split frequencies: 0.000741

      635500 -- [-1294.061] (-1294.922) (-1302.927) (-1294.711) * [-1296.836] (-1298.779) (-1309.149) (-1296.573) -- 0:01:03
      636000 -- (-1298.625) (-1301.680) (-1298.451) [-1297.810] * (-1308.058) [-1300.411] (-1298.217) (-1301.583) -- 0:01:02
      636500 -- [-1294.704] (-1302.780) (-1295.706) (-1301.025) * (-1295.725) (-1297.668) (-1306.398) [-1298.471] -- 0:01:02
      637000 -- (-1298.827) (-1296.359) [-1294.404] (-1303.353) * [-1295.568] (-1294.629) (-1296.355) (-1301.253) -- 0:01:03
      637500 -- (-1312.356) [-1298.380] (-1295.085) (-1303.382) * (-1302.196) [-1297.043] (-1296.739) (-1300.576) -- 0:01:03
      638000 -- (-1298.866) (-1297.243) (-1293.565) [-1294.906] * (-1300.285) (-1301.127) (-1304.130) [-1297.021] -- 0:01:02
      638500 -- (-1300.630) (-1301.586) [-1296.155] (-1301.271) * (-1295.418) (-1296.431) [-1304.966] (-1300.473) -- 0:01:02
      639000 -- [-1293.261] (-1302.125) (-1296.832) (-1304.082) * (-1301.223) [-1297.848] (-1301.350) (-1298.753) -- 0:01:02
      639500 -- (-1308.473) (-1300.663) [-1294.356] (-1311.704) * (-1292.403) (-1307.617) [-1299.616] (-1295.293) -- 0:01:02
      640000 -- (-1302.439) [-1299.629] (-1295.888) (-1301.107) * [-1297.922] (-1300.380) (-1293.894) (-1296.404) -- 0:01:02

      Average standard deviation of split frequencies: 0.000736

      640500 -- (-1297.889) [-1298.954] (-1299.021) (-1305.288) * (-1297.834) (-1300.863) [-1293.092] (-1294.870) -- 0:01:02
      641000 -- [-1297.237] (-1296.951) (-1297.200) (-1314.376) * (-1294.079) (-1302.464) [-1294.619] (-1296.780) -- 0:01:02
      641500 -- (-1292.708) [-1297.320] (-1299.046) (-1303.199) * [-1295.836] (-1303.958) (-1298.343) (-1299.487) -- 0:01:02
      642000 -- (-1299.289) (-1298.495) (-1299.045) [-1294.952] * (-1295.993) (-1304.249) (-1299.247) [-1298.540] -- 0:01:01
      642500 -- (-1308.880) [-1295.529] (-1303.126) (-1297.966) * (-1295.818) (-1302.081) (-1294.756) [-1296.842] -- 0:01:01
      643000 -- (-1297.348) [-1296.439] (-1306.009) (-1292.616) * [-1298.213] (-1299.570) (-1297.995) (-1297.901) -- 0:01:02
      643500 -- [-1297.535] (-1296.729) (-1301.475) (-1300.966) * (-1298.166) (-1292.856) (-1299.516) [-1296.852] -- 0:01:02
      644000 -- (-1298.150) [-1297.143] (-1296.704) (-1296.598) * (-1299.729) (-1296.746) [-1299.503] (-1298.628) -- 0:01:01
      644500 -- (-1299.352) (-1293.546) (-1304.518) [-1296.986] * (-1297.403) (-1297.174) [-1301.686] (-1299.635) -- 0:01:01
      645000 -- (-1299.962) [-1294.243] (-1295.621) (-1301.272) * (-1298.546) [-1306.343] (-1298.682) (-1309.666) -- 0:01:01

      Average standard deviation of split frequencies: 0.000730

      645500 -- (-1297.353) [-1295.619] (-1297.254) (-1301.386) * (-1301.548) (-1299.234) [-1297.153] (-1299.550) -- 0:01:01
      646000 -- [-1293.764] (-1293.446) (-1304.417) (-1303.361) * (-1294.618) [-1297.501] (-1298.283) (-1296.661) -- 0:01:01
      646500 -- (-1293.826) (-1298.169) (-1296.152) [-1294.053] * (-1296.935) (-1296.788) (-1301.734) [-1297.672] -- 0:01:01
      647000 -- [-1295.438] (-1307.411) (-1302.351) (-1299.282) * (-1302.180) (-1298.971) [-1294.047] (-1301.872) -- 0:01:01
      647500 -- [-1303.017] (-1296.030) (-1296.617) (-1305.479) * (-1298.200) (-1296.896) (-1303.911) [-1295.642] -- 0:01:00
      648000 -- (-1296.450) (-1300.773) (-1298.554) [-1295.405] * [-1301.556] (-1295.455) (-1298.669) (-1299.756) -- 0:01:00
      648500 -- [-1295.218] (-1296.261) (-1300.088) (-1306.586) * (-1302.012) (-1293.953) [-1300.961] (-1301.662) -- 0:01:01
      649000 -- (-1305.915) (-1301.240) (-1303.096) [-1300.981] * (-1302.946) [-1298.936] (-1298.183) (-1300.992) -- 0:01:01
      649500 -- (-1296.468) (-1300.519) [-1293.906] (-1301.911) * (-1293.189) [-1299.756] (-1304.053) (-1314.409) -- 0:01:00
      650000 -- (-1302.974) (-1296.293) [-1297.111] (-1298.409) * (-1294.712) (-1298.808) [-1297.257] (-1301.972) -- 0:01:00

      Average standard deviation of split frequencies: 0.000724

      650500 -- [-1299.221] (-1302.890) (-1301.621) (-1298.862) * (-1300.295) (-1305.012) [-1302.542] (-1297.068) -- 0:01:00
      651000 -- (-1295.564) [-1298.382] (-1300.788) (-1301.976) * (-1296.253) [-1297.385] (-1299.956) (-1298.013) -- 0:01:00
      651500 -- (-1297.739) (-1303.961) [-1294.333] (-1300.168) * (-1299.839) (-1297.422) [-1300.392] (-1303.745) -- 0:01:00
      652000 -- [-1293.527] (-1300.211) (-1299.241) (-1299.888) * [-1298.461] (-1298.248) (-1302.538) (-1300.127) -- 0:01:00
      652500 -- (-1297.458) [-1295.246] (-1303.911) (-1297.664) * [-1298.595] (-1299.905) (-1305.867) (-1297.226) -- 0:01:00
      653000 -- (-1299.328) [-1296.236] (-1293.579) (-1300.761) * (-1298.822) (-1296.969) (-1307.607) [-1295.225] -- 0:01:00
      653500 -- (-1297.206) (-1297.967) [-1299.388] (-1299.443) * (-1295.779) [-1293.127] (-1302.420) (-1300.772) -- 0:00:59
      654000 -- [-1297.287] (-1294.541) (-1303.041) (-1310.306) * (-1293.884) (-1301.108) [-1299.576] (-1298.674) -- 0:00:59
      654500 -- (-1300.943) [-1296.486] (-1295.978) (-1305.412) * [-1295.763] (-1296.780) (-1298.197) (-1294.613) -- 0:01:00
      655000 -- (-1301.050) [-1295.496] (-1296.536) (-1306.369) * (-1299.819) (-1297.632) [-1295.722] (-1297.749) -- 0:01:00

      Average standard deviation of split frequencies: 0.000719

      655500 -- (-1301.740) (-1299.044) (-1296.264) [-1298.356] * (-1300.274) (-1301.419) [-1294.423] (-1299.818) -- 0:00:59
      656000 -- (-1302.711) [-1296.668] (-1299.253) (-1300.280) * (-1307.289) (-1301.614) [-1292.518] (-1299.645) -- 0:00:59
      656500 -- (-1299.530) [-1295.623] (-1299.926) (-1298.849) * (-1297.188) (-1300.486) (-1298.592) [-1298.516] -- 0:00:59
      657000 -- [-1292.299] (-1299.059) (-1302.857) (-1304.564) * [-1296.050] (-1296.545) (-1298.158) (-1299.119) -- 0:00:59
      657500 -- (-1299.077) (-1298.865) (-1302.361) [-1294.854] * (-1297.055) (-1297.235) (-1296.303) [-1295.504] -- 0:00:59
      658000 -- (-1300.241) (-1298.373) (-1299.406) [-1300.683] * [-1298.362] (-1301.871) (-1297.013) (-1299.981) -- 0:00:59
      658500 -- (-1297.991) (-1296.851) [-1301.453] (-1306.317) * (-1293.875) [-1300.195] (-1295.774) (-1300.834) -- 0:00:59
      659000 -- (-1303.944) [-1294.071] (-1301.463) (-1297.084) * (-1297.304) (-1296.912) [-1296.460] (-1302.359) -- 0:00:58
      659500 -- (-1299.271) (-1298.740) (-1297.742) [-1302.192] * [-1303.774] (-1298.078) (-1297.568) (-1296.836) -- 0:00:58
      660000 -- [-1301.499] (-1300.309) (-1298.650) (-1295.051) * [-1295.000] (-1307.062) (-1297.943) (-1297.249) -- 0:00:58

      Average standard deviation of split frequencies: 0.000714

      660500 -- (-1305.785) (-1299.194) (-1294.242) [-1297.139] * [-1305.615] (-1306.872) (-1302.367) (-1296.941) -- 0:00:59
      661000 -- (-1300.558) (-1299.637) (-1298.673) [-1295.161] * [-1302.109] (-1299.260) (-1303.309) (-1299.307) -- 0:00:58
      661500 -- (-1299.854) (-1309.358) [-1296.135] (-1297.302) * (-1298.486) [-1297.663] (-1296.558) (-1307.468) -- 0:00:58
      662000 -- (-1300.139) (-1301.587) [-1294.068] (-1295.349) * (-1294.658) (-1303.256) (-1303.824) [-1297.471] -- 0:00:58
      662500 -- (-1299.590) (-1300.392) (-1293.772) [-1296.972] * (-1296.271) (-1298.147) [-1304.187] (-1297.860) -- 0:00:58
      663000 -- (-1303.413) (-1301.159) [-1295.472] (-1302.304) * (-1301.897) (-1298.630) [-1296.252] (-1302.776) -- 0:00:58
      663500 -- (-1299.739) [-1295.208] (-1295.180) (-1296.917) * (-1304.413) (-1297.636) [-1300.891] (-1300.366) -- 0:00:58
      664000 -- (-1301.574) (-1299.196) [-1299.667] (-1306.770) * (-1303.408) (-1299.176) (-1297.722) [-1295.242] -- 0:00:58
      664500 -- (-1299.209) (-1297.826) [-1299.148] (-1304.157) * (-1301.373) (-1302.054) (-1293.228) [-1303.037] -- 0:00:58
      665000 -- (-1300.947) (-1305.333) (-1305.601) [-1297.335] * [-1293.389] (-1299.668) (-1303.395) (-1296.673) -- 0:00:57

      Average standard deviation of split frequencies: 0.000354

      665500 -- (-1301.558) [-1303.783] (-1302.053) (-1302.295) * (-1300.279) [-1296.158] (-1300.336) (-1295.834) -- 0:00:57
      666000 -- [-1298.776] (-1301.403) (-1301.909) (-1299.127) * (-1293.659) (-1296.523) [-1298.514] (-1306.139) -- 0:00:58
      666500 -- (-1303.959) (-1301.625) [-1293.266] (-1298.151) * [-1304.451] (-1304.324) (-1299.419) (-1300.554) -- 0:00:58
      667000 -- (-1309.747) (-1301.168) [-1294.500] (-1295.797) * (-1299.954) [-1300.569] (-1297.062) (-1297.446) -- 0:00:57
      667500 -- (-1294.323) [-1299.614] (-1297.080) (-1295.090) * (-1297.990) [-1301.053] (-1303.323) (-1305.697) -- 0:00:57
      668000 -- (-1302.684) [-1297.554] (-1298.205) (-1296.045) * (-1298.195) [-1301.370] (-1296.798) (-1303.193) -- 0:00:57
      668500 -- [-1300.736] (-1294.131) (-1302.765) (-1296.647) * [-1294.247] (-1298.316) (-1300.464) (-1306.800) -- 0:00:57
      669000 -- (-1300.434) (-1296.391) [-1297.358] (-1302.374) * (-1295.119) [-1292.963] (-1297.686) (-1305.276) -- 0:00:57
      669500 -- (-1300.472) [-1298.860] (-1296.449) (-1303.191) * (-1293.398) (