--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 10 02:31:56 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/zetaCOP-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1310.85 -1327.52
2 -1311.47 -1331.11
--------------------------------------
TOTAL -1311.11 -1330.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.658259 0.013762 0.453987 0.898559 0.647138 1009.56 1120.62 1.000
r(A<->C){all} 0.072016 0.000830 0.014818 0.126066 0.069147 763.90 809.22 1.000
r(A<->G){all} 0.275334 0.004928 0.148516 0.414109 0.271217 484.17 587.35 1.000
r(A<->T){all} 0.175228 0.004541 0.057077 0.309705 0.166401 534.98 691.52 1.000
r(C<->G){all} 0.092171 0.000713 0.043655 0.143711 0.089392 796.20 964.11 1.000
r(C<->T){all} 0.343812 0.004754 0.221419 0.487133 0.339345 453.04 542.59 1.000
r(G<->T){all} 0.041439 0.000786 0.001222 0.094488 0.035807 623.21 714.04 1.000
pi(A){all} 0.252968 0.000360 0.214356 0.289849 0.252619 929.25 1018.72 1.000
pi(C){all} 0.285897 0.000366 0.250181 0.324510 0.285610 1235.74 1260.97 1.000
pi(G){all} 0.257328 0.000330 0.223823 0.294368 0.257256 1126.34 1195.13 1.000
pi(T){all} 0.203808 0.000294 0.169915 0.236151 0.203150 1125.16 1125.60 1.001
alpha{1,2} 0.074650 0.000782 0.003099 0.115703 0.078576 916.90 1082.64 1.000
alpha{3} 2.516525 0.743213 1.024810 4.121764 2.394605 1443.63 1472.32 1.000
pinvar{all} 0.585627 0.002673 0.482339 0.682849 0.589107 777.25 1068.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1111.975618
Model 2: PositiveSelection -1111.975618
Model 0: one-ratio -1126.154367
Model 3: discrete -1111.837858
Model 7: beta -1114.560557
Model 8: beta&w>1 -1112.009417
Model 0 vs 1 28.357498000000305
Model 2 vs 1 0.0
Model 8 vs 7 5.102280000000064
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTooooooooooooo
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=174
C1 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C2 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C3 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C4 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C5 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C6 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C7 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C8 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C9 MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
C10 MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
*******************:******************************
C1 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C2 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C3 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C4 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C5 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C6 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C7 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C8 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C9 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
C10 RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
**************************************************
C1 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C2 ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C3 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C4 ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C5 ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C6 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
C7 ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
C8 ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
C9 ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
C10 ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
************: ***************:********:***********
C1 PIAEQTVAQVLQSAREQLKWSILK
C2 PIAEQTVAQVLQSAREQLKWSILK
C3 PIAEQTVAQVLQSAREQLKWSILK
C4 PIAEQTVAQVLQSAREQLKWSILK
C5 PIAEQTVAQVLQSAREQLKWSILK
C6 PIAEQTVAQVLQSAREQLKWSILK
C7 PIAEQTVAQVLQSAREQLKWSILK
C8 PIAEQTVAQVLQSAREQLKWSILK
C9 PIAEQTVAQVTooooooooooooo
C10 PIAEQTVAQVLQSAREQLKWSILK
**********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 174 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [15660]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [15660]--->[15660]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.520 Mb, Max= 30.929 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTooooooooooooo
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
FORMAT of file /tmp/tmp4343997068101467224aln Not Supported[FATAL:T-COFFEE]
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTooooooooooooo
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:174 S:100 BS:174
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 99.43 C1 C2 99.43
TOP 1 0 99.43 C2 C1 99.43
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 99.43 C1 C4 99.43
TOP 3 0 99.43 C4 C1 99.43
BOT 0 4 99.43 C1 C5 99.43
TOP 4 0 99.43 C5 C1 99.43
BOT 0 5 99.43 C1 C6 99.43
TOP 5 0 99.43 C6 C1 99.43
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 99.43 C1 C8 99.43
TOP 7 0 99.43 C8 C1 99.43
BOT 0 8 90.23 C1 C9 90.23
TOP 8 0 90.23 C9 C1 90.23
BOT 0 9 99.43 C1 C10 99.43
TOP 9 0 99.43 C10 C1 99.43
BOT 1 2 99.43 C2 C3 99.43
TOP 2 1 99.43 C3 C2 99.43
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 98.85 C2 C5 98.85
TOP 4 1 98.85 C5 C2 98.85
BOT 1 5 98.85 C2 C6 98.85
TOP 5 1 98.85 C6 C2 98.85
BOT 1 6 99.43 C2 C7 99.43
TOP 6 1 99.43 C7 C2 99.43
BOT 1 7 98.85 C2 C8 98.85
TOP 7 1 98.85 C8 C2 98.85
BOT 1 8 90.80 C2 C9 90.80
TOP 8 1 90.80 C9 C2 90.80
BOT 1 9 98.85 C2 C10 98.85
TOP 9 1 98.85 C10 C2 98.85
BOT 2 3 99.43 C3 C4 99.43
TOP 3 2 99.43 C4 C3 99.43
BOT 2 4 99.43 C3 C5 99.43
TOP 4 2 99.43 C5 C3 99.43
BOT 2 5 99.43 C3 C6 99.43
TOP 5 2 99.43 C6 C3 99.43
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 99.43 C3 C8 99.43
TOP 7 2 99.43 C8 C3 99.43
BOT 2 8 90.23 C3 C9 90.23
TOP 8 2 90.23 C9 C3 90.23
BOT 2 9 99.43 C3 C10 99.43
TOP 9 2 99.43 C10 C3 99.43
BOT 3 4 98.85 C4 C5 98.85
TOP 4 3 98.85 C5 C4 98.85
BOT 3 5 98.85 C4 C6 98.85
TOP 5 3 98.85 C6 C4 98.85
BOT 3 6 99.43 C4 C7 99.43
TOP 6 3 99.43 C7 C4 99.43
BOT 3 7 98.85 C4 C8 98.85
TOP 7 3 98.85 C8 C4 98.85
BOT 3 8 90.80 C4 C9 90.80
TOP 8 3 90.80 C9 C4 90.80
BOT 3 9 98.85 C4 C10 98.85
TOP 9 3 98.85 C10 C4 98.85
BOT 4 5 98.85 C5 C6 98.85
TOP 5 4 98.85 C6 C5 98.85
BOT 4 6 99.43 C5 C7 99.43
TOP 6 4 99.43 C7 C5 99.43
BOT 4 7 98.85 C5 C8 98.85
TOP 7 4 98.85 C8 C5 98.85
BOT 4 8 89.66 C5 C9 89.66
TOP 8 4 89.66 C9 C5 89.66
BOT 4 9 98.85 C5 C10 98.85
TOP 9 4 98.85 C10 C5 98.85
BOT 5 6 99.43 C6 C7 99.43
TOP 6 5 99.43 C7 C6 99.43
BOT 5 7 98.85 C6 C8 98.85
TOP 7 5 98.85 C8 C6 98.85
BOT 5 8 89.66 C6 C9 89.66
TOP 8 5 89.66 C9 C6 89.66
BOT 5 9 98.85 C6 C10 98.85
TOP 9 5 98.85 C10 C6 98.85
BOT 6 7 99.43 C7 C8 99.43
TOP 7 6 99.43 C8 C7 99.43
BOT 6 8 90.23 C7 C9 90.23
TOP 8 6 90.23 C9 C7 90.23
BOT 6 9 99.43 C7 C10 99.43
TOP 9 6 99.43 C10 C7 99.43
BOT 7 8 90.80 C8 C9 90.80
TOP 8 7 90.80 C9 C8 90.80
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 8 9 90.80 C9 C10 90.80
TOP 9 8 90.80 C10 C9 90.80
AVG 0 C1 * 98.53
AVG 1 C2 * 98.28
AVG 2 C3 * 98.53
AVG 3 C4 * 98.28
AVG 4 C5 * 98.02
AVG 5 C6 * 98.02
AVG 6 C7 * 98.53
AVG 7 C8 * 98.28
AVG 8 C9 * 90.36
AVG 9 C10 * 98.28
TOT TOT * 97.51
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
C2 ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
C3 ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
C4 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C5 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C6 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C7 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C8 ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C9 ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
C10 ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
*********** ******** *****************************
C1 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C2 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C3 CGATGGCAACCGCATCCTGGCCAAGTATTACGACAAGAACATCCTGTCCA
C4 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C5 CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCTTGTCCA
C6 CGACGGCAACCGCATCCTGGCCAAGTACTACGACAAAAACATTCTGTCCA
C7 CGACGGGAACCGCATCCTGGCCAAGTACTACGACAAGAACATACTGTCCA
C8 CGATGGAAACCGCATCCTGGCCAAATACTACGATAAAAACATCTTGTCCA
C9 TGATGGAGACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
C10 TGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
** ** .****************.** ***** **.***** ******
C1 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C2 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C3 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C4 CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
C5 CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
C6 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
C7 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
C8 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
C9 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
C10 CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
********************** ***************** *********
C1 CGCTCCAACACGGAGATCATTATGCTGGACGGACTCACCTGCGTGTACAA
C2 CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
C3 CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
C4 CGCTCCAACACGGAGATCATCATGCTGGATGGACTTACCTGCGTCTACAA
C5 CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTCTACAA
C6 CGCTCCAACACGGAGATCATAATGCTGGACGGGCTCACCTGCGTCTACAA
C7 CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
C8 CGCTCCAACACGGAGATCATAATGCTGGACGGACTCACCTGCGTCTACAA
C9 CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
C10 CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
******************** ******** **.** ******** *****
C1 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C2 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C3 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C4 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C5 GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C6 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C7 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C8 AAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
C9 GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAATGCCTACGAGAATG
C10 GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
.************** ******************** *********** *
C1 AGCTCATCCTGCTGTCCGTGCTCAACTGCCTCTACGATTCCATTAGCCTG
C2 AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
C3 AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
C4 AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCCATCAGCCTG
C5 AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCTATCAGCCTG
C6 AGCTCATCCTGCTCTCGGTGCTCAACTGCCTGTACGACTCCATCAGCCTG
C7 AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
C8 AGCTGATCCTGCTGTCTGTGCTCAACTGCCTGTACGACTCCATCAGCCTA
C9 AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTA
C10 AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
**** ***** ** ** *****.******** ***** ** ** *****.
C1 ATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
C2 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
C3 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
C4 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
C5 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAATACCTGGAGAT
C6 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
C7 ATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
C8 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
C9 ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGACAACCTGGAGAT
C10 ATCCTCAAGAAGAACGTGGAGAAGCGACTGGTGCTGGAGAACCTGGAGAT
** *********** ** ********.*********** :**********
C1 CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
C2 CATCATGCTGGCTTTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
C3 CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
C4 CATCATGCTGGCCTTTGACGAGATCTGCGACGGAGGCATAATTCTGGATG
C5 CATCATGCTGGCCTTTGACGAGATCTGCGATGGAGGCATAATTCTGGATG
C6 CATCATGCTGGCCTTCGATGAGATCTGCGACGGAGGCATAATCCTGGATG
C7 CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATTATCCTGGACG
C8 CATCATGCTGGCCTTTGATGAAATCTGCGACGGAGGCATGATTCTGGATG
C9 CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATGATCCTGGATG
C10 CATCATGCTCGCCTTCGACGAGATCTGTGACGGAGGAATGATCCTGGATG
********* ** ** ** **.***** ** *****.** ** ***** *
C1 CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C2 CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C3 CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C4 CCGATCCGTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C5 CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
C6 CCGATCCATCGTCCATTGTGAAACGTGTCGATCTGCGCAACGATGACATT
C7 CGGATCCCTCGTCCGTGGTGAAACGCGTCGATCTGCGCAACGATGACATT
C8 CGGATCCCTCCTCCGTAGTGAAACGCGTCGATCTGCGCAACGATGACATT
C9 CGGATCCCTCGTCCGTGGTGAAACGAGTCGATCTGCGCAACGATGACATT
C10 CGGATCCCTCATCCGTCGTGAAACGAGTCGATCTGCGCAACGATGACATT
* ***** ** ** .* ******** ** *********************
C1 CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
C2 CCCATTGCCGAACAAACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
C3 CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
C4 CCAATTGCCGAACAGACCGTCGCCCAGGTTCTGCAATCGGCACGTGAACA
C5 CCAATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
C6 CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGTGAACA
C7 CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGCGAGCA
C8 CCTATTGCCGAACAAACCGTTGCCCAGGTTCTGCAATCGGCGCGTGAGCA
C9 CCCATTGCCGAACAGACCGTTGCCCAGGTAACT-----------------
C10 CCCATCGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGTGAACA
** ** ********.***** ********:.
C1 ACTCAAATGGTCCATTCTGAAG
C2 ACTCAAATGGTCCATTCTGAAG
C3 ACTCAAATGGTCCATTCTGAAG
C4 ACTCAAATGGTCCATTCTGAAG
C5 ACTCAAATGGTCTATTCTGAAG
C6 GCTCAAATGGTCCATTCTGAAG
C7 ACTCAAATGGTCCATTCTGAAG
C8 ACTCAAATGGTCCATTCTGAAG
C9 ----------------------
C10 ACTCAAATGGTCCATTCTGAAG
>C1
ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATTATGCTGGACGGACTCACCTGCGTGTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTGTCCGTGCTCAACTGCCTCTACGATTCCATTAGCCTG
ATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
ACTCAAATGGTCCATTCTGAAG
>C2
ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
CATCATGCTGGCTTTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCCATTGCCGAACAAACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
ACTCAAATGGTCCATTCTGAAG
>C3
ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTATTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT
CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG
CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
ACTCAAATGGTCCATTCTGAAG
>C4
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGATGGACTTACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT
CATCATGCTGGCCTTTGACGAGATCTGCGACGGAGGCATAATTCTGGATG
CCGATCCGTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCAATTGCCGAACAGACCGTCGCCCAGGTTCTGCAATCGGCACGTGAACA
ACTCAAATGGTCCATTCTGAAG
>C5
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCTTGTCCA
CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTCTACAA
GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCTATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAATACCTGGAGAT
CATCATGCTGGCCTTTGACGAGATCTGCGATGGAGGCATAATTCTGGATG
CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT
CCAATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA
ACTCAAATGGTCTATTCTGAAG
>C6
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGACGGCAACCGCATCCTGGCCAAGTACTACGACAAAAACATTCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATAATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCGGTGCTCAACTGCCTGTACGACTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
CATCATGCTGGCCTTCGATGAGATCTGCGACGGAGGCATAATCCTGGATG
CCGATCCATCGTCCATTGTGAAACGTGTCGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGTGAACA
GCTCAAATGGTCCATTCTGAAG
>C7
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGACGGGAACCGCATCCTGGCCAAGTACTACGACAAGAACATACTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
ATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATTATCCTGGACG
CGGATCCCTCGTCCGTGGTGAAACGCGTCGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGCGAGCA
ACTCAAATGGTCCATTCTGAAG
>C8
ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
CGATGGAAACCGCATCCTGGCCAAATACTACGATAAAAACATCTTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATAATGCTGGACGGACTCACCTGCGTCTACAA
AAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTGATCCTGCTGTCTGTGCTCAACTGCCTGTACGACTCCATCAGCCTA
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT
CATCATGCTGGCCTTTGATGAAATCTGCGACGGAGGCATGATTCTGGATG
CGGATCCCTCCTCCGTAGTGAAACGCGTCGATCTGCGCAACGATGACATT
CCTATTGCCGAACAAACCGTTGCCCAGGTTCTGCAATCGGCGCGTGAGCA
ACTCAAATGGTCCATTCTGAAG
>C9
ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
TGATGGAGACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAATGCCTACGAGAATG
AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTA
ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGACAACCTGGAGAT
CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATGATCCTGGATG
CGGATCCCTCGTCCGTGGTGAAACGAGTCGATCTGCGCAACGATGACATT
CCCATTGCCGAACAGACCGTTGCCCAGGTAACT-----------------
----------------------
>C10
ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA
TGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA
CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC
CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA
GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG
AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG
ATCCTCAAGAAGAACGTGGAGAAGCGACTGGTGCTGGAGAACCTGGAGAT
CATCATGCTCGCCTTCGACGAGATCTGTGACGGAGGAATGATCCTGGATG
CGGATCCCTCATCCGTCGTGAAACGAGTCGATCTGCGCAACGATGACATT
CCCATCGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGTGAACA
ACTCAAATGGTCCATTCTGAAG
>C1
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C2
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C3
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C4
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C5
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C6
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C7
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C8
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
>C9
MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVTooooooooooooo
>C10
MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
PIAEQTVAQVLQSAREQLKWSILK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 522 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481336550
Setting output file names to "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1747255453
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4210464627
Seed = 1730964098
Swapseed = 1481336550
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 13 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 65 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1937.903976 -- -24.412588
Chain 2 -- -1970.738539 -- -24.412588
Chain 3 -- -2010.559727 -- -24.412588
Chain 4 -- -1982.623378 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1988.729341 -- -24.412588
Chain 2 -- -1963.004344 -- -24.412588
Chain 3 -- -1993.307606 -- -24.412588
Chain 4 -- -1988.676944 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1937.904] (-1970.739) (-2010.560) (-1982.623) * [-1988.729] (-1963.004) (-1993.308) (-1988.677)
500 -- [-1378.469] (-1380.051) (-1386.012) (-1374.064) * (-1372.200) (-1391.240) [-1386.336] (-1384.849) -- 0:00:00
1000 -- (-1372.177) (-1358.259) [-1369.606] (-1382.451) * (-1366.125) (-1375.913) (-1369.125) [-1365.374] -- 0:00:00
1500 -- (-1358.048) (-1348.034) (-1353.894) [-1351.504] * (-1354.975) (-1364.423) [-1349.072] (-1350.030) -- 0:00:00
2000 -- (-1339.598) (-1336.862) (-1348.304) [-1335.134] * (-1345.488) (-1364.675) (-1329.298) [-1338.877] -- 0:08:19
2500 -- (-1339.755) (-1338.259) (-1332.251) [-1320.400] * [-1323.157] (-1347.935) (-1326.058) (-1331.192) -- 0:06:39
3000 -- (-1332.138) (-1344.004) [-1314.308] (-1322.355) * (-1333.371) [-1310.523] (-1331.837) (-1330.723) -- 0:05:32
3500 -- (-1331.368) (-1330.311) (-1324.921) [-1322.689] * (-1325.541) [-1316.606] (-1330.210) (-1316.548) -- 0:04:44
4000 -- (-1325.224) (-1325.330) (-1320.827) [-1316.444] * (-1333.526) [-1313.763] (-1320.891) (-1319.767) -- 0:04:09
4500 -- (-1316.847) (-1332.316) (-1327.772) [-1320.249] * (-1328.477) (-1318.527) [-1313.761] (-1335.876) -- 0:03:41
5000 -- (-1319.631) [-1316.792] (-1325.665) (-1310.706) * (-1322.200) [-1315.792] (-1318.708) (-1340.189) -- 0:03:19
Average standard deviation of split frequencies: 0.089791
5500 -- (-1315.966) (-1326.690) [-1311.494] (-1316.343) * (-1329.309) (-1320.606) (-1324.296) [-1330.280] -- 0:03:00
6000 -- (-1314.878) (-1325.167) (-1324.588) [-1316.498] * (-1323.688) (-1316.164) (-1324.167) [-1318.130] -- 0:05:31
6500 -- [-1310.974] (-1328.064) (-1316.046) (-1323.070) * (-1320.606) (-1323.162) [-1313.229] (-1321.765) -- 0:05:05
7000 -- (-1321.418) (-1322.934) (-1317.446) [-1325.058] * (-1320.356) [-1324.372] (-1319.076) (-1327.388) -- 0:04:43
7500 -- [-1321.516] (-1330.971) (-1327.033) (-1315.441) * (-1325.918) (-1321.612) [-1308.352] (-1330.687) -- 0:04:24
8000 -- (-1324.714) [-1322.290] (-1317.862) (-1323.054) * (-1325.257) (-1318.176) [-1313.437] (-1325.578) -- 0:04:08
8500 -- [-1314.400] (-1323.876) (-1319.653) (-1308.512) * [-1330.123] (-1320.440) (-1318.240) (-1324.459) -- 0:03:53
9000 -- (-1320.164) (-1327.455) [-1314.779] (-1319.151) * (-1313.393) (-1319.422) (-1318.264) [-1320.386] -- 0:03:40
9500 -- (-1316.278) [-1320.817] (-1321.297) (-1321.858) * (-1317.809) (-1327.951) (-1321.910) [-1315.504] -- 0:05:12
10000 -- (-1313.321) (-1318.796) (-1323.640) [-1319.151] * (-1324.431) (-1327.976) (-1320.998) [-1314.424] -- 0:04:57
Average standard deviation of split frequencies: 0.074432
10500 -- (-1310.794) [-1312.321] (-1320.892) (-1328.943) * [-1316.536] (-1314.899) (-1323.906) (-1322.284) -- 0:04:42
11000 -- (-1314.520) [-1318.107] (-1318.328) (-1317.163) * (-1330.310) [-1310.287] (-1314.736) (-1323.214) -- 0:04:29
11500 -- (-1327.083) (-1324.174) (-1321.101) [-1308.846] * (-1325.378) (-1320.561) [-1316.664] (-1319.921) -- 0:04:17
12000 -- (-1323.928) (-1320.909) (-1316.942) [-1312.010] * (-1328.412) [-1313.186] (-1321.207) (-1329.741) -- 0:04:07
12500 -- [-1318.434] (-1318.399) (-1313.953) (-1318.916) * (-1323.224) (-1325.458) (-1320.798) [-1313.495] -- 0:03:57
13000 -- (-1323.962) (-1329.455) [-1316.086] (-1312.058) * (-1317.712) (-1319.818) [-1316.565] (-1321.838) -- 0:03:47
13500 -- (-1325.569) (-1318.271) (-1319.125) [-1317.401] * (-1323.862) (-1314.342) (-1321.609) [-1315.848] -- 0:04:52
14000 -- (-1314.769) [-1313.757] (-1320.634) (-1326.716) * (-1324.430) (-1316.266) [-1314.742] (-1321.823) -- 0:04:41
14500 -- (-1325.690) (-1321.989) (-1317.191) [-1314.132] * (-1326.880) (-1319.862) (-1314.387) [-1319.078] -- 0:04:31
15000 -- (-1315.377) (-1323.592) [-1315.793] (-1325.692) * (-1319.051) (-1317.374) [-1321.675] (-1316.792) -- 0:04:22
Average standard deviation of split frequencies: 0.058926
15500 -- [-1316.638] (-1325.383) (-1323.906) (-1325.698) * [-1319.829] (-1317.029) (-1320.085) (-1317.793) -- 0:04:14
16000 -- (-1324.115) (-1319.338) (-1326.751) [-1312.454] * (-1324.653) (-1315.500) (-1324.431) [-1313.285] -- 0:04:06
16500 -- [-1321.109] (-1315.044) (-1317.394) (-1321.478) * (-1317.229) (-1314.267) (-1316.431) [-1314.810] -- 0:03:58
17000 -- (-1327.160) (-1316.548) (-1328.682) [-1320.781] * (-1321.593) (-1325.877) (-1319.007) [-1314.092] -- 0:04:49
17500 -- [-1311.768] (-1325.795) (-1320.947) (-1321.536) * (-1319.968) (-1324.594) [-1314.476] (-1315.107) -- 0:04:40
18000 -- [-1313.700] (-1325.014) (-1328.490) (-1316.300) * (-1316.018) (-1325.884) (-1323.396) [-1318.656] -- 0:04:32
18500 -- [-1324.112] (-1318.899) (-1318.136) (-1322.241) * (-1320.253) (-1323.762) [-1311.230] (-1321.977) -- 0:04:25
19000 -- (-1316.462) (-1320.200) [-1321.184] (-1316.103) * [-1316.335] (-1316.466) (-1326.332) (-1338.351) -- 0:04:18
19500 -- (-1314.814) (-1315.276) [-1315.406] (-1321.742) * [-1317.604] (-1317.896) (-1318.283) (-1325.441) -- 0:04:11
20000 -- [-1313.585] (-1325.434) (-1324.464) (-1317.874) * [-1316.695] (-1309.520) (-1318.367) (-1324.761) -- 0:04:05
Average standard deviation of split frequencies: 0.040253
20500 -- (-1316.191) (-1315.688) [-1315.436] (-1321.271) * (-1322.038) [-1315.533] (-1310.930) (-1315.857) -- 0:04:46
21000 -- (-1319.644) [-1315.101] (-1324.675) (-1323.334) * (-1318.887) [-1315.166] (-1318.482) (-1311.676) -- 0:04:39
21500 -- (-1321.839) [-1312.202] (-1323.590) (-1318.590) * [-1312.235] (-1318.742) (-1319.713) (-1320.666) -- 0:04:33
22000 -- (-1318.431) [-1318.575] (-1323.816) (-1326.115) * [-1313.867] (-1308.395) (-1320.752) (-1321.109) -- 0:04:26
22500 -- [-1312.852] (-1320.739) (-1322.507) (-1321.760) * (-1324.051) [-1313.978] (-1332.692) (-1318.234) -- 0:04:20
23000 -- [-1315.875] (-1319.081) (-1327.744) (-1317.452) * (-1317.672) [-1309.856] (-1323.144) (-1317.920) -- 0:04:14
23500 -- [-1322.262] (-1316.046) (-1331.660) (-1319.481) * (-1320.594) (-1317.367) (-1333.950) [-1317.215] -- 0:04:09
24000 -- [-1319.604] (-1324.521) (-1315.160) (-1323.070) * (-1318.563) [-1319.205] (-1326.989) (-1334.817) -- 0:04:04
24500 -- [-1315.291] (-1317.566) (-1322.285) (-1325.934) * (-1314.173) [-1315.680] (-1324.839) (-1337.929) -- 0:04:38
25000 -- (-1317.607) (-1322.787) (-1321.824) [-1320.882] * (-1320.094) [-1315.458] (-1317.995) (-1323.861) -- 0:04:33
Average standard deviation of split frequencies: 0.050576
25500 -- [-1311.166] (-1310.808) (-1325.171) (-1315.767) * (-1314.479) (-1313.238) [-1321.901] (-1320.837) -- 0:04:27
26000 -- [-1317.625] (-1316.685) (-1323.483) (-1319.110) * (-1312.868) [-1320.842] (-1327.834) (-1330.102) -- 0:04:22
26500 -- (-1314.004) [-1320.609] (-1318.317) (-1317.099) * (-1331.103) [-1317.509] (-1322.567) (-1310.996) -- 0:04:17
27000 -- (-1315.787) [-1324.401] (-1319.283) (-1323.801) * (-1312.640) (-1316.324) [-1311.395] (-1328.998) -- 0:04:12
27500 -- (-1315.670) (-1314.097) [-1321.641] (-1319.256) * [-1314.334] (-1317.063) (-1325.190) (-1320.313) -- 0:04:07
28000 -- [-1317.488] (-1316.831) (-1320.464) (-1318.537) * [-1317.580] (-1325.772) (-1315.713) (-1335.249) -- 0:04:37
28500 -- (-1315.083) (-1309.987) [-1317.911] (-1328.273) * (-1315.784) [-1321.708] (-1316.888) (-1328.075) -- 0:04:32
29000 -- (-1332.586) (-1330.455) [-1311.305] (-1332.334) * (-1319.230) (-1318.564) (-1321.211) [-1325.742] -- 0:04:27
29500 -- (-1326.057) (-1321.995) [-1323.404] (-1314.124) * (-1321.675) [-1318.375] (-1319.835) (-1322.566) -- 0:04:23
30000 -- (-1327.281) [-1323.030] (-1321.049) (-1318.103) * (-1324.534) [-1313.980] (-1314.242) (-1323.289) -- 0:04:18
Average standard deviation of split frequencies: 0.041846
30500 -- (-1322.508) [-1316.759] (-1324.291) (-1323.088) * (-1322.310) (-1326.268) (-1315.359) [-1325.117] -- 0:04:14
31000 -- [-1311.358] (-1317.337) (-1334.875) (-1319.130) * (-1312.493) (-1328.259) [-1316.708] (-1336.510) -- 0:04:10
31500 -- (-1323.500) [-1322.946] (-1319.077) (-1319.180) * [-1314.333] (-1328.814) (-1323.854) (-1326.213) -- 0:04:05
32000 -- (-1333.903) (-1319.245) (-1320.799) [-1314.227] * (-1316.193) [-1315.354] (-1322.968) (-1329.668) -- 0:04:32
32500 -- (-1326.747) [-1326.495] (-1314.929) (-1317.385) * [-1313.259] (-1325.763) (-1325.455) (-1334.127) -- 0:04:27
33000 -- (-1329.195) (-1332.594) (-1319.999) [-1314.611] * [-1323.761] (-1317.979) (-1310.507) (-1316.071) -- 0:04:23
33500 -- (-1321.678) (-1326.750) [-1321.665] (-1322.709) * [-1313.544] (-1318.233) (-1323.739) (-1316.219) -- 0:04:19
34000 -- (-1325.255) [-1326.221] (-1330.004) (-1323.505) * (-1324.623) (-1314.004) (-1320.561) [-1314.700] -- 0:04:15
34500 -- (-1318.403) (-1326.177) [-1317.847] (-1332.075) * (-1324.336) [-1312.531] (-1321.999) (-1316.740) -- 0:04:11
35000 -- (-1319.927) (-1321.262) (-1316.262) [-1318.873] * [-1321.096] (-1317.768) (-1320.448) (-1315.210) -- 0:04:08
Average standard deviation of split frequencies: 0.042194
35500 -- (-1315.335) (-1328.953) (-1311.473) [-1316.406] * (-1318.700) [-1316.595] (-1315.745) (-1327.745) -- 0:04:31
36000 -- [-1316.167] (-1324.864) (-1315.605) (-1326.656) * (-1328.395) [-1311.867] (-1330.980) (-1315.636) -- 0:04:27
36500 -- (-1321.838) (-1320.143) (-1326.475) [-1315.505] * (-1320.701) (-1318.620) [-1315.948] (-1324.197) -- 0:04:23
37000 -- (-1321.799) (-1320.016) [-1315.377] (-1322.414) * (-1319.808) (-1318.167) (-1332.467) [-1332.528] -- 0:04:20
37500 -- (-1315.446) [-1315.220] (-1320.334) (-1320.298) * (-1319.332) [-1316.546] (-1318.437) (-1326.686) -- 0:04:16
38000 -- (-1326.034) (-1317.586) [-1314.716] (-1316.830) * (-1335.777) [-1316.157] (-1326.620) (-1319.638) -- 0:04:13
38500 -- (-1329.985) [-1309.261] (-1325.115) (-1314.442) * (-1318.156) (-1315.316) [-1316.562] (-1325.436) -- 0:04:09
39000 -- (-1324.670) (-1317.894) [-1314.395] (-1320.231) * (-1332.063) (-1320.408) (-1328.095) [-1320.866] -- 0:04:31
39500 -- (-1329.441) (-1312.382) [-1325.552] (-1325.826) * (-1316.028) (-1313.446) (-1332.688) [-1326.965] -- 0:04:27
40000 -- (-1317.508) (-1325.190) [-1312.727] (-1315.277) * (-1328.182) [-1317.727] (-1320.952) (-1316.075) -- 0:04:24
Average standard deviation of split frequencies: 0.034132
40500 -- (-1340.170) [-1316.761] (-1320.235) (-1320.050) * (-1327.166) (-1326.825) (-1323.336) [-1311.002] -- 0:04:20
41000 -- [-1327.849] (-1328.863) (-1322.516) (-1318.344) * (-1323.278) (-1323.305) [-1319.852] (-1317.892) -- 0:04:17
41500 -- (-1329.792) (-1316.794) (-1311.007) [-1313.940] * (-1321.989) [-1322.028] (-1328.354) (-1321.458) -- 0:04:14
42000 -- (-1322.713) [-1318.602] (-1310.554) (-1318.064) * (-1324.232) [-1316.028] (-1324.300) (-1322.847) -- 0:04:10
42500 -- (-1324.383) (-1318.603) [-1314.130] (-1319.752) * (-1320.532) [-1317.681] (-1339.478) (-1321.421) -- 0:04:07
43000 -- (-1331.773) [-1318.457] (-1316.482) (-1320.276) * (-1329.068) [-1311.408] (-1335.371) (-1316.906) -- 0:04:27
43500 -- (-1338.395) (-1319.953) [-1311.132] (-1322.402) * (-1319.286) (-1317.945) (-1325.090) [-1313.686] -- 0:04:23
44000 -- (-1318.641) (-1332.031) (-1322.177) [-1318.600] * (-1323.711) (-1324.398) (-1320.387) [-1311.821] -- 0:04:20
44500 -- (-1320.084) [-1320.813] (-1334.979) (-1313.044) * (-1318.789) (-1311.971) (-1321.892) [-1310.325] -- 0:04:17
45000 -- (-1326.127) (-1323.576) (-1323.191) [-1320.214] * (-1335.462) (-1320.375) (-1324.182) [-1318.967] -- 0:04:14
Average standard deviation of split frequencies: 0.028047
45500 -- (-1325.048) (-1326.156) (-1327.423) [-1318.462] * (-1330.415) [-1316.308] (-1326.866) (-1317.315) -- 0:04:11
46000 -- (-1325.199) [-1314.335] (-1319.446) (-1331.042) * (-1315.508) (-1322.679) (-1325.218) [-1314.909] -- 0:04:08
46500 -- (-1337.422) (-1321.952) (-1329.353) [-1315.616] * (-1319.433) (-1322.760) (-1322.661) [-1321.053] -- 0:04:26
47000 -- (-1322.930) [-1311.682] (-1322.291) (-1327.442) * (-1325.824) [-1325.192] (-1325.339) (-1310.656) -- 0:04:23
47500 -- (-1329.671) (-1311.562) [-1314.905] (-1322.995) * (-1326.595) [-1318.414] (-1325.007) (-1314.579) -- 0:04:20
48000 -- [-1324.568] (-1311.341) (-1316.052) (-1323.340) * [-1317.068] (-1319.093) (-1326.100) (-1319.987) -- 0:04:17
48500 -- [-1316.142] (-1315.370) (-1319.567) (-1318.690) * (-1323.537) (-1324.071) [-1317.199] (-1314.499) -- 0:04:15
49000 -- [-1316.080] (-1316.696) (-1318.379) (-1321.564) * [-1319.561] (-1324.026) (-1321.333) (-1314.666) -- 0:04:12
49500 -- (-1321.838) (-1318.415) [-1317.998] (-1329.499) * (-1320.926) [-1319.015] (-1324.914) (-1321.606) -- 0:04:09
50000 -- (-1319.987) [-1323.942] (-1321.440) (-1316.787) * [-1317.209] (-1324.960) (-1328.374) (-1328.817) -- 0:04:26
Average standard deviation of split frequencies: 0.024294
50500 -- (-1313.288) (-1317.950) (-1323.553) [-1317.506] * [-1312.549] (-1320.819) (-1324.949) (-1314.780) -- 0:04:23
51000 -- (-1324.022) [-1321.435] (-1316.780) (-1315.099) * (-1325.387) [-1313.940] (-1320.878) (-1318.152) -- 0:04:20
51500 -- (-1323.325) (-1321.277) [-1323.189] (-1318.921) * (-1314.231) (-1312.455) (-1335.328) [-1312.301] -- 0:04:17
52000 -- (-1320.590) [-1318.488] (-1325.005) (-1317.630) * (-1320.984) [-1320.012] (-1321.880) (-1324.322) -- 0:04:15
52500 -- (-1321.870) (-1319.044) [-1314.599] (-1313.429) * (-1313.271) (-1319.361) (-1323.837) [-1315.097] -- 0:04:12
53000 -- (-1319.501) (-1314.684) [-1311.782] (-1317.349) * [-1319.094] (-1324.811) (-1314.493) (-1327.408) -- 0:04:10
53500 -- (-1319.102) (-1313.986) [-1322.889] (-1316.975) * (-1327.819) [-1319.275] (-1321.100) (-1315.724) -- 0:04:07
54000 -- [-1319.019] (-1316.312) (-1325.991) (-1331.530) * [-1323.151] (-1312.750) (-1332.692) (-1314.216) -- 0:04:22
54500 -- [-1316.142] (-1323.035) (-1320.204) (-1316.113) * [-1320.950] (-1317.419) (-1321.154) (-1316.931) -- 0:04:20
55000 -- [-1314.043] (-1325.679) (-1324.474) (-1329.571) * (-1316.807) (-1325.097) (-1318.479) [-1313.046] -- 0:04:17
Average standard deviation of split frequencies: 0.026189
55500 -- (-1321.982) (-1325.241) [-1321.742] (-1315.740) * [-1321.933] (-1323.265) (-1325.527) (-1313.317) -- 0:04:15
56000 -- (-1328.087) [-1309.132] (-1326.311) (-1312.682) * (-1319.961) (-1318.429) [-1322.810] (-1318.439) -- 0:04:12
56500 -- (-1321.201) [-1315.210] (-1316.064) (-1317.463) * (-1331.378) (-1313.364) (-1328.305) [-1314.079] -- 0:04:10
57000 -- (-1323.908) (-1318.554) (-1325.654) [-1319.161] * [-1320.066] (-1332.964) (-1324.498) (-1318.577) -- 0:04:08
57500 -- [-1314.481] (-1323.806) (-1315.674) (-1315.788) * [-1315.537] (-1323.436) (-1320.840) (-1315.752) -- 0:04:22
58000 -- (-1328.612) [-1313.172] (-1323.444) (-1316.734) * (-1333.309) (-1320.053) (-1327.377) [-1321.297] -- 0:04:19
58500 -- (-1325.280) (-1316.833) (-1316.074) [-1323.785] * [-1311.787] (-1315.706) (-1313.644) (-1325.052) -- 0:04:17
59000 -- (-1321.493) [-1316.598] (-1313.664) (-1322.884) * (-1314.267) (-1331.561) (-1319.847) [-1317.099] -- 0:04:15
59500 -- (-1321.916) (-1317.639) [-1314.871] (-1320.672) * [-1320.418] (-1324.794) (-1320.220) (-1318.146) -- 0:04:12
60000 -- (-1324.241) (-1321.699) [-1314.984] (-1321.858) * (-1326.688) (-1326.036) (-1314.021) [-1314.867] -- 0:04:10
Average standard deviation of split frequencies: 0.026765
60500 -- (-1320.414) [-1317.972] (-1315.984) (-1326.150) * (-1335.014) (-1323.013) [-1319.331] (-1327.100) -- 0:04:08
61000 -- (-1321.567) [-1322.173] (-1316.182) (-1314.743) * (-1324.006) (-1328.552) (-1325.380) [-1321.050] -- 0:04:06
61500 -- (-1320.280) [-1315.805] (-1315.279) (-1325.437) * [-1315.946] (-1323.945) (-1319.789) (-1317.273) -- 0:04:19
62000 -- (-1319.355) [-1312.884] (-1319.469) (-1319.064) * [-1316.719] (-1319.094) (-1323.245) (-1326.693) -- 0:04:17
62500 -- (-1325.466) [-1316.997] (-1337.545) (-1329.993) * (-1315.806) [-1315.579] (-1319.871) (-1313.134) -- 0:04:15
63000 -- (-1324.062) (-1315.599) (-1318.463) [-1325.382] * (-1322.145) (-1318.001) [-1319.972] (-1334.077) -- 0:04:12
63500 -- (-1336.600) [-1313.827] (-1318.996) (-1330.813) * (-1322.095) (-1324.462) [-1316.586] (-1325.801) -- 0:04:10
64000 -- (-1324.025) (-1331.523) [-1316.922] (-1318.584) * (-1320.689) (-1317.278) (-1325.798) [-1318.965] -- 0:04:08
64500 -- (-1330.728) (-1325.441) (-1319.410) [-1318.610] * (-1320.449) (-1322.707) (-1317.521) [-1323.682] -- 0:04:06
65000 -- (-1325.056) (-1327.908) [-1313.063] (-1313.264) * (-1320.109) (-1321.899) (-1316.432) [-1315.572] -- 0:04:18
Average standard deviation of split frequencies: 0.031348
65500 -- (-1316.859) (-1342.975) [-1316.984] (-1321.575) * (-1325.737) (-1316.668) [-1318.725] (-1325.067) -- 0:04:16
66000 -- (-1327.446) (-1320.294) (-1318.232) [-1315.100] * (-1325.997) (-1318.307) [-1322.825] (-1313.962) -- 0:04:14
66500 -- (-1323.942) [-1319.085] (-1319.028) (-1316.497) * (-1317.928) (-1314.973) (-1322.736) [-1327.444] -- 0:04:12
67000 -- (-1314.343) [-1322.162] (-1312.462) (-1315.414) * [-1313.711] (-1318.038) (-1326.506) (-1322.545) -- 0:04:10
67500 -- (-1327.175) (-1325.806) [-1317.650] (-1322.007) * (-1318.611) [-1307.342] (-1317.673) (-1316.045) -- 0:04:08
68000 -- (-1318.650) (-1320.308) [-1322.848] (-1315.882) * (-1321.410) [-1310.291] (-1313.127) (-1315.102) -- 0:04:06
68500 -- (-1319.531) (-1326.782) [-1323.702] (-1311.946) * (-1322.579) [-1312.726] (-1315.564) (-1326.022) -- 0:04:04
69000 -- [-1325.107] (-1320.354) (-1316.176) (-1315.778) * (-1317.047) (-1317.010) [-1315.263] (-1312.799) -- 0:04:16
69500 -- (-1316.676) (-1326.815) (-1316.944) [-1318.371] * (-1322.333) (-1318.401) [-1320.717] (-1330.063) -- 0:04:14
70000 -- (-1320.354) (-1319.358) [-1320.201] (-1319.071) * [-1317.371] (-1312.246) (-1320.860) (-1316.402) -- 0:04:12
Average standard deviation of split frequencies: 0.032613
70500 -- [-1321.278] (-1322.946) (-1327.074) (-1316.341) * (-1331.628) (-1315.635) (-1313.443) [-1320.279] -- 0:04:10
71000 -- (-1323.652) (-1319.852) (-1324.325) [-1307.327] * (-1325.715) (-1315.731) (-1320.724) [-1315.661] -- 0:04:08
71500 -- [-1314.936] (-1314.982) (-1316.597) (-1313.919) * (-1314.981) [-1312.270] (-1318.230) (-1317.606) -- 0:04:06
72000 -- (-1325.554) [-1322.553] (-1318.340) (-1317.935) * (-1317.744) (-1317.060) (-1324.970) [-1316.408] -- 0:04:04
72500 -- [-1315.793] (-1319.458) (-1322.577) (-1312.736) * (-1321.803) (-1320.198) (-1324.909) [-1321.540] -- 0:04:15
73000 -- (-1319.044) [-1315.383] (-1330.110) (-1336.321) * (-1324.581) (-1326.221) [-1323.575] (-1313.965) -- 0:04:13
73500 -- (-1321.187) (-1316.298) [-1311.277] (-1317.670) * [-1315.339] (-1315.731) (-1329.454) (-1311.652) -- 0:04:12
74000 -- (-1317.273) (-1324.876) [-1312.526] (-1332.772) * (-1324.047) [-1315.068] (-1316.693) (-1319.731) -- 0:04:10
74500 -- (-1327.268) (-1328.350) [-1308.616] (-1320.617) * (-1322.318) (-1316.494) (-1319.070) [-1318.109] -- 0:04:08
75000 -- [-1330.560] (-1315.990) (-1309.831) (-1323.756) * (-1329.577) [-1319.011] (-1316.041) (-1325.830) -- 0:04:06
Average standard deviation of split frequencies: 0.027223
75500 -- (-1322.515) (-1320.809) [-1317.651] (-1312.665) * (-1319.828) (-1318.772) (-1319.775) [-1320.214] -- 0:04:04
76000 -- (-1312.108) (-1320.603) [-1316.760] (-1318.574) * (-1330.833) (-1316.527) (-1313.309) [-1318.642] -- 0:04:03
76500 -- [-1312.796] (-1338.842) (-1319.102) (-1320.348) * (-1319.983) (-1313.970) [-1314.600] (-1327.611) -- 0:04:13
77000 -- (-1312.090) (-1319.945) (-1327.828) [-1321.603] * (-1318.040) (-1317.732) (-1316.513) [-1324.715] -- 0:04:11
77500 -- [-1316.518] (-1318.273) (-1329.508) (-1321.232) * (-1323.774) (-1324.396) (-1314.728) [-1318.735] -- 0:04:09
78000 -- (-1312.069) (-1323.599) [-1316.247] (-1320.282) * (-1314.792) [-1320.486] (-1315.945) (-1319.640) -- 0:04:08
78500 -- (-1316.205) [-1319.577] (-1317.818) (-1324.839) * [-1322.399] (-1317.622) (-1329.304) (-1314.875) -- 0:04:06
79000 -- [-1320.041] (-1320.228) (-1317.108) (-1317.818) * (-1316.113) (-1316.371) [-1316.949] (-1318.968) -- 0:04:04
79500 -- [-1314.093] (-1320.182) (-1320.850) (-1313.007) * (-1320.132) (-1315.428) (-1324.616) [-1318.862] -- 0:04:03
80000 -- (-1314.237) (-1321.360) (-1322.127) [-1315.423] * (-1324.709) [-1311.912] (-1330.301) (-1329.436) -- 0:04:13
Average standard deviation of split frequencies: 0.020282
80500 -- (-1310.457) (-1335.310) [-1319.822] (-1318.409) * (-1318.015) (-1317.170) [-1314.178] (-1327.010) -- 0:04:11
81000 -- (-1318.857) (-1321.906) (-1322.736) [-1320.420] * (-1316.286) (-1318.410) [-1311.220] (-1320.211) -- 0:04:09
81500 -- (-1316.280) (-1322.737) [-1320.638] (-1320.027) * [-1317.710] (-1317.287) (-1315.057) (-1313.180) -- 0:04:07
82000 -- (-1315.450) (-1322.493) [-1327.626] (-1320.718) * (-1317.790) (-1314.444) [-1316.724] (-1321.516) -- 0:04:06
82500 -- (-1321.820) [-1321.076] (-1322.834) (-1312.125) * (-1312.276) [-1317.974] (-1320.947) (-1317.429) -- 0:04:04
83000 -- [-1321.560] (-1320.066) (-1319.721) (-1313.821) * [-1312.058] (-1321.890) (-1319.489) (-1315.491) -- 0:04:03
83500 -- [-1315.473] (-1328.140) (-1322.657) (-1317.313) * (-1327.621) (-1324.354) [-1314.184] (-1325.788) -- 0:04:12
84000 -- [-1318.983] (-1322.118) (-1318.610) (-1325.513) * (-1318.490) [-1316.480] (-1321.624) (-1324.784) -- 0:04:10
84500 -- [-1318.570] (-1320.792) (-1319.003) (-1332.171) * (-1313.355) (-1320.833) [-1315.479] (-1318.923) -- 0:04:09
85000 -- (-1321.920) (-1318.582) [-1323.315] (-1313.524) * (-1328.262) (-1316.681) (-1316.486) [-1312.914] -- 0:04:07
Average standard deviation of split frequencies: 0.017412
85500 -- (-1320.943) [-1317.823] (-1331.546) (-1319.191) * (-1334.778) (-1315.715) [-1323.343] (-1321.826) -- 0:04:06
86000 -- (-1323.167) (-1322.036) [-1310.396] (-1319.771) * (-1319.418) (-1318.871) (-1317.960) [-1317.777] -- 0:04:04
86500 -- (-1322.847) [-1325.018] (-1317.166) (-1323.192) * (-1327.304) (-1320.318) [-1313.504] (-1323.166) -- 0:04:02
87000 -- (-1315.339) [-1317.479] (-1315.008) (-1319.913) * (-1311.796) [-1315.045] (-1320.849) (-1315.837) -- 0:04:01
87500 -- (-1312.077) (-1322.297) [-1319.151] (-1321.883) * (-1321.671) [-1316.882] (-1311.037) (-1317.549) -- 0:04:10
88000 -- (-1317.353) (-1318.586) [-1320.220] (-1318.764) * [-1310.120] (-1320.696) (-1321.123) (-1321.507) -- 0:04:08
88500 -- (-1317.037) (-1323.608) [-1314.617] (-1329.135) * (-1317.720) (-1336.337) [-1316.501] (-1318.973) -- 0:04:07
89000 -- [-1313.709] (-1325.141) (-1331.093) (-1317.574) * (-1319.052) (-1316.130) (-1316.382) [-1311.883] -- 0:04:05
89500 -- (-1330.946) (-1324.931) (-1329.132) [-1324.168] * (-1320.855) [-1317.822] (-1326.290) (-1313.577) -- 0:04:04
90000 -- (-1324.136) (-1327.385) [-1324.475] (-1315.451) * (-1317.368) (-1321.943) (-1313.479) [-1309.233] -- 0:04:02
Average standard deviation of split frequencies: 0.012234
90500 -- (-1326.916) [-1319.355] (-1316.139) (-1323.174) * (-1320.244) (-1323.878) (-1331.473) [-1318.808] -- 0:04:01
91000 -- (-1320.283) (-1313.974) (-1320.420) [-1321.620] * [-1322.752] (-1331.991) (-1317.931) (-1332.386) -- 0:04:09
91500 -- (-1325.067) (-1317.665) [-1314.366] (-1313.995) * [-1315.592] (-1330.433) (-1316.928) (-1324.344) -- 0:04:08
92000 -- [-1313.180] (-1316.588) (-1326.291) (-1323.431) * (-1317.448) (-1325.930) [-1320.920] (-1316.119) -- 0:04:06
92500 -- [-1314.551] (-1319.847) (-1330.368) (-1333.938) * [-1321.152] (-1329.431) (-1324.349) (-1323.212) -- 0:04:05
93000 -- [-1318.084] (-1330.272) (-1328.576) (-1318.443) * (-1321.218) [-1317.311] (-1326.681) (-1317.690) -- 0:04:03
93500 -- (-1320.064) (-1313.966) [-1317.217] (-1318.439) * (-1318.609) (-1323.736) [-1325.681] (-1317.361) -- 0:04:02
94000 -- (-1313.018) (-1315.430) (-1324.657) [-1316.836] * [-1314.851] (-1320.114) (-1326.607) (-1319.560) -- 0:04:00
94500 -- [-1320.184] (-1325.749) (-1321.956) (-1326.369) * (-1314.543) [-1313.871] (-1330.462) (-1320.149) -- 0:03:59
95000 -- (-1312.202) (-1318.658) [-1314.100] (-1318.893) * [-1314.149] (-1322.393) (-1327.010) (-1325.720) -- 0:04:07
Average standard deviation of split frequencies: 0.016753
95500 -- (-1318.308) (-1315.183) (-1328.998) [-1313.037] * (-1319.572) [-1313.456] (-1326.044) (-1331.085) -- 0:04:06
96000 -- (-1323.595) (-1314.206) (-1315.632) [-1311.861] * [-1321.099] (-1320.611) (-1332.045) (-1317.109) -- 0:04:04
96500 -- (-1316.320) [-1320.818] (-1314.842) (-1314.267) * (-1318.103) (-1311.042) (-1327.857) [-1312.255] -- 0:04:03
97000 -- (-1317.557) (-1323.116) [-1312.105] (-1320.659) * (-1316.694) [-1313.459] (-1317.769) (-1311.986) -- 0:04:02
97500 -- [-1327.043] (-1312.666) (-1323.238) (-1319.479) * (-1323.435) [-1326.490] (-1320.847) (-1314.075) -- 0:04:00
98000 -- (-1332.718) (-1317.737) (-1322.161) [-1314.436] * (-1321.535) [-1313.299] (-1320.109) (-1313.810) -- 0:03:59
98500 -- (-1329.330) (-1326.104) (-1329.272) [-1323.589] * (-1320.732) [-1314.873] (-1317.224) (-1317.854) -- 0:04:07
99000 -- (-1338.508) (-1331.011) [-1320.964] (-1314.121) * (-1315.714) (-1319.292) (-1314.007) [-1316.878] -- 0:04:05
99500 -- (-1332.054) [-1315.073] (-1326.082) (-1315.113) * (-1322.092) [-1318.142] (-1324.548) (-1322.448) -- 0:04:04
100000 -- (-1323.420) (-1319.489) (-1335.543) [-1308.280] * (-1325.644) (-1319.362) (-1318.084) [-1313.359] -- 0:04:03
Average standard deviation of split frequencies: 0.014599
100500 -- (-1324.045) [-1320.181] (-1333.238) (-1315.195) * [-1310.098] (-1323.402) (-1319.402) (-1317.764) -- 0:04:01
101000 -- (-1322.562) (-1317.239) (-1324.358) [-1311.791] * (-1321.327) [-1314.900] (-1318.266) (-1318.216) -- 0:04:00
101500 -- (-1317.245) (-1323.232) (-1312.536) [-1310.854] * (-1326.330) (-1310.514) (-1313.821) [-1312.413] -- 0:03:59
102000 -- (-1314.429) (-1334.433) (-1321.403) [-1311.736] * (-1311.627) (-1317.178) (-1316.070) [-1311.694] -- 0:03:57
102500 -- (-1321.468) (-1318.480) (-1320.755) [-1321.744] * (-1316.913) [-1316.404] (-1316.679) (-1314.302) -- 0:04:05
103000 -- (-1318.647) (-1323.441) (-1318.009) [-1319.850] * (-1328.428) (-1324.522) (-1318.399) [-1327.752] -- 0:04:03
103500 -- [-1328.518] (-1318.356) (-1324.546) (-1324.921) * (-1310.101) (-1321.911) [-1312.790] (-1318.460) -- 0:04:02
104000 -- (-1320.695) (-1319.540) [-1319.406] (-1315.097) * [-1309.555] (-1317.463) (-1315.131) (-1326.950) -- 0:04:01
104500 -- (-1330.219) (-1318.575) (-1321.277) [-1324.505] * (-1315.314) (-1320.529) (-1319.196) [-1316.653] -- 0:03:59
105000 -- (-1331.970) (-1313.937) (-1322.740) [-1321.871] * (-1317.918) [-1310.311] (-1313.943) (-1314.920) -- 0:03:58
Average standard deviation of split frequencies: 0.013064
105500 -- (-1320.963) (-1316.801) (-1325.068) [-1318.380] * [-1317.451] (-1317.136) (-1313.837) (-1313.646) -- 0:03:57
106000 -- (-1318.731) (-1325.273) (-1318.796) [-1322.483] * (-1328.794) (-1324.223) [-1315.229] (-1329.024) -- 0:04:04
106500 -- (-1318.540) (-1320.674) (-1327.891) [-1310.666] * (-1315.974) (-1330.566) [-1320.941] (-1321.924) -- 0:04:03
107000 -- (-1322.908) (-1325.799) (-1316.504) [-1317.693] * (-1316.344) [-1312.283] (-1325.953) (-1312.407) -- 0:04:02
107500 -- [-1322.474] (-1330.015) (-1324.963) (-1311.363) * [-1314.554] (-1321.907) (-1322.002) (-1313.848) -- 0:04:00
108000 -- (-1327.414) (-1315.253) [-1317.800] (-1323.131) * [-1316.746] (-1321.799) (-1321.406) (-1321.043) -- 0:03:59
108500 -- (-1323.477) (-1336.033) (-1316.114) [-1322.922] * (-1318.254) [-1314.800] (-1321.758) (-1317.925) -- 0:03:58
109000 -- (-1316.938) [-1319.707] (-1326.311) (-1331.547) * (-1316.183) (-1313.997) [-1311.603] (-1321.998) -- 0:03:57
109500 -- (-1316.722) (-1329.431) (-1323.961) [-1315.346] * (-1319.716) (-1311.865) (-1323.120) [-1318.929] -- 0:04:03
110000 -- (-1321.948) (-1332.881) (-1313.456) [-1329.795] * (-1314.487) (-1324.143) (-1328.146) [-1317.193] -- 0:04:02
Average standard deviation of split frequencies: 0.018370
110500 -- (-1324.090) (-1321.811) [-1315.883] (-1315.599) * (-1315.585) (-1319.039) (-1322.637) [-1317.987] -- 0:04:01
111000 -- (-1323.107) (-1319.344) (-1322.018) [-1320.648] * (-1327.563) (-1315.198) (-1320.826) [-1322.642] -- 0:04:00
111500 -- (-1329.652) (-1314.977) [-1321.803] (-1322.827) * (-1309.714) [-1315.698] (-1316.708) (-1313.028) -- 0:03:59
112000 -- (-1320.298) (-1327.662) [-1312.959] (-1329.133) * [-1313.911] (-1324.546) (-1327.714) (-1341.530) -- 0:03:57
112500 -- (-1321.395) (-1317.467) [-1311.246] (-1322.674) * [-1315.377] (-1325.636) (-1321.734) (-1313.875) -- 0:03:56
113000 -- (-1317.929) [-1317.247] (-1316.532) (-1323.976) * [-1315.902] (-1326.257) (-1324.307) (-1320.974) -- 0:03:55
113500 -- [-1310.062] (-1316.842) (-1316.167) (-1319.653) * (-1322.691) (-1320.612) (-1325.956) [-1312.328] -- 0:04:02
114000 -- (-1313.770) (-1318.279) [-1314.153] (-1314.414) * [-1325.563] (-1323.381) (-1323.018) (-1320.146) -- 0:04:00
114500 -- (-1318.689) [-1320.913] (-1316.556) (-1323.118) * [-1317.414] (-1315.222) (-1320.251) (-1324.548) -- 0:03:59
115000 -- (-1319.056) (-1320.304) [-1313.584] (-1326.641) * (-1324.830) (-1323.395) (-1320.157) [-1315.208] -- 0:03:58
Average standard deviation of split frequencies: 0.018795
115500 -- [-1312.733] (-1316.875) (-1323.579) (-1325.327) * [-1317.851] (-1325.852) (-1325.392) (-1316.747) -- 0:03:57
116000 -- (-1329.327) (-1322.050) (-1320.682) [-1320.749] * (-1330.621) (-1320.668) [-1324.926] (-1321.852) -- 0:03:56
116500 -- (-1318.134) [-1318.061] (-1320.670) (-1317.186) * (-1324.434) (-1322.313) (-1319.746) [-1316.165] -- 0:03:55
117000 -- (-1325.778) (-1327.062) [-1320.229] (-1315.510) * (-1330.188) [-1318.877] (-1318.657) (-1314.021) -- 0:04:01
117500 -- (-1317.784) [-1319.115] (-1320.863) (-1322.816) * (-1332.221) (-1314.135) (-1321.585) [-1312.286] -- 0:04:00
118000 -- [-1320.392] (-1324.537) (-1322.840) (-1327.437) * (-1329.306) (-1322.090) [-1313.803] (-1318.553) -- 0:03:59
118500 -- (-1333.443) (-1321.405) [-1314.250] (-1322.565) * [-1318.750] (-1328.380) (-1317.727) (-1324.315) -- 0:03:58
119000 -- (-1318.222) [-1318.693] (-1319.568) (-1331.424) * (-1320.243) [-1324.432] (-1319.445) (-1329.109) -- 0:03:56
119500 -- (-1322.761) [-1313.703] (-1321.087) (-1330.054) * (-1317.505) (-1329.262) [-1317.461] (-1330.349) -- 0:03:55
120000 -- (-1310.188) [-1316.996] (-1328.591) (-1325.642) * (-1318.842) [-1315.198] (-1324.816) (-1318.206) -- 0:03:54
Average standard deviation of split frequencies: 0.020266
120500 -- [-1314.828] (-1323.579) (-1313.704) (-1338.114) * [-1324.940] (-1324.103) (-1325.859) (-1314.787) -- 0:03:53
121000 -- (-1316.259) (-1321.751) [-1321.563] (-1327.545) * (-1320.944) [-1316.281] (-1322.530) (-1317.915) -- 0:03:59
121500 -- [-1317.384] (-1328.641) (-1320.448) (-1319.417) * (-1318.904) [-1311.535] (-1325.428) (-1328.706) -- 0:03:58
122000 -- (-1320.007) [-1315.311] (-1324.358) (-1326.448) * [-1323.538] (-1316.682) (-1322.332) (-1325.224) -- 0:03:57
122500 -- (-1331.178) (-1319.068) [-1313.298] (-1322.541) * (-1322.786) [-1307.668] (-1319.397) (-1323.242) -- 0:03:56
123000 -- (-1326.462) (-1314.640) (-1321.944) [-1314.182] * (-1316.906) (-1315.761) [-1312.780] (-1320.609) -- 0:03:55
123500 -- (-1313.941) (-1315.370) [-1316.687] (-1320.444) * (-1318.485) (-1323.076) [-1310.646] (-1322.919) -- 0:03:54
124000 -- (-1317.543) (-1316.784) [-1319.959] (-1322.367) * (-1317.609) [-1324.129] (-1322.497) (-1313.034) -- 0:03:53
124500 -- [-1318.975] (-1325.532) (-1316.608) (-1316.397) * (-1326.246) (-1315.566) [-1319.473] (-1313.945) -- 0:03:59
125000 -- (-1319.323) [-1317.019] (-1318.586) (-1319.310) * [-1312.133] (-1312.888) (-1318.563) (-1313.263) -- 0:03:58
Average standard deviation of split frequencies: 0.021980
125500 -- [-1317.076] (-1317.450) (-1321.000) (-1320.767) * (-1309.062) [-1313.051] (-1321.837) (-1323.331) -- 0:03:56
126000 -- (-1314.728) [-1311.097] (-1318.929) (-1318.254) * (-1318.481) [-1312.882] (-1324.804) (-1328.999) -- 0:03:55
126500 -- (-1313.218) (-1318.669) [-1326.352] (-1318.005) * (-1335.739) (-1324.459) [-1322.859] (-1322.946) -- 0:03:54
127000 -- [-1318.814] (-1320.461) (-1321.328) (-1318.695) * (-1327.172) (-1321.033) [-1313.627] (-1314.882) -- 0:03:53
127500 -- (-1320.540) (-1320.165) (-1317.023) [-1313.976] * (-1319.866) (-1329.702) [-1317.051] (-1320.944) -- 0:03:52
128000 -- [-1322.626] (-1329.897) (-1320.418) (-1325.615) * (-1317.360) (-1322.407) [-1318.837] (-1331.593) -- 0:03:58
128500 -- (-1314.359) (-1326.792) (-1311.839) [-1322.479] * [-1309.138] (-1320.498) (-1321.273) (-1320.084) -- 0:03:57
129000 -- (-1322.592) (-1328.801) [-1319.488] (-1320.721) * (-1322.603) [-1314.004] (-1312.452) (-1320.887) -- 0:03:56
129500 -- [-1313.286] (-1321.700) (-1314.664) (-1330.636) * (-1313.558) [-1322.712] (-1322.904) (-1327.716) -- 0:03:55
130000 -- (-1316.914) [-1319.110] (-1333.285) (-1322.262) * (-1320.683) [-1310.176] (-1327.594) (-1321.545) -- 0:03:54
Average standard deviation of split frequencies: 0.022548
130500 -- [-1320.765] (-1319.207) (-1320.930) (-1318.425) * (-1313.313) (-1318.230) [-1319.682] (-1321.559) -- 0:03:53
131000 -- (-1319.594) (-1321.961) [-1317.253] (-1319.518) * (-1325.712) (-1320.946) (-1321.472) [-1315.463] -- 0:03:52
131500 -- (-1325.208) (-1317.589) (-1322.850) [-1316.543] * (-1332.298) (-1318.112) [-1309.442] (-1321.846) -- 0:03:51
132000 -- (-1324.006) [-1315.359] (-1322.204) (-1327.433) * [-1314.166] (-1312.429) (-1315.748) (-1320.382) -- 0:03:56
132500 -- (-1322.611) (-1320.253) (-1327.161) [-1317.607] * [-1315.207] (-1321.601) (-1325.255) (-1320.027) -- 0:03:55
133000 -- [-1315.365] (-1319.443) (-1330.096) (-1316.471) * [-1320.205] (-1325.799) (-1318.398) (-1326.910) -- 0:03:54
133500 -- (-1318.625) (-1321.873) (-1329.083) [-1313.457] * (-1318.712) (-1316.638) (-1317.132) [-1310.609] -- 0:03:53
134000 -- (-1322.174) (-1332.935) (-1320.002) [-1320.078] * [-1313.823] (-1322.398) (-1321.959) (-1313.807) -- 0:03:52
134500 -- (-1317.866) (-1321.998) (-1317.417) [-1315.772] * (-1315.906) [-1325.935] (-1314.336) (-1318.706) -- 0:03:51
135000 -- [-1322.112] (-1317.650) (-1339.551) (-1328.270) * (-1316.495) (-1320.214) (-1308.669) [-1314.780] -- 0:03:50
Average standard deviation of split frequencies: 0.018631
135500 -- (-1327.719) [-1311.426] (-1316.308) (-1320.590) * (-1321.268) (-1325.158) (-1315.826) [-1318.240] -- 0:03:49
136000 -- (-1316.381) (-1314.797) [-1313.473] (-1322.683) * (-1318.939) [-1316.341] (-1321.874) (-1323.520) -- 0:03:55
136500 -- (-1312.237) (-1317.394) (-1319.585) [-1317.049] * [-1320.949] (-1319.803) (-1320.617) (-1321.415) -- 0:03:54
137000 -- [-1319.365] (-1317.826) (-1326.826) (-1329.827) * (-1312.602) (-1316.669) [-1311.727] (-1325.652) -- 0:03:53
137500 -- (-1320.813) (-1308.261) [-1308.878] (-1314.969) * (-1320.888) (-1311.636) [-1315.033] (-1317.673) -- 0:03:52
138000 -- [-1314.380] (-1318.035) (-1320.527) (-1321.824) * (-1325.743) (-1321.354) [-1308.577] (-1317.998) -- 0:03:51
138500 -- (-1328.332) (-1314.428) (-1318.249) [-1311.983] * (-1324.129) (-1314.795) [-1312.848] (-1318.952) -- 0:03:50
139000 -- (-1320.657) [-1314.454] (-1323.978) (-1319.403) * (-1320.403) (-1319.217) [-1313.306] (-1323.270) -- 0:03:49
139500 -- (-1316.460) [-1312.409] (-1319.898) (-1319.173) * [-1314.667] (-1325.153) (-1316.229) (-1318.281) -- 0:03:54
140000 -- [-1316.046] (-1328.414) (-1315.451) (-1321.190) * [-1314.193] (-1320.756) (-1323.381) (-1323.020) -- 0:03:53
Average standard deviation of split frequencies: 0.019269
140500 -- (-1316.807) (-1313.443) (-1317.312) [-1307.497] * [-1312.326] (-1325.231) (-1319.695) (-1317.509) -- 0:03:52
141000 -- [-1327.752] (-1325.216) (-1325.012) (-1311.257) * (-1319.495) (-1313.919) (-1317.560) [-1323.867] -- 0:03:51
141500 -- (-1327.980) (-1317.159) [-1320.365] (-1326.120) * (-1322.351) [-1314.088] (-1315.389) (-1318.361) -- 0:03:50
142000 -- (-1318.724) [-1323.654] (-1322.249) (-1312.952) * (-1327.545) (-1315.859) (-1311.287) [-1310.540] -- 0:03:49
142500 -- [-1323.963] (-1323.364) (-1329.227) (-1311.745) * (-1326.151) (-1317.904) [-1312.056] (-1317.764) -- 0:03:48
143000 -- (-1320.148) (-1323.860) [-1313.927] (-1312.050) * (-1319.689) [-1310.516] (-1318.542) (-1327.541) -- 0:03:53
143500 -- (-1318.750) [-1316.558] (-1323.551) (-1315.063) * [-1314.808] (-1327.370) (-1321.077) (-1319.156) -- 0:03:52
144000 -- (-1326.146) (-1323.950) [-1312.330] (-1316.776) * (-1320.871) (-1321.789) (-1321.050) [-1315.585] -- 0:03:51
144500 -- (-1320.762) (-1315.449) (-1325.144) [-1319.285] * [-1310.822] (-1322.809) (-1322.128) (-1330.970) -- 0:03:50
145000 -- [-1327.644] (-1322.578) (-1321.636) (-1324.920) * [-1315.272] (-1320.751) (-1321.963) (-1316.457) -- 0:03:49
Average standard deviation of split frequencies: 0.016346
145500 -- (-1321.896) (-1327.486) (-1313.196) [-1326.926] * (-1314.219) (-1318.106) (-1325.377) [-1327.000] -- 0:03:49
146000 -- [-1318.422] (-1320.966) (-1317.509) (-1332.141) * (-1320.596) (-1334.066) [-1310.256] (-1319.862) -- 0:03:48
146500 -- (-1309.620) (-1328.001) [-1323.046] (-1313.356) * (-1318.712) (-1323.235) (-1323.020) [-1321.318] -- 0:03:47
147000 -- (-1311.998) [-1318.744] (-1321.830) (-1316.220) * (-1317.985) [-1314.341] (-1319.640) (-1324.807) -- 0:03:52
147500 -- (-1320.961) (-1318.256) (-1332.378) [-1316.594] * [-1319.151] (-1321.305) (-1313.961) (-1319.267) -- 0:03:51
148000 -- (-1320.847) (-1319.480) (-1327.821) [-1313.311] * (-1318.185) (-1326.430) (-1323.917) [-1317.873] -- 0:03:50
148500 -- [-1319.105] (-1338.726) (-1324.095) (-1330.825) * [-1313.026] (-1320.142) (-1315.645) (-1326.561) -- 0:03:49
149000 -- (-1319.550) (-1329.911) [-1316.176] (-1308.714) * [-1312.565] (-1319.752) (-1317.632) (-1319.683) -- 0:03:48
149500 -- [-1320.028] (-1331.821) (-1318.790) (-1323.726) * [-1317.789] (-1326.122) (-1323.080) (-1325.078) -- 0:03:47
150000 -- [-1316.873] (-1315.881) (-1326.317) (-1318.472) * [-1310.688] (-1327.580) (-1329.689) (-1330.404) -- 0:03:46
Average standard deviation of split frequencies: 0.012906
150500 -- (-1327.662) (-1319.959) [-1322.156] (-1310.166) * [-1320.742] (-1325.130) (-1332.961) (-1324.697) -- 0:03:51
151000 -- (-1316.847) (-1313.704) [-1317.997] (-1318.605) * [-1310.094] (-1319.130) (-1335.660) (-1329.032) -- 0:03:50
151500 -- (-1328.044) [-1309.722] (-1326.054) (-1322.811) * [-1316.714] (-1324.507) (-1326.024) (-1327.026) -- 0:03:49
152000 -- (-1327.877) (-1325.046) (-1329.654) [-1311.871] * (-1317.411) [-1319.727] (-1339.864) (-1321.885) -- 0:03:48
152500 -- (-1312.819) (-1325.761) (-1316.169) [-1317.461] * (-1317.442) [-1315.100] (-1343.694) (-1329.361) -- 0:03:47
153000 -- (-1315.876) (-1324.469) [-1318.649] (-1318.991) * (-1312.570) (-1317.206) (-1337.816) [-1319.095] -- 0:03:46
153500 -- (-1324.462) (-1323.633) (-1317.233) [-1321.982] * (-1328.709) [-1311.384] (-1333.315) (-1322.861) -- 0:03:46
154000 -- (-1331.981) (-1317.823) [-1318.700] (-1336.930) * (-1327.468) [-1309.058] (-1327.991) (-1322.144) -- 0:03:45
154500 -- (-1319.939) (-1320.331) (-1320.356) [-1320.207] * (-1318.844) (-1316.897) (-1330.746) [-1318.870] -- 0:03:49
155000 -- (-1321.371) [-1321.979] (-1326.667) (-1318.589) * (-1316.935) (-1319.725) (-1326.817) [-1313.823] -- 0:03:48
Average standard deviation of split frequencies: 0.011332
155500 -- (-1316.064) (-1328.438) [-1319.158] (-1337.926) * [-1323.337] (-1321.225) (-1334.265) (-1326.777) -- 0:03:48
156000 -- (-1317.774) (-1323.460) [-1317.721] (-1326.611) * (-1319.075) [-1317.308] (-1325.755) (-1320.952) -- 0:03:47
156500 -- [-1316.319] (-1317.779) (-1325.154) (-1334.100) * (-1321.285) (-1312.542) [-1323.003] (-1325.584) -- 0:03:46
157000 -- (-1316.906) [-1317.610] (-1324.543) (-1328.687) * (-1321.678) (-1310.168) (-1319.081) [-1318.177] -- 0:03:45
157500 -- (-1313.232) (-1315.732) [-1315.918] (-1332.967) * [-1324.142] (-1324.518) (-1318.387) (-1329.853) -- 0:03:44
158000 -- (-1320.055) (-1319.782) [-1314.589] (-1329.725) * (-1316.075) (-1316.099) [-1316.905] (-1318.211) -- 0:03:49
158500 -- (-1323.818) [-1314.459] (-1320.251) (-1317.298) * (-1324.611) [-1319.345] (-1323.520) (-1315.621) -- 0:03:48
159000 -- (-1313.092) [-1312.259] (-1328.389) (-1320.150) * [-1322.154] (-1328.443) (-1324.683) (-1314.814) -- 0:03:47
159500 -- (-1321.202) [-1310.908] (-1322.419) (-1332.846) * (-1320.618) [-1319.417] (-1328.223) (-1325.421) -- 0:03:46
160000 -- [-1319.340] (-1327.360) (-1315.592) (-1327.607) * (-1325.874) (-1316.036) (-1327.576) [-1316.418] -- 0:03:45
Average standard deviation of split frequencies: 0.014487
160500 -- [-1324.535] (-1317.347) (-1319.719) (-1318.189) * (-1318.914) [-1314.215] (-1316.418) (-1320.110) -- 0:03:44
161000 -- (-1331.251) [-1317.200] (-1325.874) (-1321.874) * (-1315.142) (-1328.734) (-1323.520) [-1305.780] -- 0:03:44
161500 -- [-1320.632] (-1319.899) (-1336.695) (-1321.140) * (-1318.521) (-1313.978) (-1329.478) [-1314.836] -- 0:03:43
162000 -- (-1314.978) (-1324.093) (-1325.665) [-1309.918] * (-1326.382) (-1317.747) (-1325.462) [-1319.088] -- 0:03:47
162500 -- (-1321.324) (-1317.449) [-1316.086] (-1317.283) * (-1331.559) (-1323.194) (-1324.725) [-1314.500] -- 0:03:46
163000 -- (-1337.292) (-1315.186) [-1307.091] (-1320.462) * (-1322.180) (-1313.937) [-1321.721] (-1309.759) -- 0:03:45
163500 -- (-1328.109) [-1314.748] (-1310.656) (-1312.244) * (-1320.334) (-1322.138) (-1322.030) [-1322.948] -- 0:03:45
164000 -- (-1325.188) [-1317.784] (-1320.143) (-1321.281) * (-1328.033) (-1327.601) (-1314.039) [-1311.909] -- 0:03:44
164500 -- (-1313.988) [-1320.361] (-1319.668) (-1318.520) * (-1312.450) (-1328.336) [-1319.875] (-1322.480) -- 0:03:43
165000 -- (-1313.919) [-1321.362] (-1323.148) (-1328.693) * [-1314.263] (-1327.642) (-1326.600) (-1316.421) -- 0:03:42
Average standard deviation of split frequencies: 0.012069
165500 -- (-1316.239) [-1314.066] (-1332.989) (-1327.130) * (-1324.859) (-1323.668) (-1321.240) [-1320.884] -- 0:03:46
166000 -- (-1309.536) [-1315.439] (-1334.410) (-1326.103) * (-1310.371) [-1313.539] (-1318.211) (-1317.043) -- 0:03:46
166500 -- (-1320.450) (-1318.844) [-1315.588] (-1327.382) * (-1317.497) [-1322.961] (-1330.901) (-1319.539) -- 0:03:45
167000 -- (-1322.317) (-1326.493) [-1321.464] (-1326.460) * (-1315.884) (-1325.348) [-1317.449] (-1323.948) -- 0:03:44
167500 -- [-1315.393] (-1321.677) (-1316.307) (-1320.125) * [-1318.364] (-1315.849) (-1320.805) (-1317.473) -- 0:03:43
168000 -- (-1321.377) [-1321.036] (-1321.361) (-1324.113) * (-1317.842) [-1310.801] (-1323.115) (-1312.571) -- 0:03:42
168500 -- (-1313.099) [-1322.032] (-1325.319) (-1331.094) * (-1319.210) (-1317.922) (-1327.282) [-1320.016] -- 0:03:42
169000 -- (-1325.699) (-1324.797) [-1314.118] (-1322.138) * [-1314.663] (-1321.268) (-1322.762) (-1318.333) -- 0:03:46
169500 -- (-1318.902) (-1322.743) [-1313.280] (-1324.252) * (-1317.074) [-1315.941] (-1329.412) (-1316.792) -- 0:03:45
170000 -- [-1318.563] (-1314.643) (-1321.891) (-1321.390) * (-1312.497) [-1318.882] (-1323.117) (-1323.840) -- 0:03:44
Average standard deviation of split frequencies: 0.012084
170500 -- [-1317.077] (-1322.976) (-1315.949) (-1320.034) * (-1307.615) (-1321.026) (-1326.503) [-1315.373] -- 0:03:43
171000 -- [-1314.719] (-1324.915) (-1321.267) (-1315.806) * (-1321.426) (-1319.143) (-1322.797) [-1313.873] -- 0:03:43
171500 -- (-1317.615) (-1330.398) [-1312.308] (-1322.237) * (-1323.034) (-1335.307) (-1327.896) [-1313.507] -- 0:03:42
172000 -- (-1316.344) (-1324.178) [-1314.392] (-1317.411) * (-1314.443) (-1326.101) [-1318.763] (-1312.374) -- 0:03:41
172500 -- (-1322.274) [-1316.309] (-1317.845) (-1319.817) * (-1325.218) [-1318.273] (-1322.172) (-1312.073) -- 0:03:40
173000 -- (-1320.526) (-1313.021) (-1327.643) [-1315.194] * [-1311.505] (-1317.106) (-1325.349) (-1313.987) -- 0:03:44
173500 -- (-1313.285) [-1320.474] (-1313.229) (-1321.496) * (-1319.864) (-1314.870) (-1317.640) [-1317.674] -- 0:03:43
174000 -- (-1321.238) [-1314.630] (-1318.087) (-1313.910) * [-1311.736] (-1324.046) (-1316.275) (-1324.686) -- 0:03:43
174500 -- (-1319.076) (-1320.020) [-1313.514] (-1317.380) * (-1325.519) (-1320.070) (-1326.431) [-1318.713] -- 0:03:42
175000 -- (-1321.827) (-1325.891) (-1327.360) [-1322.247] * (-1323.787) (-1312.372) (-1313.872) [-1319.022] -- 0:03:41
Average standard deviation of split frequencies: 0.010556
175500 -- [-1314.229] (-1322.303) (-1319.964) (-1314.723) * (-1319.208) (-1318.357) [-1317.615] (-1329.347) -- 0:03:40
176000 -- (-1323.672) [-1314.094] (-1317.955) (-1323.253) * (-1318.586) (-1313.925) [-1313.869] (-1322.795) -- 0:03:40
176500 -- [-1310.971] (-1315.268) (-1317.757) (-1322.974) * (-1319.400) (-1321.549) (-1321.479) [-1321.657] -- 0:03:43
177000 -- (-1317.225) (-1322.456) [-1316.033] (-1328.743) * [-1323.963] (-1328.873) (-1314.156) (-1313.099) -- 0:03:43
177500 -- [-1317.244] (-1324.998) (-1312.725) (-1330.869) * (-1322.593) (-1328.835) (-1326.861) [-1322.776] -- 0:03:42
178000 -- [-1320.156] (-1321.067) (-1312.834) (-1330.013) * (-1321.792) [-1321.509] (-1316.601) (-1330.207) -- 0:03:41
178500 -- (-1321.262) (-1314.440) [-1311.614] (-1313.726) * (-1318.998) (-1312.517) [-1312.972] (-1321.311) -- 0:03:40
179000 -- [-1319.989] (-1326.981) (-1313.789) (-1316.747) * (-1320.220) [-1319.619] (-1320.568) (-1314.908) -- 0:03:40
179500 -- (-1331.896) (-1323.402) (-1313.548) [-1314.907] * (-1320.330) (-1321.700) (-1326.224) [-1307.607] -- 0:03:39
180000 -- (-1320.696) (-1323.868) (-1314.759) [-1316.884] * [-1316.026] (-1331.056) (-1320.181) (-1314.530) -- 0:03:38
Average standard deviation of split frequencies: 0.009823
180500 -- [-1317.608] (-1317.702) (-1315.677) (-1316.505) * [-1314.026] (-1320.780) (-1328.018) (-1326.552) -- 0:03:42
181000 -- [-1317.583] (-1314.855) (-1322.624) (-1323.780) * (-1316.383) (-1328.462) (-1317.109) [-1315.907] -- 0:03:41
181500 -- (-1318.252) [-1323.590] (-1319.159) (-1321.890) * (-1318.171) (-1322.864) (-1314.226) [-1316.305] -- 0:03:40
182000 -- (-1327.840) (-1316.726) [-1319.122] (-1330.903) * (-1323.871) (-1312.445) [-1309.896] (-1315.196) -- 0:03:40
182500 -- (-1323.033) (-1319.158) [-1312.300] (-1324.661) * (-1318.579) (-1317.633) (-1319.691) [-1309.256] -- 0:03:39
183000 -- (-1332.017) (-1313.016) (-1319.507) [-1316.613] * (-1315.571) [-1315.522] (-1317.591) (-1318.782) -- 0:03:38
183500 -- (-1318.999) [-1312.079] (-1314.516) (-1329.245) * (-1328.315) [-1322.039] (-1322.957) (-1320.272) -- 0:03:38
184000 -- [-1320.179] (-1316.323) (-1319.864) (-1316.112) * (-1318.375) (-1332.281) [-1314.682] (-1316.902) -- 0:03:41
184500 -- [-1312.218] (-1319.640) (-1326.742) (-1314.696) * [-1314.508] (-1327.371) (-1338.966) (-1322.209) -- 0:03:41
185000 -- [-1312.899] (-1317.395) (-1322.775) (-1311.888) * [-1308.563] (-1324.095) (-1322.257) (-1316.296) -- 0:03:40
Average standard deviation of split frequencies: 0.010138
185500 -- (-1321.863) (-1318.486) [-1314.583] (-1318.520) * (-1327.502) [-1316.263] (-1324.954) (-1314.783) -- 0:03:39
186000 -- (-1316.018) (-1316.150) [-1317.368] (-1319.437) * (-1320.213) (-1322.535) [-1318.024] (-1321.699) -- 0:03:38
186500 -- (-1316.927) (-1316.343) [-1308.465] (-1327.633) * [-1319.455] (-1316.692) (-1322.056) (-1320.228) -- 0:03:38
187000 -- (-1320.697) (-1319.984) [-1324.298] (-1325.370) * (-1326.334) (-1316.626) [-1311.667] (-1317.244) -- 0:03:37
187500 -- [-1310.595] (-1321.992) (-1315.811) (-1328.398) * [-1314.755] (-1326.441) (-1315.906) (-1315.812) -- 0:03:36
188000 -- [-1314.494] (-1319.555) (-1317.694) (-1318.691) * (-1310.855) (-1322.351) [-1310.404] (-1323.825) -- 0:03:40
188500 -- (-1317.683) [-1323.853] (-1324.269) (-1317.628) * (-1315.809) (-1323.028) (-1312.883) [-1314.948] -- 0:03:39
189000 -- (-1330.240) (-1331.467) [-1316.754] (-1323.944) * (-1319.421) (-1322.592) [-1325.795] (-1326.171) -- 0:03:38
189500 -- (-1311.303) (-1321.469) [-1322.205] (-1321.062) * [-1311.272] (-1320.804) (-1325.474) (-1327.164) -- 0:03:38
190000 -- (-1310.297) (-1322.776) (-1319.598) [-1313.206] * [-1320.719] (-1321.476) (-1318.254) (-1321.691) -- 0:03:37
Average standard deviation of split frequencies: 0.010617
190500 -- (-1323.361) (-1311.796) [-1315.015] (-1318.722) * [-1313.006] (-1325.110) (-1317.968) (-1324.658) -- 0:03:36
191000 -- [-1312.792] (-1325.702) (-1316.507) (-1316.201) * (-1318.476) (-1325.137) [-1311.598] (-1333.321) -- 0:03:36
191500 -- [-1317.812] (-1332.816) (-1325.390) (-1315.770) * (-1314.002) (-1323.076) [-1319.061] (-1334.853) -- 0:03:39
192000 -- [-1306.922] (-1328.016) (-1325.535) (-1320.441) * (-1327.227) [-1317.333] (-1324.532) (-1326.590) -- 0:03:38
192500 -- [-1313.354] (-1317.621) (-1325.752) (-1321.377) * (-1323.001) [-1324.487] (-1320.861) (-1323.764) -- 0:03:38
193000 -- (-1314.671) [-1313.334] (-1320.738) (-1313.245) * [-1312.562] (-1317.923) (-1321.582) (-1314.267) -- 0:03:37
193500 -- (-1323.855) (-1322.153) [-1317.285] (-1320.751) * [-1324.076] (-1325.998) (-1326.429) (-1318.722) -- 0:03:36
194000 -- (-1332.042) (-1324.042) (-1327.342) [-1322.649] * (-1316.540) (-1315.862) [-1316.347] (-1316.452) -- 0:03:36
194500 -- [-1317.765] (-1316.592) (-1334.580) (-1313.629) * (-1320.536) [-1312.229] (-1322.322) (-1321.293) -- 0:03:35
195000 -- (-1325.847) [-1319.812] (-1323.486) (-1320.261) * [-1316.210] (-1313.610) (-1317.552) (-1322.646) -- 0:03:34
Average standard deviation of split frequencies: 0.011035
195500 -- (-1328.617) [-1321.897] (-1317.414) (-1321.694) * [-1319.396] (-1321.796) (-1315.725) (-1317.097) -- 0:03:38
196000 -- (-1326.308) (-1320.853) [-1321.655] (-1316.430) * (-1316.877) (-1320.053) [-1316.558] (-1320.627) -- 0:03:37
196500 -- (-1316.778) (-1329.854) (-1310.678) [-1320.406] * (-1314.594) [-1311.655] (-1318.181) (-1327.105) -- 0:03:36
197000 -- (-1308.461) (-1331.836) [-1321.280] (-1331.406) * (-1323.248) (-1313.956) [-1322.919] (-1318.081) -- 0:03:36
197500 -- [-1310.770] (-1332.513) (-1323.033) (-1323.506) * (-1318.442) (-1323.803) (-1329.659) [-1317.312] -- 0:03:35
198000 -- (-1326.000) (-1325.095) [-1318.924] (-1321.564) * (-1315.437) (-1315.781) (-1314.309) [-1311.289] -- 0:03:34
198500 -- (-1320.807) (-1318.902) (-1320.964) [-1315.593] * (-1316.862) (-1313.526) [-1313.950] (-1322.696) -- 0:03:38
199000 -- (-1327.544) (-1329.488) [-1319.346] (-1314.830) * (-1317.009) (-1317.401) [-1322.833] (-1317.705) -- 0:03:37
199500 -- (-1317.448) (-1320.501) (-1320.106) [-1310.811] * [-1317.978] (-1318.641) (-1317.132) (-1319.755) -- 0:03:36
200000 -- (-1317.058) (-1311.948) (-1321.252) [-1314.728] * (-1323.836) (-1320.359) (-1323.351) [-1321.199] -- 0:03:36
Average standard deviation of split frequencies: 0.010364
200500 -- (-1316.068) (-1321.000) [-1322.731] (-1314.201) * (-1317.181) [-1315.209] (-1331.586) (-1324.210) -- 0:03:35
201000 -- (-1317.838) (-1317.176) (-1314.186) [-1310.914] * (-1322.510) [-1313.837] (-1320.683) (-1316.850) -- 0:03:34
201500 -- (-1313.289) [-1317.427] (-1322.944) (-1312.895) * (-1314.921) (-1321.526) [-1332.584] (-1327.261) -- 0:03:37
202000 -- (-1329.624) (-1325.010) (-1320.327) [-1316.585] * [-1314.508] (-1322.622) (-1324.231) (-1326.184) -- 0:03:37
202500 -- (-1314.953) (-1312.148) (-1324.135) [-1325.211] * (-1324.343) (-1323.224) [-1329.714] (-1320.222) -- 0:03:36
203000 -- (-1313.522) (-1317.285) (-1324.126) [-1313.656] * (-1322.058) (-1319.379) (-1330.060) [-1316.741] -- 0:03:35
203500 -- (-1323.734) (-1327.379) [-1310.510] (-1319.462) * (-1322.022) (-1318.784) (-1317.649) [-1318.270] -- 0:03:35
204000 -- (-1320.565) (-1322.509) (-1314.960) [-1317.443] * (-1316.345) (-1326.315) [-1315.173] (-1313.955) -- 0:03:34
204500 -- [-1313.049] (-1325.222) (-1323.309) (-1316.945) * (-1331.939) (-1321.437) [-1313.517] (-1320.061) -- 0:03:33
205000 -- (-1324.424) (-1327.567) [-1318.890] (-1316.797) * [-1319.234] (-1317.039) (-1325.006) (-1314.890) -- 0:03:37
Average standard deviation of split frequencies: 0.011299
205500 -- (-1322.657) (-1321.981) (-1326.849) [-1317.689] * (-1319.696) (-1318.334) (-1322.283) [-1316.202] -- 0:03:36
206000 -- [-1318.691] (-1323.949) (-1319.443) (-1317.609) * (-1322.987) (-1324.452) (-1336.998) [-1313.779] -- 0:03:35
206500 -- [-1314.629] (-1319.015) (-1320.636) (-1316.103) * (-1317.898) (-1314.809) [-1314.094] (-1324.482) -- 0:03:35
207000 -- (-1322.279) [-1317.845] (-1316.902) (-1320.076) * (-1330.235) (-1324.968) [-1323.212] (-1327.296) -- 0:03:34
207500 -- (-1320.255) (-1316.636) (-1322.742) [-1314.223] * (-1317.464) (-1324.145) (-1317.727) [-1316.684] -- 0:03:33
208000 -- (-1318.003) [-1309.806] (-1318.557) (-1322.571) * (-1326.117) (-1321.955) (-1325.799) [-1324.206] -- 0:03:33
208500 -- (-1315.069) (-1315.472) [-1313.626] (-1317.129) * (-1320.934) (-1322.125) (-1326.559) [-1315.832] -- 0:03:32
209000 -- [-1317.024] (-1325.551) (-1321.549) (-1322.292) * (-1318.544) (-1324.301) [-1318.279] (-1313.693) -- 0:03:35
209500 -- [-1327.314] (-1323.325) (-1327.024) (-1314.175) * (-1315.581) [-1319.153] (-1318.059) (-1314.241) -- 0:03:35
210000 -- (-1322.221) [-1316.162] (-1314.396) (-1317.788) * (-1319.660) (-1324.379) (-1317.659) [-1313.289] -- 0:03:34
Average standard deviation of split frequencies: 0.012110
210500 -- (-1317.981) (-1321.249) (-1315.019) [-1322.715] * (-1318.259) (-1321.598) (-1322.359) [-1315.812] -- 0:03:33
211000 -- (-1317.404) [-1313.087] (-1323.953) (-1323.113) * [-1318.959] (-1318.545) (-1329.143) (-1322.593) -- 0:03:33
211500 -- (-1316.322) [-1316.349] (-1312.328) (-1312.214) * (-1319.194) [-1332.947] (-1322.230) (-1313.671) -- 0:03:32
212000 -- (-1315.971) [-1321.987] (-1315.306) (-1312.809) * (-1313.960) (-1316.196) [-1316.196] (-1319.371) -- 0:03:31
212500 -- (-1326.824) (-1321.733) [-1313.622] (-1326.971) * [-1312.758] (-1323.508) (-1316.471) (-1326.356) -- 0:03:34
213000 -- [-1312.963] (-1312.939) (-1316.696) (-1320.057) * [-1318.765] (-1322.956) (-1320.508) (-1317.327) -- 0:03:34
213500 -- (-1318.562) (-1316.693) (-1321.016) [-1328.605] * [-1313.463] (-1325.494) (-1316.552) (-1332.093) -- 0:03:33
214000 -- (-1315.476) (-1322.044) [-1311.166] (-1314.262) * (-1313.395) (-1327.673) (-1321.033) [-1315.997] -- 0:03:33
214500 -- (-1324.193) (-1323.954) (-1318.579) [-1314.757] * (-1316.564) (-1326.100) [-1314.603] (-1317.639) -- 0:03:32
215000 -- [-1320.738] (-1317.588) (-1320.924) (-1318.859) * (-1318.338) (-1313.404) (-1311.926) [-1318.119] -- 0:03:31
Average standard deviation of split frequencies: 0.011554
215500 -- [-1317.338] (-1327.575) (-1321.379) (-1333.309) * [-1316.636] (-1326.209) (-1310.205) (-1319.608) -- 0:03:31
216000 -- (-1319.088) (-1310.474) (-1327.785) [-1320.774] * (-1318.261) (-1317.910) (-1313.310) [-1325.424] -- 0:03:30
216500 -- (-1323.505) [-1310.814] (-1320.809) (-1318.511) * [-1316.859] (-1316.005) (-1312.413) (-1321.941) -- 0:03:33
217000 -- (-1324.784) [-1314.411] (-1326.452) (-1324.961) * (-1323.090) (-1319.036) (-1321.560) [-1319.276] -- 0:03:32
217500 -- (-1322.360) [-1311.718] (-1332.823) (-1321.205) * (-1319.106) (-1315.300) (-1318.252) [-1321.009] -- 0:03:32
218000 -- [-1313.246] (-1311.911) (-1321.272) (-1324.951) * (-1316.976) (-1318.609) [-1314.106] (-1322.835) -- 0:03:31
218500 -- (-1312.147) (-1312.690) (-1332.330) [-1314.588] * (-1330.894) (-1317.386) [-1318.640] (-1323.673) -- 0:03:31
219000 -- [-1316.124] (-1320.419) (-1321.973) (-1324.515) * (-1326.698) (-1326.799) [-1311.712] (-1323.092) -- 0:03:30
219500 -- (-1326.148) (-1325.160) (-1327.419) [-1320.598] * (-1319.874) (-1323.517) [-1313.277] (-1319.316) -- 0:03:29
220000 -- [-1318.808] (-1320.588) (-1329.687) (-1319.427) * (-1319.596) (-1338.558) [-1327.173] (-1325.124) -- 0:03:32
Average standard deviation of split frequencies: 0.010556
220500 -- (-1315.615) [-1310.839] (-1322.975) (-1320.758) * (-1317.166) (-1330.538) [-1324.439] (-1320.139) -- 0:03:32
221000 -- (-1326.947) (-1312.514) [-1327.637] (-1319.705) * [-1313.580] (-1322.123) (-1319.998) (-1309.717) -- 0:03:31
221500 -- (-1333.015) (-1319.289) [-1328.349] (-1328.771) * (-1317.181) (-1319.078) [-1325.126] (-1313.457) -- 0:03:30
222000 -- [-1317.155] (-1310.739) (-1319.829) (-1326.274) * (-1312.344) [-1315.679] (-1326.826) (-1328.511) -- 0:03:30
222500 -- (-1324.555) [-1316.388] (-1334.750) (-1329.893) * (-1318.977) (-1321.427) (-1323.853) [-1312.026] -- 0:03:29
223000 -- [-1313.778] (-1311.787) (-1321.635) (-1325.371) * [-1329.111] (-1315.497) (-1319.660) (-1314.578) -- 0:03:29
223500 -- [-1310.723] (-1320.212) (-1318.251) (-1325.523) * [-1313.821] (-1324.741) (-1322.809) (-1319.750) -- 0:03:31
224000 -- (-1319.124) (-1323.992) [-1322.363] (-1324.347) * (-1322.532) (-1319.740) (-1329.184) [-1316.801] -- 0:03:31
224500 -- [-1314.397] (-1324.627) (-1329.956) (-1315.588) * (-1322.953) (-1317.783) (-1326.146) [-1311.463] -- 0:03:30
225000 -- [-1311.076] (-1321.399) (-1311.244) (-1312.749) * [-1319.985] (-1322.609) (-1327.114) (-1318.185) -- 0:03:30
Average standard deviation of split frequencies: 0.011534
225500 -- [-1310.737] (-1329.101) (-1314.355) (-1311.197) * [-1319.160] (-1316.732) (-1316.604) (-1325.945) -- 0:03:29
226000 -- [-1322.440] (-1327.790) (-1318.606) (-1321.615) * (-1316.850) (-1318.471) (-1313.876) [-1317.961] -- 0:03:28
226500 -- [-1311.593] (-1321.049) (-1325.993) (-1317.170) * (-1325.557) (-1327.852) [-1307.829] (-1315.469) -- 0:03:28
227000 -- [-1324.027] (-1321.407) (-1315.174) (-1313.121) * (-1315.661) (-1312.286) [-1314.532] (-1316.741) -- 0:03:27
227500 -- (-1323.990) (-1315.876) (-1312.105) [-1321.463] * (-1312.804) [-1323.673] (-1310.151) (-1318.292) -- 0:03:30
228000 -- [-1323.522] (-1321.079) (-1321.414) (-1323.037) * (-1310.076) (-1318.594) [-1310.652] (-1323.535) -- 0:03:29
228500 -- (-1319.391) (-1312.947) (-1319.820) [-1318.885] * [-1317.068] (-1320.650) (-1312.686) (-1321.622) -- 0:03:29
229000 -- (-1317.159) (-1323.258) (-1331.993) [-1316.914] * (-1317.698) [-1310.314] (-1309.085) (-1327.214) -- 0:03:28
229500 -- [-1313.546] (-1335.453) (-1319.699) (-1319.184) * [-1321.312] (-1318.136) (-1320.536) (-1316.644) -- 0:03:28
230000 -- (-1328.575) (-1315.898) [-1314.666] (-1322.209) * (-1319.710) [-1310.193] (-1315.150) (-1329.831) -- 0:03:27
Average standard deviation of split frequencies: 0.009737
230500 -- (-1318.559) (-1318.891) [-1325.176] (-1325.524) * [-1317.288] (-1319.115) (-1320.735) (-1338.243) -- 0:03:26
231000 -- (-1314.009) (-1336.725) [-1319.601] (-1314.011) * (-1313.250) [-1313.650] (-1317.069) (-1320.966) -- 0:03:29
231500 -- (-1321.438) (-1320.592) (-1318.643) [-1316.679] * (-1314.037) [-1317.181] (-1317.373) (-1325.836) -- 0:03:29
232000 -- (-1322.909) (-1321.892) (-1315.391) [-1315.291] * (-1316.043) (-1318.208) (-1318.627) [-1317.570] -- 0:03:28
232500 -- (-1318.055) [-1315.771] (-1319.055) (-1316.483) * (-1318.008) (-1321.889) [-1311.913] (-1316.588) -- 0:03:27
233000 -- (-1319.811) (-1320.971) [-1309.739] (-1317.626) * (-1322.491) (-1313.070) [-1321.531] (-1322.435) -- 0:03:27
233500 -- (-1318.054) (-1319.693) [-1314.303] (-1331.381) * (-1317.412) (-1317.640) [-1313.681] (-1320.719) -- 0:03:26
234000 -- (-1322.892) (-1326.498) [-1314.784] (-1315.808) * (-1318.413) [-1318.535] (-1312.475) (-1314.742) -- 0:03:26
234500 -- (-1322.380) (-1326.448) [-1317.079] (-1315.503) * (-1316.452) [-1316.551] (-1325.920) (-1321.157) -- 0:03:28
235000 -- (-1320.207) [-1320.427] (-1326.353) (-1325.499) * [-1318.167] (-1317.994) (-1317.384) (-1314.366) -- 0:03:28
Average standard deviation of split frequencies: 0.010575
235500 -- (-1317.951) (-1328.174) (-1315.597) [-1324.874] * (-1314.765) (-1318.479) [-1317.176] (-1321.395) -- 0:03:27
236000 -- (-1318.293) (-1333.996) [-1320.322] (-1328.603) * (-1326.379) (-1324.542) [-1315.140] (-1319.156) -- 0:03:27
236500 -- [-1311.314] (-1322.299) (-1319.336) (-1315.569) * (-1314.582) (-1322.390) (-1323.971) [-1320.187] -- 0:03:26
237000 -- (-1313.842) (-1317.000) (-1322.107) [-1319.068] * (-1316.351) [-1314.116] (-1330.609) (-1318.666) -- 0:03:26
237500 -- (-1315.832) (-1314.079) [-1316.141] (-1324.032) * [-1313.478] (-1318.363) (-1332.209) (-1324.723) -- 0:03:25
238000 -- [-1313.041] (-1322.105) (-1324.866) (-1328.234) * (-1323.172) [-1319.752] (-1316.739) (-1320.265) -- 0:03:24
238500 -- (-1308.620) (-1324.761) [-1314.873] (-1325.273) * (-1323.497) [-1317.137] (-1318.502) (-1321.527) -- 0:03:27
239000 -- (-1319.104) (-1318.034) (-1312.943) [-1313.786] * [-1318.402] (-1316.751) (-1313.064) (-1331.991) -- 0:03:26
239500 -- (-1328.303) (-1320.619) (-1314.918) [-1307.940] * (-1329.394) (-1319.610) (-1319.317) [-1318.585] -- 0:03:26
240000 -- (-1310.273) [-1318.358] (-1321.321) (-1320.791) * [-1318.318] (-1321.203) (-1329.188) (-1315.321) -- 0:03:25
Average standard deviation of split frequencies: 0.011407
240500 -- (-1326.404) (-1319.811) [-1315.854] (-1324.716) * [-1312.107] (-1318.053) (-1317.671) (-1318.285) -- 0:03:25
241000 -- (-1314.262) (-1322.728) (-1326.906) [-1320.202] * (-1319.216) [-1316.631] (-1324.519) (-1315.494) -- 0:03:24
241500 -- (-1312.935) [-1322.366] (-1326.782) (-1314.750) * (-1316.990) (-1323.074) (-1340.298) [-1312.305] -- 0:03:24
242000 -- (-1324.658) (-1328.915) [-1325.855] (-1332.102) * [-1319.205] (-1326.402) (-1325.378) (-1320.506) -- 0:03:26
242500 -- [-1321.875] (-1325.215) (-1316.780) (-1329.847) * (-1328.970) (-1320.385) [-1322.570] (-1320.667) -- 0:03:26
243000 -- (-1320.394) (-1319.322) [-1310.742] (-1332.504) * (-1333.361) [-1316.561] (-1323.909) (-1317.638) -- 0:03:25
243500 -- [-1315.163] (-1322.222) (-1320.191) (-1324.962) * [-1314.544] (-1331.496) (-1330.800) (-1325.636) -- 0:03:25
244000 -- [-1316.083] (-1324.667) (-1324.369) (-1318.250) * (-1312.852) (-1320.527) [-1323.088] (-1322.422) -- 0:03:24
244500 -- [-1316.603] (-1318.044) (-1320.868) (-1322.643) * (-1311.131) [-1321.056] (-1321.558) (-1332.490) -- 0:03:23
245000 -- [-1318.744] (-1320.843) (-1316.341) (-1313.699) * (-1310.856) (-1326.292) (-1329.420) [-1311.989] -- 0:03:23
Average standard deviation of split frequencies: 0.011272
245500 -- (-1321.211) [-1326.207] (-1331.588) (-1321.974) * (-1321.545) [-1316.384] (-1314.323) (-1325.214) -- 0:03:22
246000 -- (-1318.529) (-1324.376) (-1326.955) [-1317.125] * (-1335.386) [-1319.584] (-1316.886) (-1315.144) -- 0:03:25
246500 -- (-1315.918) (-1327.484) [-1314.481] (-1319.559) * (-1317.130) [-1325.256] (-1323.540) (-1316.394) -- 0:03:24
247000 -- [-1331.062] (-1325.542) (-1322.293) (-1319.618) * (-1316.305) [-1314.054] (-1319.323) (-1319.816) -- 0:03:24
247500 -- (-1314.625) [-1316.164] (-1321.762) (-1317.707) * (-1317.766) [-1322.703] (-1322.601) (-1314.663) -- 0:03:23
248000 -- (-1316.007) (-1319.319) (-1325.627) [-1314.888] * (-1314.315) (-1321.895) (-1322.934) [-1309.691] -- 0:03:23
248500 -- (-1323.157) (-1326.509) [-1319.975] (-1318.815) * [-1321.653] (-1309.103) (-1312.900) (-1321.257) -- 0:03:22
249000 -- (-1333.665) (-1319.100) [-1313.673] (-1315.621) * [-1318.384] (-1319.421) (-1317.099) (-1319.141) -- 0:03:22
249500 -- (-1323.273) (-1320.481) (-1321.287) [-1316.101] * (-1316.974) (-1320.542) [-1320.005] (-1319.607) -- 0:03:24
250000 -- (-1313.081) (-1315.350) (-1326.462) [-1310.225] * (-1316.667) (-1320.265) [-1316.591] (-1319.767) -- 0:03:24
Average standard deviation of split frequencies: 0.011284
250500 -- (-1317.783) [-1313.548] (-1323.273) (-1318.172) * [-1313.974] (-1330.943) (-1333.377) (-1319.566) -- 0:03:23
251000 -- (-1330.609) (-1320.544) (-1329.011) [-1318.477] * (-1324.972) (-1311.774) [-1318.025] (-1331.898) -- 0:03:22
251500 -- (-1313.992) [-1314.480] (-1322.025) (-1325.310) * [-1315.451] (-1319.939) (-1331.020) (-1337.931) -- 0:03:22
252000 -- (-1326.873) (-1316.826) [-1325.553] (-1321.716) * (-1335.515) (-1321.985) (-1330.737) [-1313.976] -- 0:03:21
252500 -- [-1308.462] (-1329.624) (-1316.220) (-1321.971) * (-1327.644) (-1316.647) [-1310.644] (-1317.634) -- 0:03:21
253000 -- (-1315.682) (-1317.594) [-1316.573] (-1316.177) * (-1326.492) (-1327.530) [-1310.349] (-1318.754) -- 0:03:20
253500 -- (-1319.344) [-1325.629] (-1318.152) (-1318.698) * (-1324.413) (-1311.523) (-1315.567) [-1317.336] -- 0:03:23
254000 -- (-1317.411) (-1319.378) (-1314.283) [-1319.772] * (-1336.522) (-1315.756) [-1310.048] (-1311.157) -- 0:03:22
254500 -- (-1315.438) (-1321.566) [-1318.668] (-1323.304) * (-1320.723) [-1313.549] (-1317.339) (-1321.707) -- 0:03:22
255000 -- (-1315.140) (-1317.560) [-1324.836] (-1324.648) * (-1318.621) (-1323.554) [-1318.512] (-1327.495) -- 0:03:21
Average standard deviation of split frequencies: 0.011049
255500 -- (-1319.009) [-1316.119] (-1321.678) (-1322.159) * (-1324.079) (-1321.173) (-1317.173) [-1315.491] -- 0:03:21
256000 -- (-1308.785) (-1320.347) (-1322.151) [-1321.399] * (-1326.202) (-1317.091) [-1314.217] (-1320.165) -- 0:03:20
256500 -- (-1312.915) (-1331.593) [-1315.429] (-1332.741) * (-1331.075) (-1317.337) (-1314.635) [-1324.603] -- 0:03:20
257000 -- (-1320.805) (-1329.634) (-1315.582) [-1313.682] * [-1317.856] (-1324.226) (-1324.845) (-1333.552) -- 0:03:22
257500 -- (-1317.239) (-1329.949) (-1322.348) [-1313.858] * (-1325.540) (-1323.665) (-1319.774) [-1317.621] -- 0:03:21
258000 -- [-1316.084] (-1315.765) (-1318.161) (-1321.879) * (-1327.917) [-1317.424] (-1317.387) (-1318.814) -- 0:03:21
258500 -- (-1318.472) (-1316.133) (-1317.288) [-1310.572] * (-1329.526) [-1318.758] (-1318.073) (-1328.422) -- 0:03:20
259000 -- (-1324.743) (-1322.329) (-1324.450) [-1323.384] * (-1338.437) (-1323.560) (-1323.553) [-1319.727] -- 0:03:20
259500 -- (-1324.614) [-1320.295] (-1316.821) (-1316.849) * (-1325.396) (-1324.200) (-1313.043) [-1317.502] -- 0:03:19
260000 -- (-1322.067) (-1322.096) (-1316.258) [-1314.392] * (-1330.726) (-1323.890) [-1321.894] (-1313.528) -- 0:03:19
Average standard deviation of split frequencies: 0.011755
260500 -- (-1324.739) (-1325.165) [-1311.219] (-1320.212) * (-1319.940) (-1323.989) [-1323.616] (-1320.303) -- 0:03:21
261000 -- (-1328.234) (-1316.324) [-1311.245] (-1318.717) * [-1321.090] (-1310.552) (-1327.075) (-1324.759) -- 0:03:21
261500 -- (-1319.509) [-1316.106] (-1319.908) (-1318.661) * [-1317.487] (-1318.670) (-1327.413) (-1324.064) -- 0:03:20
262000 -- (-1326.069) [-1319.514] (-1311.660) (-1326.405) * [-1310.195] (-1322.561) (-1325.428) (-1320.237) -- 0:03:19
262500 -- (-1319.221) [-1323.674] (-1316.845) (-1322.651) * [-1313.457] (-1313.126) (-1318.733) (-1330.855) -- 0:03:19
263000 -- (-1323.274) [-1315.123] (-1325.592) (-1315.132) * (-1323.719) (-1316.378) (-1320.623) [-1314.091] -- 0:03:18
263500 -- (-1316.663) [-1316.385] (-1323.013) (-1318.979) * (-1326.639) (-1324.101) [-1312.016] (-1325.824) -- 0:03:18
264000 -- [-1319.863] (-1320.279) (-1317.242) (-1320.924) * (-1323.017) [-1317.518] (-1312.339) (-1325.555) -- 0:03:17
264500 -- (-1314.243) (-1322.546) [-1317.291] (-1319.579) * (-1329.765) (-1317.321) (-1313.686) [-1314.317] -- 0:03:20
265000 -- (-1317.339) (-1313.695) (-1326.127) [-1311.266] * (-1321.515) (-1317.641) (-1328.165) [-1324.336] -- 0:03:19
Average standard deviation of split frequencies: 0.011409
265500 -- (-1315.240) [-1323.659] (-1320.469) (-1313.086) * (-1324.216) (-1330.356) (-1324.170) [-1317.160] -- 0:03:19
266000 -- [-1314.597] (-1317.682) (-1322.657) (-1321.449) * (-1327.244) [-1323.955] (-1319.037) (-1314.549) -- 0:03:18
266500 -- (-1312.714) (-1313.687) (-1319.466) [-1317.273] * [-1324.294] (-1320.279) (-1329.620) (-1318.185) -- 0:03:18
267000 -- (-1321.977) [-1310.854] (-1322.693) (-1324.630) * (-1316.540) [-1324.381] (-1317.441) (-1326.710) -- 0:03:17
267500 -- [-1316.093] (-1320.257) (-1330.580) (-1324.457) * (-1333.868) (-1322.851) (-1316.547) [-1322.062] -- 0:03:17
268000 -- [-1310.128] (-1313.406) (-1321.441) (-1324.919) * (-1321.682) [-1316.195] (-1317.302) (-1317.976) -- 0:03:19
268500 -- (-1312.132) [-1321.796] (-1326.263) (-1325.762) * [-1315.729] (-1315.703) (-1321.465) (-1324.225) -- 0:03:18
269000 -- (-1320.783) (-1319.551) (-1318.597) [-1317.051] * (-1329.871) (-1319.751) (-1327.789) [-1315.491] -- 0:03:18
269500 -- (-1325.625) (-1321.818) [-1325.531] (-1322.663) * (-1315.370) [-1322.685] (-1330.119) (-1314.931) -- 0:03:17
270000 -- (-1315.220) (-1322.703) [-1319.079] (-1319.235) * (-1314.177) (-1333.879) [-1313.483] (-1322.059) -- 0:03:17
Average standard deviation of split frequencies: 0.011430
270500 -- (-1319.852) (-1317.029) [-1310.158] (-1322.969) * (-1316.241) (-1322.648) [-1314.335] (-1322.127) -- 0:03:16
271000 -- (-1314.997) (-1323.089) (-1318.161) [-1314.963] * (-1328.770) (-1323.165) (-1317.058) [-1314.012] -- 0:03:19
271500 -- (-1322.766) (-1323.958) [-1319.448] (-1326.616) * (-1321.982) (-1320.495) (-1315.579) [-1311.288] -- 0:03:18
272000 -- [-1320.739] (-1325.188) (-1323.004) (-1322.412) * (-1325.921) [-1315.470] (-1326.974) (-1325.347) -- 0:03:18
272500 -- (-1319.812) (-1322.554) [-1315.544] (-1328.156) * (-1327.102) (-1316.908) [-1313.800] (-1331.303) -- 0:03:17
273000 -- (-1330.545) (-1320.188) (-1312.158) [-1316.326] * [-1307.618] (-1315.272) (-1315.000) (-1319.959) -- 0:03:17
273500 -- [-1317.654] (-1321.532) (-1313.285) (-1317.603) * (-1318.051) (-1330.551) (-1311.984) [-1317.218] -- 0:03:16
274000 -- (-1318.945) (-1322.450) (-1318.150) [-1313.309] * (-1314.777) [-1315.309] (-1322.335) (-1321.856) -- 0:03:16
274500 -- (-1325.338) (-1325.126) [-1319.847] (-1319.843) * [-1315.718] (-1319.487) (-1326.449) (-1322.125) -- 0:03:18
275000 -- (-1332.309) (-1321.619) (-1320.190) [-1312.015] * (-1313.993) (-1322.324) (-1318.551) [-1323.256] -- 0:03:17
Average standard deviation of split frequencies: 0.010782
275500 -- [-1313.131] (-1319.986) (-1323.535) (-1318.308) * (-1322.915) [-1315.089] (-1314.185) (-1315.844) -- 0:03:17
276000 -- (-1322.246) [-1320.076] (-1327.625) (-1319.275) * [-1313.226] (-1322.756) (-1315.293) (-1313.857) -- 0:03:16
276500 -- (-1324.462) [-1315.426] (-1321.560) (-1321.833) * (-1314.437) (-1326.709) (-1321.439) [-1310.932] -- 0:03:16
277000 -- (-1318.094) (-1317.076) (-1329.348) [-1320.597] * (-1311.993) (-1341.036) [-1314.588] (-1318.635) -- 0:03:15
277500 -- (-1319.099) [-1320.801] (-1323.011) (-1312.443) * [-1315.227] (-1319.383) (-1314.875) (-1314.634) -- 0:03:15
278000 -- (-1318.276) (-1327.786) [-1315.297] (-1318.086) * (-1322.698) (-1330.517) (-1314.561) [-1312.654] -- 0:03:17
278500 -- [-1317.749] (-1315.730) (-1328.547) (-1317.898) * (-1323.340) [-1321.104] (-1321.305) (-1320.126) -- 0:03:16
279000 -- (-1320.301) (-1317.968) [-1316.476] (-1312.901) * (-1323.704) (-1329.583) [-1319.152] (-1325.028) -- 0:03:16
279500 -- (-1320.212) [-1318.324] (-1318.275) (-1323.942) * (-1322.930) (-1323.005) (-1316.319) [-1314.543] -- 0:03:15
280000 -- (-1318.496) (-1319.248) (-1317.767) [-1321.572] * (-1330.833) (-1313.030) [-1318.497] (-1317.464) -- 0:03:15
Average standard deviation of split frequencies: 0.009343
280500 -- (-1319.497) (-1315.111) (-1322.696) [-1313.461] * (-1314.485) [-1321.048] (-1320.868) (-1318.013) -- 0:03:14
281000 -- [-1310.877] (-1317.900) (-1335.096) (-1326.844) * (-1315.575) [-1321.782] (-1316.631) (-1329.188) -- 0:03:14
281500 -- (-1316.951) (-1314.188) [-1315.628] (-1336.387) * [-1314.964] (-1318.806) (-1322.189) (-1325.037) -- 0:03:16
282000 -- (-1314.475) (-1320.124) (-1318.313) [-1320.183] * [-1313.587] (-1318.304) (-1326.057) (-1319.374) -- 0:03:16
282500 -- [-1316.732] (-1318.000) (-1321.129) (-1325.283) * (-1321.010) (-1325.038) [-1326.776] (-1313.103) -- 0:03:15
283000 -- (-1321.630) [-1318.597] (-1318.191) (-1319.186) * (-1317.573) (-1317.908) [-1316.550] (-1319.432) -- 0:03:15
283500 -- [-1310.174] (-1316.292) (-1321.399) (-1315.863) * (-1317.739) (-1321.449) [-1315.941] (-1315.814) -- 0:03:14
284000 -- (-1312.836) (-1331.458) (-1316.924) [-1316.143] * (-1327.774) (-1323.808) (-1328.030) [-1319.052] -- 0:03:14
284500 -- (-1314.231) (-1325.664) (-1312.657) [-1319.963] * (-1325.959) (-1319.050) (-1325.124) [-1320.765] -- 0:03:13
285000 -- [-1312.377] (-1324.562) (-1326.100) (-1316.366) * [-1314.852] (-1316.705) (-1332.767) (-1322.778) -- 0:03:15
Average standard deviation of split frequencies: 0.009272
285500 -- (-1316.217) [-1315.883] (-1331.454) (-1315.768) * (-1315.050) [-1315.084] (-1324.409) (-1324.006) -- 0:03:15
286000 -- [-1322.252] (-1332.484) (-1321.633) (-1328.189) * [-1321.612] (-1315.234) (-1322.418) (-1324.435) -- 0:03:14
286500 -- (-1316.624) (-1319.168) (-1324.919) [-1319.539] * (-1318.578) (-1318.909) [-1323.065] (-1330.460) -- 0:03:14
287000 -- (-1315.996) (-1317.773) (-1330.525) [-1318.051] * (-1337.658) [-1310.186] (-1314.655) (-1325.952) -- 0:03:13
287500 -- (-1314.656) (-1327.973) [-1316.542] (-1314.465) * (-1317.794) (-1319.798) [-1317.488] (-1327.406) -- 0:03:13
288000 -- (-1318.421) (-1321.339) (-1322.955) [-1316.100] * [-1313.260] (-1318.468) (-1328.804) (-1319.078) -- 0:03:12
288500 -- (-1327.087) (-1317.953) [-1325.208] (-1318.097) * (-1316.720) (-1330.817) (-1329.962) [-1322.039] -- 0:03:14
289000 -- (-1321.474) (-1316.051) (-1323.691) [-1313.212] * (-1330.037) [-1316.093] (-1320.083) (-1317.335) -- 0:03:14
289500 -- [-1318.861] (-1324.291) (-1318.075) (-1322.667) * (-1315.135) (-1321.078) [-1320.545] (-1322.247) -- 0:03:13
290000 -- (-1318.076) (-1330.132) (-1321.091) [-1314.605] * (-1319.993) (-1324.077) (-1319.735) [-1323.597] -- 0:03:13
Average standard deviation of split frequencies: 0.009427
290500 -- [-1321.607] (-1319.019) (-1321.560) (-1323.268) * (-1315.537) (-1327.917) [-1322.275] (-1317.360) -- 0:03:12
291000 -- [-1314.940] (-1323.591) (-1316.809) (-1322.146) * (-1317.296) [-1327.844] (-1317.429) (-1322.479) -- 0:03:12
291500 -- (-1317.539) [-1320.510] (-1324.160) (-1321.409) * (-1313.983) [-1313.228] (-1322.953) (-1320.063) -- 0:03:14
292000 -- [-1311.244] (-1321.292) (-1318.524) (-1317.759) * [-1321.556] (-1323.483) (-1329.425) (-1324.952) -- 0:03:13
292500 -- (-1319.909) (-1323.367) [-1318.463] (-1318.534) * [-1316.810] (-1314.685) (-1322.273) (-1337.318) -- 0:03:13
293000 -- (-1319.398) (-1317.156) [-1323.823] (-1324.608) * (-1316.969) [-1316.412] (-1332.594) (-1330.073) -- 0:03:13
293500 -- (-1324.745) [-1313.087] (-1323.632) (-1319.829) * [-1314.705] (-1315.838) (-1332.287) (-1319.269) -- 0:03:12
294000 -- (-1325.360) (-1330.294) [-1319.660] (-1317.994) * (-1329.799) (-1313.736) (-1324.987) [-1320.573] -- 0:03:12
294500 -- [-1321.232] (-1325.000) (-1315.043) (-1320.628) * [-1317.877] (-1319.493) (-1328.388) (-1326.227) -- 0:03:11
295000 -- (-1323.970) [-1317.474] (-1319.925) (-1329.987) * (-1313.788) (-1318.810) (-1332.952) [-1317.975] -- 0:03:13
Average standard deviation of split frequencies: 0.010492
295500 -- (-1323.073) (-1332.531) [-1317.117] (-1324.975) * (-1319.880) (-1313.614) (-1328.696) [-1317.129] -- 0:03:13
296000 -- (-1315.825) (-1314.553) [-1314.794] (-1317.488) * (-1325.392) [-1320.044] (-1331.403) (-1311.433) -- 0:03:12
296500 -- (-1319.915) [-1322.800] (-1317.441) (-1325.990) * (-1315.640) (-1327.003) (-1323.736) [-1310.642] -- 0:03:12
297000 -- (-1324.384) (-1321.294) (-1323.840) [-1316.082] * (-1315.114) [-1318.217] (-1328.434) (-1322.398) -- 0:03:11
297500 -- (-1321.369) (-1321.010) (-1314.759) [-1313.196] * (-1321.336) [-1313.366] (-1321.338) (-1319.501) -- 0:03:11
298000 -- [-1318.327] (-1315.860) (-1317.909) (-1331.343) * (-1326.508) [-1318.301] (-1324.446) (-1319.614) -- 0:03:10
298500 -- (-1327.083) (-1318.758) [-1319.210] (-1319.751) * [-1317.146] (-1318.538) (-1319.291) (-1322.896) -- 0:03:10
299000 -- (-1319.207) (-1316.963) (-1317.821) [-1314.101] * (-1316.962) (-1311.508) [-1321.543] (-1325.870) -- 0:03:12
299500 -- (-1324.556) (-1316.381) (-1317.460) [-1311.690] * [-1319.384] (-1316.620) (-1320.935) (-1313.646) -- 0:03:11
300000 -- (-1326.305) [-1315.755] (-1319.400) (-1325.246) * (-1318.690) [-1321.980] (-1318.999) (-1322.889) -- 0:03:11
Average standard deviation of split frequencies: 0.012174
300500 -- (-1325.018) (-1323.814) [-1317.022] (-1323.300) * (-1311.464) [-1323.879] (-1318.009) (-1325.995) -- 0:03:10
301000 -- (-1317.341) (-1316.577) (-1318.736) [-1319.374] * [-1323.317] (-1317.182) (-1325.042) (-1328.598) -- 0:03:10
301500 -- (-1317.292) [-1311.936] (-1319.755) (-1317.611) * (-1316.170) (-1321.477) [-1318.439] (-1322.479) -- 0:03:09
302000 -- (-1315.628) (-1316.826) [-1312.915] (-1316.635) * (-1317.237) (-1323.308) [-1317.552] (-1323.906) -- 0:03:09
302500 -- (-1325.518) [-1321.034] (-1331.629) (-1320.603) * (-1313.906) (-1322.322) (-1318.395) [-1321.728] -- 0:03:11
303000 -- (-1318.794) (-1333.686) (-1313.253) [-1312.273] * (-1313.776) (-1326.273) [-1316.455] (-1317.635) -- 0:03:10
303500 -- (-1315.511) [-1319.368] (-1324.088) (-1326.174) * (-1317.485) (-1329.036) (-1319.783) [-1325.522] -- 0:03:10
304000 -- (-1324.135) (-1322.012) [-1323.844] (-1319.932) * (-1322.618) [-1319.029] (-1326.807) (-1324.262) -- 0:03:10
304500 -- (-1312.402) [-1321.177] (-1321.407) (-1317.793) * (-1314.480) (-1328.977) (-1327.244) [-1319.514] -- 0:03:09
305000 -- (-1319.297) (-1322.379) (-1323.644) [-1312.343] * (-1324.582) [-1321.864] (-1317.572) (-1325.629) -- 0:03:09
Average standard deviation of split frequencies: 0.012052
305500 -- (-1315.649) [-1323.654] (-1331.989) (-1320.216) * (-1315.867) (-1326.191) [-1314.099] (-1333.344) -- 0:03:08
306000 -- (-1317.570) [-1320.314] (-1325.028) (-1318.090) * (-1318.055) (-1323.449) [-1311.290] (-1320.994) -- 0:03:10
306500 -- [-1314.350] (-1323.300) (-1320.714) (-1318.397) * (-1327.021) (-1321.260) [-1312.208] (-1324.482) -- 0:03:10
307000 -- (-1317.375) (-1316.178) (-1318.849) [-1324.138] * [-1318.504] (-1320.960) (-1317.678) (-1318.116) -- 0:03:09
307500 -- [-1312.888] (-1315.489) (-1315.712) (-1327.853) * [-1316.607] (-1319.994) (-1319.679) (-1314.754) -- 0:03:09
308000 -- [-1321.087] (-1318.255) (-1312.320) (-1329.152) * (-1317.459) [-1318.721] (-1324.933) (-1319.340) -- 0:03:08
308500 -- (-1321.234) (-1322.492) [-1311.558] (-1327.177) * (-1318.330) (-1320.808) [-1321.450] (-1315.697) -- 0:03:08
309000 -- [-1318.838] (-1316.273) (-1317.415) (-1317.861) * (-1320.578) (-1327.987) [-1313.684] (-1316.220) -- 0:03:10
309500 -- (-1332.818) (-1319.801) [-1318.757] (-1321.799) * (-1330.766) [-1318.807] (-1319.351) (-1313.262) -- 0:03:09
310000 -- (-1321.621) (-1315.768) (-1314.955) [-1313.682] * (-1327.195) (-1314.272) (-1318.512) [-1315.987] -- 0:03:09
Average standard deviation of split frequencies: 0.011693
310500 -- (-1332.139) [-1314.469] (-1315.353) (-1317.116) * (-1331.207) [-1317.496] (-1335.447) (-1317.836) -- 0:03:08
311000 -- (-1316.434) (-1316.872) [-1320.813] (-1321.494) * (-1319.499) (-1315.926) (-1320.180) [-1322.256] -- 0:03:08
311500 -- (-1333.717) (-1323.707) [-1319.243] (-1314.900) * [-1320.986] (-1321.263) (-1323.908) (-1313.808) -- 0:03:07
312000 -- [-1320.368] (-1326.884) (-1327.026) (-1323.522) * (-1307.640) (-1318.622) [-1313.809] (-1325.722) -- 0:03:07
312500 -- [-1314.797] (-1317.407) (-1321.203) (-1330.908) * (-1309.442) (-1319.912) (-1324.685) [-1323.197] -- 0:03:07
313000 -- (-1312.634) (-1320.826) [-1320.986] (-1324.807) * [-1314.071] (-1316.725) (-1315.742) (-1318.439) -- 0:03:08
313500 -- (-1315.407) (-1326.403) [-1331.427] (-1325.118) * (-1333.311) (-1317.264) [-1314.411] (-1327.651) -- 0:03:08
314000 -- [-1316.308] (-1326.245) (-1321.146) (-1326.901) * (-1325.755) [-1314.543] (-1317.580) (-1318.822) -- 0:03:07
314500 -- (-1313.371) (-1323.897) [-1321.101] (-1332.472) * (-1313.861) (-1318.132) [-1318.194] (-1324.157) -- 0:03:07
315000 -- (-1327.176) (-1327.084) [-1310.884] (-1323.552) * [-1321.429] (-1318.625) (-1321.634) (-1315.832) -- 0:03:07
Average standard deviation of split frequencies: 0.012373
315500 -- (-1323.392) [-1319.514] (-1329.320) (-1320.377) * (-1312.159) (-1318.375) (-1319.068) [-1312.573] -- 0:03:06
316000 -- [-1316.261] (-1321.231) (-1320.785) (-1319.943) * [-1313.209] (-1319.283) (-1316.951) (-1317.044) -- 0:03:06
316500 -- (-1324.581) (-1336.350) [-1317.433] (-1321.620) * (-1307.915) [-1317.454] (-1312.160) (-1326.666) -- 0:03:07
317000 -- (-1317.171) (-1321.711) [-1319.590] (-1321.135) * (-1324.810) (-1324.179) (-1319.693) [-1317.744] -- 0:03:07
317500 -- (-1322.302) [-1319.265] (-1330.087) (-1326.636) * (-1317.984) (-1318.186) [-1321.416] (-1313.077) -- 0:03:07
318000 -- (-1318.775) (-1320.744) [-1326.121] (-1335.762) * (-1313.452) [-1312.061] (-1314.046) (-1324.047) -- 0:03:06
318500 -- [-1316.897] (-1317.133) (-1324.864) (-1330.914) * (-1315.527) [-1313.613] (-1318.924) (-1322.430) -- 0:03:06
319000 -- (-1313.816) [-1314.548] (-1328.172) (-1320.470) * [-1321.911] (-1316.078) (-1324.347) (-1322.393) -- 0:03:05
319500 -- (-1332.927) (-1323.940) [-1308.978] (-1329.453) * (-1314.111) (-1326.594) (-1313.625) [-1321.649] -- 0:03:05
320000 -- (-1316.550) [-1319.357] (-1314.928) (-1318.445) * (-1317.334) (-1324.556) [-1315.374] (-1327.469) -- 0:03:07
Average standard deviation of split frequencies: 0.012312
320500 -- (-1314.520) (-1324.504) (-1317.947) [-1325.427] * (-1315.143) (-1322.982) (-1320.354) [-1312.697] -- 0:03:06
321000 -- (-1315.757) (-1326.108) [-1309.486] (-1312.948) * [-1313.184] (-1316.934) (-1328.351) (-1319.187) -- 0:03:06
321500 -- [-1318.265] (-1318.531) (-1317.313) (-1334.159) * (-1324.486) (-1319.363) (-1319.650) [-1321.268] -- 0:03:05
322000 -- (-1319.060) (-1318.905) (-1324.622) [-1318.242] * (-1317.518) [-1314.938] (-1324.710) (-1323.922) -- 0:03:05
322500 -- (-1320.029) [-1317.023] (-1313.952) (-1322.432) * [-1321.027] (-1316.666) (-1314.472) (-1316.726) -- 0:03:04
323000 -- (-1323.315) [-1314.657] (-1313.007) (-1325.363) * [-1311.520] (-1323.058) (-1313.622) (-1322.480) -- 0:03:04
323500 -- (-1329.061) (-1322.869) (-1320.378) [-1322.174] * [-1316.509] (-1318.688) (-1319.244) (-1324.943) -- 0:03:06
324000 -- (-1327.221) [-1324.197] (-1323.934) (-1322.383) * (-1312.453) (-1317.626) (-1315.088) [-1318.704] -- 0:03:05
324500 -- [-1315.627] (-1323.762) (-1327.093) (-1320.040) * (-1324.810) (-1323.356) [-1311.788] (-1318.585) -- 0:03:05
325000 -- (-1325.723) (-1324.580) (-1334.684) [-1318.736] * (-1325.159) (-1322.469) (-1319.681) [-1322.243] -- 0:03:04
Average standard deviation of split frequencies: 0.012201
325500 -- (-1332.506) (-1322.134) (-1324.403) [-1318.122] * [-1319.832] (-1323.249) (-1317.824) (-1317.108) -- 0:03:04
326000 -- [-1326.275] (-1318.094) (-1326.173) (-1313.078) * [-1314.859] (-1320.751) (-1313.587) (-1326.625) -- 0:03:04
326500 -- (-1318.863) (-1319.184) [-1321.015] (-1312.904) * [-1308.697] (-1330.684) (-1314.315) (-1323.410) -- 0:03:05
327000 -- (-1321.576) (-1324.722) (-1315.217) [-1311.140] * [-1310.419] (-1322.498) (-1314.650) (-1321.531) -- 0:03:05
327500 -- (-1317.299) [-1318.473] (-1311.935) (-1318.157) * (-1320.623) [-1312.808] (-1339.428) (-1326.418) -- 0:03:04
328000 -- (-1319.442) [-1313.479] (-1325.973) (-1319.641) * (-1330.307) (-1319.238) (-1311.442) [-1311.229] -- 0:03:04
328500 -- (-1320.982) [-1321.000] (-1328.010) (-1316.079) * [-1323.738] (-1315.467) (-1321.215) (-1311.957) -- 0:03:03
329000 -- [-1312.862] (-1322.547) (-1327.793) (-1325.079) * (-1317.708) (-1330.731) (-1317.624) [-1326.462] -- 0:03:03
329500 -- (-1318.533) (-1327.741) (-1339.907) [-1312.124] * (-1319.992) (-1327.259) (-1319.289) [-1310.603] -- 0:03:03
330000 -- (-1328.837) [-1317.427] (-1319.116) (-1326.626) * [-1321.114] (-1325.760) (-1325.502) (-1323.870) -- 0:03:04
Average standard deviation of split frequencies: 0.010650
330500 -- (-1322.270) (-1319.400) [-1320.507] (-1321.530) * (-1317.622) (-1319.412) [-1324.330] (-1311.059) -- 0:03:04
331000 -- (-1329.992) (-1318.537) (-1321.096) [-1322.537] * [-1320.201] (-1322.026) (-1322.950) (-1316.885) -- 0:03:03
331500 -- (-1326.079) (-1315.182) [-1317.129] (-1323.009) * [-1319.767] (-1320.189) (-1317.008) (-1327.847) -- 0:03:03
332000 -- (-1325.264) (-1315.050) [-1313.831] (-1317.807) * (-1326.868) (-1322.459) (-1313.023) [-1310.932] -- 0:03:03
332500 -- (-1327.604) (-1320.176) (-1311.231) [-1316.511] * (-1319.610) (-1326.473) [-1317.489] (-1320.537) -- 0:03:02
333000 -- (-1321.978) (-1328.073) [-1314.549] (-1321.451) * [-1317.157] (-1317.101) (-1322.503) (-1322.390) -- 0:03:02
333500 -- (-1314.871) (-1316.231) (-1323.131) [-1321.586] * [-1312.363] (-1319.468) (-1312.904) (-1319.386) -- 0:03:03
334000 -- (-1336.480) (-1319.445) (-1322.131) [-1323.479] * [-1315.426] (-1316.806) (-1316.260) (-1322.944) -- 0:03:03
334500 -- (-1328.488) [-1308.803] (-1319.353) (-1315.138) * (-1326.452) [-1314.622] (-1325.294) (-1321.438) -- 0:03:03
335000 -- (-1326.217) [-1320.538] (-1320.707) (-1319.301) * (-1324.569) (-1320.943) [-1316.474] (-1316.949) -- 0:03:02
Average standard deviation of split frequencies: 0.010646
335500 -- (-1328.666) (-1325.069) [-1316.160] (-1326.706) * [-1326.472] (-1325.255) (-1331.223) (-1319.336) -- 0:03:02
336000 -- (-1329.469) (-1314.455) [-1315.350] (-1331.056) * (-1324.823) (-1314.938) [-1326.168] (-1322.051) -- 0:03:01
336500 -- (-1327.662) [-1314.116] (-1324.063) (-1328.037) * (-1325.055) (-1313.342) (-1318.292) [-1312.566] -- 0:03:01
337000 -- (-1323.759) [-1313.691] (-1317.498) (-1312.194) * (-1325.113) (-1317.964) (-1323.853) [-1321.599] -- 0:03:02
337500 -- (-1323.783) [-1310.234] (-1316.715) (-1322.710) * (-1314.680) (-1318.760) [-1321.701] (-1318.989) -- 0:03:02
338000 -- (-1331.219) (-1331.972) [-1315.713] (-1321.658) * (-1322.464) (-1317.054) (-1326.228) [-1316.426] -- 0:03:02
338500 -- (-1327.206) [-1313.290] (-1323.684) (-1332.016) * (-1312.364) (-1333.462) [-1315.319] (-1320.546) -- 0:03:01
339000 -- [-1313.016] (-1320.247) (-1321.362) (-1336.800) * (-1323.964) (-1327.331) (-1314.865) [-1314.712] -- 0:03:01
339500 -- (-1316.688) [-1314.093] (-1335.035) (-1317.203) * (-1326.659) (-1334.963) [-1321.558] (-1328.321) -- 0:03:02
340000 -- (-1315.886) (-1314.423) [-1312.751] (-1326.614) * (-1324.715) [-1317.429] (-1329.680) (-1314.299) -- 0:03:02
Average standard deviation of split frequencies: 0.009849
340500 -- (-1318.194) [-1313.659] (-1315.012) (-1318.203) * (-1324.412) (-1326.850) [-1309.746] (-1315.282) -- 0:03:02
341000 -- [-1312.210] (-1330.276) (-1317.361) (-1317.090) * (-1323.861) (-1321.139) [-1314.064] (-1320.548) -- 0:03:01
341500 -- [-1312.256] (-1322.138) (-1318.544) (-1317.712) * (-1317.928) [-1323.073] (-1322.258) (-1315.793) -- 0:03:01
342000 -- (-1322.267) (-1319.400) [-1318.322] (-1312.559) * (-1317.273) (-1316.381) (-1317.138) [-1318.684] -- 0:03:00
342500 -- (-1318.228) (-1331.452) (-1335.987) [-1318.239] * (-1317.643) [-1317.481] (-1317.841) (-1324.295) -- 0:03:02
343000 -- [-1313.898] (-1316.509) (-1329.627) (-1311.253) * [-1314.464] (-1320.571) (-1322.594) (-1317.241) -- 0:03:01
343500 -- (-1318.686) (-1315.345) (-1315.495) [-1312.590] * (-1318.454) (-1324.756) [-1314.913] (-1322.154) -- 0:03:01
344000 -- (-1326.130) (-1317.436) [-1315.292] (-1319.916) * (-1321.495) (-1327.989) [-1316.584] (-1330.397) -- 0:03:01
344500 -- (-1328.438) (-1323.567) (-1314.601) [-1314.783] * [-1316.152] (-1324.933) (-1321.189) (-1330.294) -- 0:03:00
345000 -- (-1329.912) (-1321.997) (-1331.401) [-1318.546] * (-1325.736) [-1317.821] (-1318.757) (-1319.242) -- 0:03:00
Average standard deviation of split frequencies: 0.010098
345500 -- (-1313.719) (-1325.162) (-1324.689) [-1318.503] * (-1324.494) (-1324.320) [-1318.576] (-1326.863) -- 0:02:59
346000 -- [-1315.057] (-1327.481) (-1323.055) (-1311.651) * (-1317.373) (-1313.632) [-1316.180] (-1324.834) -- 0:03:01
346500 -- [-1319.427] (-1322.038) (-1314.005) (-1321.070) * (-1317.638) (-1333.711) (-1314.063) [-1320.538] -- 0:03:01
347000 -- (-1319.534) (-1327.181) [-1312.602] (-1317.435) * (-1322.031) [-1317.876] (-1314.515) (-1324.864) -- 0:03:00
347500 -- (-1317.082) (-1321.098) (-1311.866) [-1316.904] * (-1318.611) [-1314.412] (-1314.878) (-1323.997) -- 0:03:00
348000 -- (-1315.307) [-1320.124] (-1329.560) (-1312.728) * (-1323.108) (-1318.394) [-1321.707] (-1311.129) -- 0:02:59
348500 -- [-1313.256] (-1326.316) (-1322.524) (-1324.622) * [-1313.320] (-1319.138) (-1324.258) (-1316.524) -- 0:02:59
349000 -- (-1330.967) (-1325.976) [-1328.859] (-1314.484) * (-1322.091) (-1316.183) [-1314.494] (-1316.938) -- 0:03:00
349500 -- [-1317.554] (-1314.679) (-1329.766) (-1322.488) * [-1315.163] (-1315.568) (-1327.623) (-1330.137) -- 0:03:00
350000 -- [-1317.997] (-1317.943) (-1321.409) (-1317.112) * [-1314.474] (-1319.066) (-1320.434) (-1326.321) -- 0:03:00
Average standard deviation of split frequencies: 0.008857
350500 -- [-1321.304] (-1321.289) (-1326.752) (-1321.221) * (-1312.637) (-1324.271) (-1329.076) [-1321.468] -- 0:02:59
351000 -- (-1316.608) [-1317.459] (-1331.975) (-1321.216) * (-1319.695) (-1314.222) [-1324.643] (-1316.057) -- 0:02:59
351500 -- [-1321.938] (-1318.774) (-1326.222) (-1322.552) * (-1320.196) [-1321.258] (-1327.649) (-1318.054) -- 0:02:58
352000 -- [-1315.733] (-1319.666) (-1328.608) (-1319.061) * [-1316.573] (-1320.621) (-1325.519) (-1315.171) -- 0:03:00
352500 -- (-1313.121) (-1316.008) [-1319.961] (-1315.370) * [-1320.576] (-1316.525) (-1320.443) (-1329.402) -- 0:03:00
353000 -- (-1314.063) [-1314.109] (-1320.256) (-1317.661) * (-1314.377) [-1317.868] (-1319.726) (-1323.980) -- 0:02:59
353500 -- (-1320.403) [-1322.813] (-1323.784) (-1317.573) * (-1316.084) [-1321.525] (-1312.730) (-1324.223) -- 0:02:59
354000 -- [-1325.413] (-1323.551) (-1316.759) (-1321.112) * (-1334.730) [-1316.392] (-1316.532) (-1322.595) -- 0:02:58
354500 -- (-1319.419) (-1313.092) [-1317.163] (-1329.546) * (-1315.049) (-1327.203) (-1318.098) [-1319.224] -- 0:02:58
355000 -- [-1318.631] (-1318.240) (-1320.403) (-1325.268) * (-1318.580) (-1332.521) (-1321.217) [-1319.000] -- 0:02:58
Average standard deviation of split frequencies: 0.009581
355500 -- (-1329.549) (-1314.386) [-1311.673] (-1322.805) * (-1326.405) (-1322.300) (-1315.683) [-1318.558] -- 0:02:59
356000 -- (-1325.600) [-1315.202] (-1325.861) (-1321.771) * (-1327.297) (-1311.506) (-1316.161) [-1318.622] -- 0:02:59
356500 -- (-1327.443) (-1327.681) [-1313.337] (-1326.126) * (-1324.857) [-1311.992] (-1321.380) (-1324.750) -- 0:02:58
357000 -- (-1326.666) [-1316.137] (-1321.539) (-1332.426) * [-1316.100] (-1322.422) (-1320.500) (-1324.452) -- 0:02:58
357500 -- [-1319.616] (-1320.858) (-1326.382) (-1313.197) * (-1322.467) (-1327.444) (-1325.039) [-1317.489] -- 0:02:57
358000 -- [-1315.955] (-1327.171) (-1325.160) (-1311.581) * (-1317.972) (-1336.203) (-1321.832) [-1320.016] -- 0:02:57
358500 -- (-1317.065) (-1313.654) (-1326.063) [-1317.151] * (-1319.850) (-1333.125) [-1316.566] (-1325.146) -- 0:02:58
359000 -- (-1325.370) [-1318.737] (-1325.039) (-1325.034) * [-1317.199] (-1322.379) (-1319.216) (-1319.313) -- 0:02:58
359500 -- (-1323.407) (-1315.862) (-1322.602) [-1323.606] * (-1314.509) [-1320.814] (-1321.568) (-1335.322) -- 0:02:58
360000 -- (-1321.550) (-1323.267) (-1327.220) [-1313.761] * (-1314.875) (-1320.870) [-1320.443] (-1324.501) -- 0:02:57
Average standard deviation of split frequencies: 0.009380
360500 -- (-1320.865) (-1321.483) (-1329.452) [-1313.853] * [-1315.799] (-1318.409) (-1326.498) (-1322.577) -- 0:02:57
361000 -- (-1314.517) [-1317.118] (-1317.768) (-1318.739) * (-1319.622) [-1318.210] (-1325.358) (-1329.062) -- 0:02:57
361500 -- (-1320.712) (-1315.312) [-1310.663] (-1325.996) * [-1320.451] (-1325.952) (-1320.019) (-1324.265) -- 0:02:56
362000 -- [-1317.315] (-1312.739) (-1316.912) (-1326.443) * [-1312.404] (-1315.481) (-1326.482) (-1323.549) -- 0:02:58
362500 -- [-1315.055] (-1321.445) (-1321.869) (-1326.431) * (-1325.040) (-1320.111) (-1319.383) [-1321.162] -- 0:02:57
363000 -- (-1315.264) (-1320.542) [-1329.692] (-1326.921) * (-1319.745) (-1329.736) [-1318.794] (-1317.377) -- 0:02:57
363500 -- [-1314.903] (-1323.102) (-1325.530) (-1337.719) * (-1321.349) (-1323.130) [-1315.997] (-1350.518) -- 0:02:56
364000 -- (-1325.708) [-1326.812] (-1324.082) (-1337.476) * (-1324.428) [-1319.679] (-1311.110) (-1319.915) -- 0:02:56
364500 -- (-1320.733) (-1328.534) [-1313.010] (-1320.968) * [-1311.607] (-1318.765) (-1317.903) (-1316.276) -- 0:02:56
365000 -- [-1315.932] (-1320.610) (-1323.113) (-1318.394) * (-1319.218) (-1322.386) (-1323.841) [-1315.490] -- 0:02:57
Average standard deviation of split frequencies: 0.010380
365500 -- [-1318.306] (-1316.179) (-1325.221) (-1322.470) * (-1327.030) [-1317.250] (-1320.240) (-1319.996) -- 0:02:57
366000 -- (-1321.715) (-1327.088) [-1322.606] (-1323.585) * (-1320.713) (-1314.974) [-1315.492] (-1324.134) -- 0:02:56
366500 -- (-1319.196) (-1330.761) (-1322.442) [-1321.706] * [-1322.169] (-1320.911) (-1318.683) (-1327.109) -- 0:02:56
367000 -- (-1318.756) [-1323.390] (-1323.461) (-1321.322) * (-1326.838) [-1315.644] (-1311.937) (-1325.656) -- 0:02:55
367500 -- (-1312.455) [-1310.422] (-1321.267) (-1326.262) * (-1325.754) (-1316.005) [-1317.897] (-1324.040) -- 0:02:55
368000 -- (-1321.161) [-1313.352] (-1323.814) (-1319.029) * (-1321.084) [-1315.753] (-1316.295) (-1315.901) -- 0:02:55
368500 -- (-1332.264) [-1323.516] (-1332.721) (-1325.491) * (-1326.774) (-1311.811) [-1320.139] (-1314.260) -- 0:02:56
369000 -- (-1325.874) (-1323.310) (-1328.368) [-1315.766] * (-1311.895) [-1313.159] (-1329.629) (-1326.054) -- 0:02:56
369500 -- (-1320.382) [-1316.805] (-1322.721) (-1324.782) * (-1312.461) (-1311.388) (-1321.988) [-1313.142] -- 0:02:55
370000 -- (-1317.940) [-1309.109] (-1329.275) (-1325.625) * (-1322.512) (-1313.737) [-1317.837] (-1323.783) -- 0:02:55
Average standard deviation of split frequencies: 0.010548
370500 -- (-1323.173) [-1313.467] (-1330.109) (-1320.627) * (-1319.816) (-1317.099) (-1323.333) [-1315.987] -- 0:02:55
371000 -- (-1315.226) (-1317.851) [-1320.489] (-1334.092) * (-1317.381) [-1315.711] (-1327.066) (-1317.079) -- 0:02:54
371500 -- (-1311.786) [-1315.394] (-1321.092) (-1330.312) * [-1308.965] (-1320.016) (-1313.228) (-1319.258) -- 0:02:54
372000 -- (-1322.835) (-1314.791) (-1320.459) [-1319.214] * (-1315.001) (-1328.802) [-1321.151] (-1320.395) -- 0:02:55
372500 -- (-1326.687) [-1313.988] (-1317.317) (-1324.185) * (-1315.648) (-1317.290) [-1316.743] (-1318.453) -- 0:02:55
373000 -- (-1319.842) [-1314.030] (-1314.552) (-1338.579) * (-1322.053) (-1310.971) (-1310.626) [-1320.091] -- 0:02:54
373500 -- (-1318.518) (-1319.775) (-1320.624) [-1310.865] * (-1322.174) [-1312.644] (-1314.144) (-1325.595) -- 0:02:54
374000 -- (-1323.309) [-1323.689] (-1329.268) (-1310.681) * (-1323.011) [-1323.989] (-1320.313) (-1318.009) -- 0:02:54
374500 -- (-1323.212) [-1320.503] (-1326.612) (-1314.157) * (-1320.844) [-1314.542] (-1319.836) (-1326.564) -- 0:02:53
375000 -- (-1318.810) (-1320.972) (-1322.099) [-1315.852] * [-1314.105] (-1321.018) (-1319.430) (-1316.112) -- 0:02:53
Average standard deviation of split frequencies: 0.010177
375500 -- (-1330.301) [-1313.698] (-1314.530) (-1323.056) * (-1317.106) [-1316.573] (-1333.237) (-1315.739) -- 0:02:52
376000 -- (-1329.647) (-1316.507) (-1328.289) [-1318.983] * (-1321.715) (-1318.739) [-1317.601] (-1321.543) -- 0:02:54
376500 -- [-1316.810] (-1319.715) (-1321.441) (-1322.294) * (-1323.766) (-1318.793) (-1319.029) [-1313.929] -- 0:02:53
377000 -- (-1330.355) [-1316.542] (-1315.447) (-1328.204) * [-1313.692] (-1324.177) (-1324.437) (-1319.332) -- 0:02:53
377500 -- (-1327.725) [-1312.879] (-1315.244) (-1315.011) * [-1309.076] (-1317.424) (-1328.559) (-1320.048) -- 0:02:53
378000 -- (-1326.555) (-1312.661) [-1320.094] (-1316.667) * (-1315.947) (-1316.451) [-1312.001] (-1318.142) -- 0:02:52
378500 -- (-1327.105) (-1317.565) (-1314.827) [-1320.366] * (-1313.253) [-1313.174] (-1322.346) (-1313.189) -- 0:02:54
379000 -- (-1316.843) (-1317.430) (-1319.983) [-1324.191] * (-1315.711) (-1314.239) (-1315.348) [-1316.573] -- 0:02:53
379500 -- (-1331.435) (-1312.876) [-1314.445] (-1320.410) * (-1331.398) (-1312.971) [-1312.094] (-1312.428) -- 0:02:53
380000 -- (-1318.482) (-1321.803) [-1318.496] (-1319.028) * (-1330.805) [-1311.115] (-1316.717) (-1321.285) -- 0:02:52
Average standard deviation of split frequencies: 0.010198
380500 -- (-1320.812) (-1320.717) [-1310.332] (-1324.202) * [-1315.421] (-1324.460) (-1313.894) (-1319.420) -- 0:02:52
381000 -- [-1308.354] (-1326.967) (-1327.559) (-1324.756) * (-1323.998) (-1325.150) [-1312.423] (-1317.993) -- 0:02:52
381500 -- [-1314.348] (-1318.304) (-1335.922) (-1320.966) * (-1310.582) [-1322.620] (-1324.909) (-1315.581) -- 0:02:53
382000 -- (-1318.140) [-1321.789] (-1334.719) (-1319.817) * (-1316.907) (-1331.082) [-1306.828] (-1323.105) -- 0:02:53
382500 -- (-1324.555) (-1317.507) (-1322.007) [-1308.834] * (-1314.404) (-1320.263) (-1320.317) [-1317.841] -- 0:02:52
383000 -- (-1314.392) (-1320.304) (-1323.237) [-1323.059] * (-1317.673) (-1314.091) (-1325.636) [-1319.843] -- 0:02:52
383500 -- [-1311.886] (-1333.043) (-1323.378) (-1324.247) * (-1314.372) (-1319.419) (-1319.547) [-1313.417] -- 0:02:52
384000 -- [-1310.408] (-1325.902) (-1324.004) (-1321.215) * [-1315.764] (-1322.409) (-1317.737) (-1314.537) -- 0:02:53
384500 -- (-1315.307) (-1326.807) [-1316.208] (-1316.312) * (-1319.226) [-1314.707] (-1325.453) (-1313.314) -- 0:02:52
385000 -- (-1320.698) (-1322.717) [-1316.721] (-1316.342) * (-1318.190) [-1316.311] (-1323.035) (-1317.161) -- 0:02:52
Average standard deviation of split frequencies: 0.010417
385500 -- (-1320.653) (-1316.980) [-1313.506] (-1325.624) * (-1330.438) (-1321.906) [-1316.284] (-1316.818) -- 0:02:52
386000 -- (-1323.812) (-1320.280) [-1320.178] (-1327.611) * (-1312.400) (-1320.005) [-1320.355] (-1318.966) -- 0:02:51
386500 -- (-1327.185) [-1318.113] (-1320.948) (-1323.028) * (-1318.275) (-1321.914) [-1314.394] (-1328.083) -- 0:02:51
387000 -- (-1317.462) (-1318.564) (-1321.504) [-1319.179] * [-1318.477] (-1342.021) (-1323.783) (-1329.158) -- 0:02:51
387500 -- (-1330.955) [-1318.901] (-1319.203) (-1324.852) * (-1328.737) (-1320.574) (-1318.529) [-1329.615] -- 0:02:52
388000 -- (-1331.225) (-1323.592) (-1323.039) [-1317.778] * [-1319.800] (-1322.800) (-1325.161) (-1327.021) -- 0:02:51
388500 -- (-1325.984) (-1316.700) [-1324.673] (-1321.512) * (-1323.576) (-1327.770) (-1312.797) [-1319.064] -- 0:02:51
389000 -- (-1325.857) (-1323.420) [-1315.619] (-1318.478) * [-1312.858] (-1326.439) (-1315.260) (-1319.808) -- 0:02:51
389500 -- (-1326.391) (-1320.378) [-1320.208] (-1325.984) * (-1311.939) (-1325.471) (-1310.810) [-1331.932] -- 0:02:50
390000 -- (-1316.835) [-1317.927] (-1312.299) (-1321.393) * [-1312.084] (-1319.856) (-1320.355) (-1325.357) -- 0:02:50
Average standard deviation of split frequencies: 0.010079
390500 -- (-1321.176) (-1321.558) (-1316.932) [-1317.773] * (-1311.142) (-1326.042) [-1317.719] (-1316.603) -- 0:02:51
391000 -- (-1324.508) (-1327.075) [-1319.421] (-1330.372) * (-1321.806) (-1315.996) (-1316.035) [-1321.770] -- 0:02:51
391500 -- (-1321.654) (-1319.894) [-1314.350] (-1313.637) * [-1314.507] (-1314.377) (-1323.728) (-1321.849) -- 0:02:50
392000 -- (-1313.991) (-1325.801) [-1308.762] (-1324.171) * (-1315.781) (-1319.682) [-1317.350] (-1325.670) -- 0:02:50
392500 -- [-1309.368] (-1317.577) (-1320.258) (-1311.791) * [-1317.519] (-1329.164) (-1322.616) (-1325.479) -- 0:02:50
393000 -- (-1313.370) (-1317.724) [-1315.453] (-1323.146) * (-1322.005) (-1326.210) [-1319.650] (-1315.869) -- 0:02:51
393500 -- (-1323.510) [-1323.116] (-1319.478) (-1328.564) * (-1323.495) [-1314.095] (-1316.706) (-1315.597) -- 0:02:51
394000 -- (-1317.661) [-1313.833] (-1312.153) (-1323.718) * (-1310.059) (-1317.092) [-1317.693] (-1323.814) -- 0:02:50
394500 -- (-1332.468) (-1314.768) (-1320.339) [-1314.723] * (-1320.430) (-1322.975) (-1328.142) [-1319.289] -- 0:02:50
395000 -- (-1328.219) [-1317.845] (-1323.174) (-1315.052) * [-1316.662] (-1312.208) (-1313.412) (-1313.648) -- 0:02:50
Average standard deviation of split frequencies: 0.009733
395500 -- (-1320.248) [-1318.661] (-1321.012) (-1317.150) * [-1312.117] (-1316.870) (-1318.912) (-1320.692) -- 0:02:49
396000 -- (-1319.353) [-1317.797] (-1320.546) (-1323.710) * (-1323.719) [-1322.522] (-1324.598) (-1321.667) -- 0:02:49
396500 -- (-1324.695) (-1322.778) [-1315.670] (-1316.347) * (-1323.040) (-1318.016) (-1318.461) [-1321.588] -- 0:02:50
397000 -- (-1315.937) (-1318.979) (-1318.854) [-1313.561] * (-1322.316) (-1324.558) [-1316.839] (-1326.721) -- 0:02:50
397500 -- (-1313.485) (-1325.380) [-1313.566] (-1316.438) * (-1326.589) [-1312.703] (-1324.240) (-1320.844) -- 0:02:49
398000 -- (-1325.262) [-1322.134] (-1333.971) (-1320.652) * [-1320.967] (-1315.727) (-1321.006) (-1319.255) -- 0:02:49
398500 -- (-1321.950) [-1322.290] (-1318.894) (-1321.363) * [-1318.115] (-1321.065) (-1316.294) (-1333.079) -- 0:02:49
399000 -- (-1318.984) (-1318.859) [-1314.130] (-1319.121) * (-1319.132) (-1318.985) (-1321.772) [-1320.818] -- 0:02:50
399500 -- (-1333.531) [-1314.402] (-1319.515) (-1321.572) * (-1308.983) (-1327.322) (-1320.287) [-1316.482] -- 0:02:49
400000 -- [-1311.502] (-1318.124) (-1328.366) (-1317.807) * (-1320.474) [-1321.987] (-1317.658) (-1315.706) -- 0:02:49
Average standard deviation of split frequencies: 0.009897
400500 -- (-1324.358) [-1316.602] (-1331.214) (-1325.847) * (-1317.641) [-1317.962] (-1320.854) (-1329.995) -- 0:02:49
401000 -- (-1326.372) (-1322.249) (-1310.652) [-1316.608] * (-1324.212) [-1318.556] (-1319.908) (-1328.307) -- 0:02:48
401500 -- (-1319.070) (-1316.131) (-1330.413) [-1312.953] * (-1322.129) (-1321.357) [-1313.497] (-1333.989) -- 0:02:48
402000 -- (-1319.089) (-1317.420) (-1321.408) [-1308.192] * (-1317.860) (-1329.949) (-1327.120) [-1323.305] -- 0:02:48
402500 -- (-1322.029) (-1320.927) (-1328.259) [-1318.651] * (-1323.837) (-1323.197) [-1317.874] (-1325.621) -- 0:02:49
403000 -- [-1322.893] (-1319.730) (-1324.313) (-1313.847) * (-1323.946) [-1315.758] (-1317.429) (-1329.835) -- 0:02:48
403500 -- (-1322.419) (-1329.610) (-1319.764) [-1313.183] * (-1325.188) (-1315.961) [-1318.078] (-1320.057) -- 0:02:48
404000 -- (-1330.714) (-1324.969) [-1315.028] (-1312.624) * (-1322.244) (-1325.579) [-1319.148] (-1323.467) -- 0:02:48
404500 -- (-1316.053) (-1331.914) [-1313.155] (-1318.544) * (-1326.364) (-1320.615) (-1318.716) [-1320.984] -- 0:02:47
405000 -- [-1320.515] (-1324.954) (-1311.197) (-1328.056) * (-1319.030) [-1322.177] (-1317.832) (-1319.339) -- 0:02:47
Average standard deviation of split frequencies: 0.010450
405500 -- (-1317.685) (-1338.321) [-1318.684] (-1328.323) * [-1310.652] (-1325.258) (-1312.147) (-1326.199) -- 0:02:47
406000 -- [-1317.173] (-1337.060) (-1320.348) (-1317.352) * (-1328.865) (-1321.211) [-1315.732] (-1323.979) -- 0:02:48
406500 -- (-1321.095) [-1316.849] (-1314.487) (-1331.009) * (-1319.854) (-1317.198) [-1318.751] (-1336.393) -- 0:02:47
407000 -- [-1323.500] (-1313.341) (-1320.845) (-1317.665) * [-1325.329] (-1324.585) (-1311.123) (-1328.784) -- 0:02:47
407500 -- [-1319.336] (-1325.743) (-1327.897) (-1314.952) * (-1325.602) (-1329.172) [-1318.283] (-1314.944) -- 0:02:47
408000 -- [-1320.674] (-1314.851) (-1323.876) (-1317.367) * (-1317.180) [-1319.870] (-1324.638) (-1324.810) -- 0:02:46
408500 -- (-1316.411) (-1325.555) [-1324.612] (-1330.433) * (-1318.996) (-1322.679) [-1311.608] (-1322.617) -- 0:02:46
409000 -- (-1318.887) [-1330.493] (-1326.812) (-1327.110) * (-1319.201) (-1334.369) [-1317.214] (-1319.443) -- 0:02:47
409500 -- (-1326.854) [-1323.641] (-1326.957) (-1327.519) * [-1323.001] (-1334.497) (-1319.844) (-1324.857) -- 0:02:47
410000 -- (-1321.435) (-1323.386) (-1318.080) [-1319.959] * (-1315.547) (-1329.007) (-1319.974) [-1323.002] -- 0:02:46
Average standard deviation of split frequencies: 0.010534
410500 -- (-1323.785) (-1324.884) (-1326.816) [-1322.295] * (-1328.897) (-1321.944) (-1320.015) [-1320.946] -- 0:02:46
411000 -- (-1320.549) [-1323.716] (-1317.074) (-1315.567) * (-1333.733) (-1330.322) (-1320.956) [-1312.823] -- 0:02:46
411500 -- [-1318.645] (-1320.379) (-1327.443) (-1320.274) * (-1322.097) [-1324.457] (-1322.176) (-1322.049) -- 0:02:45
412000 -- (-1320.517) [-1318.082] (-1321.292) (-1326.344) * (-1319.391) (-1321.620) (-1323.519) [-1310.797] -- 0:02:45
412500 -- (-1328.004) (-1325.421) (-1323.428) [-1325.299] * (-1320.352) (-1325.898) (-1319.194) [-1312.560] -- 0:02:46
413000 -- (-1316.056) (-1326.613) (-1333.085) [-1321.591] * (-1331.586) (-1320.915) [-1321.840] (-1319.131) -- 0:02:46
413500 -- (-1321.159) [-1312.981] (-1320.999) (-1329.331) * (-1333.901) [-1324.234] (-1322.375) (-1314.700) -- 0:02:45
414000 -- [-1323.521] (-1322.804) (-1327.024) (-1322.001) * [-1325.977] (-1329.295) (-1323.318) (-1314.302) -- 0:02:45
414500 -- [-1318.675] (-1336.698) (-1323.801) (-1322.355) * (-1318.653) (-1327.333) (-1324.055) [-1316.086] -- 0:02:45
415000 -- (-1323.810) [-1328.273] (-1329.641) (-1316.050) * (-1318.017) (-1326.215) (-1319.974) [-1319.578] -- 0:02:46
Average standard deviation of split frequencies: 0.010399
415500 -- [-1320.343] (-1318.152) (-1329.341) (-1317.014) * (-1313.960) [-1312.504] (-1321.134) (-1336.905) -- 0:02:45
416000 -- (-1324.408) (-1320.619) [-1315.696] (-1325.877) * [-1315.168] (-1324.452) (-1324.153) (-1319.491) -- 0:02:45
416500 -- (-1317.395) (-1325.149) (-1316.973) [-1324.392] * (-1320.366) [-1314.774] (-1323.162) (-1306.468) -- 0:02:45
417000 -- [-1314.403] (-1315.532) (-1319.603) (-1311.162) * (-1319.368) (-1320.913) (-1321.287) [-1313.003] -- 0:02:44
417500 -- [-1320.982] (-1322.418) (-1318.220) (-1320.145) * (-1314.307) (-1333.189) [-1313.338] (-1312.260) -- 0:02:46
418000 -- (-1323.533) [-1328.340] (-1319.639) (-1319.453) * (-1320.720) (-1321.864) (-1327.266) [-1315.737] -- 0:02:45
418500 -- (-1316.627) (-1313.118) (-1320.109) [-1313.840] * (-1318.897) (-1322.187) [-1313.401] (-1322.998) -- 0:02:45
419000 -- (-1323.009) (-1341.242) (-1317.036) [-1314.615] * [-1317.830] (-1315.460) (-1314.484) (-1323.999) -- 0:02:45
419500 -- (-1328.619) (-1321.951) (-1321.250) [-1319.979] * (-1327.723) (-1315.211) [-1319.150] (-1313.705) -- 0:02:44
420000 -- (-1321.287) (-1316.529) (-1318.947) [-1322.636] * (-1339.161) (-1325.106) (-1330.921) [-1311.079] -- 0:02:44
Average standard deviation of split frequencies: 0.010296
420500 -- (-1319.616) (-1320.927) (-1323.303) [-1319.964] * (-1331.347) (-1321.397) (-1314.307) [-1323.441] -- 0:02:45
421000 -- (-1329.699) (-1320.923) (-1327.128) [-1311.420] * (-1325.668) (-1320.219) (-1317.278) [-1314.566] -- 0:02:45
421500 -- (-1330.937) [-1322.718] (-1318.458) (-1322.243) * [-1316.783] (-1313.225) (-1320.851) (-1318.121) -- 0:02:44
422000 -- (-1318.000) (-1317.313) (-1320.965) [-1317.787] * (-1326.440) [-1309.175] (-1327.022) (-1317.537) -- 0:02:44
422500 -- (-1321.819) (-1327.198) (-1327.339) [-1311.169] * (-1330.060) [-1310.857] (-1322.251) (-1320.041) -- 0:02:44
423000 -- (-1314.771) (-1322.326) (-1320.665) [-1307.929] * (-1315.463) [-1319.300] (-1321.703) (-1314.639) -- 0:02:43
423500 -- (-1317.716) (-1308.655) [-1319.945] (-1318.127) * (-1320.981) (-1323.740) [-1315.979] (-1322.936) -- 0:02:43
424000 -- (-1317.735) (-1325.361) (-1319.402) [-1323.836] * [-1325.560] (-1316.680) (-1317.179) (-1322.510) -- 0:02:44
424500 -- [-1329.130] (-1313.024) (-1316.450) (-1321.596) * (-1325.774) (-1319.979) (-1318.703) [-1315.982] -- 0:02:44
425000 -- (-1318.954) (-1326.057) [-1312.389] (-1320.866) * (-1326.018) (-1326.834) (-1315.221) [-1322.151] -- 0:02:43
Average standard deviation of split frequencies: 0.009890
425500 -- (-1313.500) (-1326.624) [-1314.059] (-1314.851) * (-1324.651) (-1312.351) [-1321.908] (-1325.844) -- 0:02:43
426000 -- (-1324.221) (-1311.776) (-1316.881) [-1311.389] * [-1318.397] (-1317.717) (-1315.306) (-1314.029) -- 0:02:43
426500 -- (-1320.398) [-1324.417] (-1328.473) (-1315.572) * [-1310.020] (-1320.206) (-1329.801) (-1317.190) -- 0:02:42
427000 -- (-1319.277) (-1324.421) [-1312.059] (-1320.720) * (-1322.387) (-1320.318) [-1314.871] (-1324.422) -- 0:02:42
427500 -- (-1312.860) (-1325.580) [-1322.625] (-1313.684) * (-1324.341) (-1324.202) [-1313.347] (-1316.775) -- 0:02:42
428000 -- [-1315.068] (-1317.680) (-1318.910) (-1328.662) * (-1318.267) (-1317.799) (-1321.013) [-1315.707] -- 0:02:43
428500 -- (-1318.944) (-1329.596) (-1320.869) [-1319.234] * (-1323.683) (-1318.915) [-1326.743] (-1326.617) -- 0:02:42
429000 -- (-1318.674) (-1321.212) [-1318.660] (-1328.528) * (-1333.861) [-1314.271] (-1345.698) (-1319.475) -- 0:02:42
429500 -- (-1325.000) [-1311.324] (-1319.204) (-1318.491) * (-1313.809) (-1328.808) [-1322.129] (-1317.437) -- 0:02:42
430000 -- (-1333.374) (-1326.379) (-1323.792) [-1319.937] * (-1320.882) (-1319.812) (-1330.322) [-1316.979] -- 0:02:41
Average standard deviation of split frequencies: 0.009851
430500 -- (-1329.283) [-1312.824] (-1326.981) (-1317.569) * (-1321.279) [-1324.890] (-1325.599) (-1319.791) -- 0:02:41
431000 -- (-1318.911) (-1313.720) (-1315.683) [-1317.257] * (-1315.496) [-1313.037] (-1329.022) (-1316.720) -- 0:02:41
431500 -- (-1324.630) (-1316.691) [-1313.122] (-1312.584) * [-1321.327] (-1317.109) (-1329.946) (-1322.539) -- 0:02:42
432000 -- (-1316.614) (-1320.300) [-1317.900] (-1314.762) * (-1320.084) [-1317.988] (-1318.659) (-1317.932) -- 0:02:41
432500 -- (-1320.792) [-1317.514] (-1326.712) (-1321.278) * [-1313.336] (-1320.524) (-1317.679) (-1332.670) -- 0:02:41
433000 -- [-1318.899] (-1324.063) (-1326.987) (-1321.301) * (-1312.756) (-1322.889) [-1313.923] (-1327.748) -- 0:02:41
433500 -- (-1331.516) (-1327.305) (-1320.962) [-1323.073] * (-1316.911) [-1323.686] (-1323.638) (-1313.346) -- 0:02:40
434000 -- (-1316.014) (-1331.899) [-1318.727] (-1315.920) * (-1312.425) (-1323.748) (-1325.028) [-1314.172] -- 0:02:40
434500 -- (-1332.845) (-1322.486) (-1315.185) [-1312.357] * [-1317.325] (-1306.940) (-1331.497) (-1317.246) -- 0:02:40
435000 -- (-1316.107) (-1325.533) [-1312.811] (-1320.684) * (-1332.270) (-1319.200) [-1316.163] (-1322.011) -- 0:02:41
Average standard deviation of split frequencies: 0.009222
435500 -- (-1314.122) (-1322.229) (-1319.862) [-1317.099] * (-1321.244) [-1317.008] (-1332.610) (-1330.341) -- 0:02:40
436000 -- [-1320.630] (-1328.032) (-1323.325) (-1318.179) * (-1317.948) (-1315.672) [-1322.689] (-1327.104) -- 0:02:40
436500 -- (-1322.525) (-1322.117) (-1317.228) [-1316.115] * [-1325.801] (-1319.528) (-1320.672) (-1321.090) -- 0:02:40
437000 -- (-1324.276) (-1325.120) (-1317.728) [-1313.844] * (-1329.210) [-1313.797] (-1315.194) (-1323.673) -- 0:02:39
437500 -- (-1323.839) (-1319.959) [-1310.605] (-1317.797) * (-1334.942) [-1318.042] (-1314.595) (-1322.011) -- 0:02:39
438000 -- (-1314.889) (-1311.005) (-1328.596) [-1311.736] * (-1315.169) [-1315.779] (-1320.278) (-1327.964) -- 0:02:39
438500 -- (-1316.343) (-1315.527) (-1317.452) [-1320.468] * [-1316.972] (-1327.457) (-1326.845) (-1310.382) -- 0:02:40
439000 -- (-1323.834) [-1318.103] (-1312.499) (-1316.405) * (-1314.681) [-1316.850] (-1330.907) (-1320.109) -- 0:02:39
439500 -- (-1320.620) (-1318.199) [-1324.127] (-1335.008) * [-1318.800] (-1315.042) (-1333.139) (-1322.179) -- 0:02:39
440000 -- (-1322.888) [-1323.207] (-1329.848) (-1326.220) * (-1316.396) (-1326.360) (-1326.506) [-1319.629] -- 0:02:39
Average standard deviation of split frequencies: 0.008432
440500 -- (-1313.474) [-1315.762] (-1319.262) (-1318.597) * (-1315.379) [-1324.948] (-1321.509) (-1321.301) -- 0:02:38
441000 -- [-1319.722] (-1319.161) (-1318.708) (-1328.068) * (-1309.690) [-1317.262] (-1316.033) (-1322.335) -- 0:02:38
441500 -- (-1326.244) (-1316.306) [-1319.312] (-1324.931) * (-1312.988) (-1324.002) [-1311.342] (-1316.219) -- 0:02:38
442000 -- (-1326.392) [-1317.624] (-1317.301) (-1316.309) * (-1325.491) (-1329.345) [-1318.413] (-1316.824) -- 0:02:39
442500 -- (-1320.982) (-1315.425) (-1322.113) [-1317.114] * [-1319.860] (-1325.172) (-1330.614) (-1313.183) -- 0:02:38
443000 -- (-1322.998) [-1315.502] (-1324.943) (-1318.994) * (-1316.204) (-1329.211) [-1317.795] (-1309.399) -- 0:02:38
443500 -- [-1310.990] (-1322.846) (-1318.849) (-1310.596) * [-1321.455] (-1323.949) (-1328.792) (-1325.519) -- 0:02:38
444000 -- (-1335.297) (-1320.640) (-1322.868) [-1315.065] * (-1320.864) (-1322.615) (-1319.176) [-1314.219] -- 0:02:37
444500 -- [-1306.642] (-1318.248) (-1319.585) (-1329.199) * [-1311.877] (-1316.104) (-1317.121) (-1324.603) -- 0:02:38
445000 -- [-1314.990] (-1329.054) (-1323.466) (-1326.965) * (-1315.250) [-1322.855] (-1329.336) (-1324.874) -- 0:02:38
Average standard deviation of split frequencies: 0.009450
445500 -- [-1317.734] (-1315.260) (-1319.788) (-1320.831) * (-1319.592) (-1332.670) (-1313.798) [-1317.434] -- 0:02:38
446000 -- (-1326.526) (-1316.468) [-1319.967] (-1324.748) * [-1306.770] (-1321.163) (-1336.727) (-1326.672) -- 0:02:37
446500 -- (-1310.759) (-1316.278) (-1316.479) [-1321.604] * (-1320.795) (-1331.666) (-1318.019) [-1322.725] -- 0:02:37
447000 -- [-1315.075] (-1334.304) (-1324.502) (-1318.787) * (-1315.026) [-1317.628] (-1322.656) (-1321.481) -- 0:02:37
447500 -- (-1325.243) [-1314.505] (-1339.357) (-1316.773) * [-1316.393] (-1318.472) (-1325.352) (-1327.883) -- 0:02:36
448000 -- [-1317.464] (-1318.465) (-1321.914) (-1319.001) * [-1315.704] (-1329.602) (-1321.403) (-1313.242) -- 0:02:37
448500 -- [-1318.610] (-1331.922) (-1318.220) (-1328.384) * (-1328.900) (-1320.618) (-1310.637) [-1320.157] -- 0:02:37
449000 -- [-1314.705] (-1320.251) (-1314.091) (-1321.883) * (-1313.657) [-1318.606] (-1321.203) (-1318.675) -- 0:02:37
449500 -- (-1322.158) [-1314.847] (-1316.613) (-1323.275) * [-1319.961] (-1318.551) (-1316.400) (-1318.184) -- 0:02:36
450000 -- (-1317.400) [-1327.372] (-1330.936) (-1326.387) * (-1317.108) [-1317.715] (-1322.628) (-1325.195) -- 0:02:36
Average standard deviation of split frequencies: 0.009353
450500 -- [-1320.579] (-1318.652) (-1326.835) (-1320.586) * (-1315.555) [-1320.075] (-1328.667) (-1327.334) -- 0:02:36
451000 -- [-1323.564] (-1316.448) (-1320.716) (-1316.495) * [-1316.581] (-1326.250) (-1318.786) (-1326.805) -- 0:02:35
451500 -- (-1330.661) (-1321.949) [-1325.877] (-1334.088) * [-1317.808] (-1316.689) (-1323.404) (-1332.691) -- 0:02:36
452000 -- (-1328.692) [-1316.638] (-1320.552) (-1330.251) * [-1319.225] (-1317.295) (-1321.846) (-1331.347) -- 0:02:36
452500 -- (-1329.034) [-1316.207] (-1327.459) (-1324.561) * (-1320.529) [-1317.017] (-1320.707) (-1315.570) -- 0:02:36
453000 -- (-1314.548) [-1318.285] (-1320.907) (-1317.603) * [-1320.918] (-1314.379) (-1331.455) (-1312.418) -- 0:02:35
453500 -- [-1322.969] (-1318.613) (-1319.117) (-1330.147) * (-1325.738) (-1325.075) [-1326.874] (-1327.753) -- 0:02:35
454000 -- [-1317.697] (-1323.255) (-1323.592) (-1314.308) * (-1318.049) [-1311.385] (-1315.003) (-1328.041) -- 0:02:36
454500 -- [-1325.899] (-1315.585) (-1323.583) (-1318.079) * (-1317.319) (-1314.987) (-1320.284) [-1319.039] -- 0:02:36
455000 -- [-1321.661] (-1330.272) (-1323.001) (-1320.253) * (-1328.158) [-1320.504] (-1316.111) (-1321.625) -- 0:02:35
Average standard deviation of split frequencies: 0.009547
455500 -- [-1320.368] (-1327.965) (-1329.802) (-1316.977) * (-1318.431) (-1325.547) [-1313.256] (-1319.285) -- 0:02:35
456000 -- [-1318.354] (-1325.977) (-1314.016) (-1327.298) * (-1318.001) (-1328.670) [-1311.625] (-1324.010) -- 0:02:35
456500 -- [-1316.344] (-1327.585) (-1315.255) (-1323.427) * (-1312.525) (-1322.695) (-1316.047) [-1319.438] -- 0:02:34
457000 -- (-1316.800) (-1338.833) [-1312.579] (-1323.910) * (-1332.254) (-1318.218) [-1314.079] (-1330.722) -- 0:02:35
457500 -- [-1311.198] (-1322.788) (-1316.741) (-1321.172) * (-1321.612) (-1333.441) (-1321.804) [-1333.487] -- 0:02:35
458000 -- (-1317.674) (-1319.974) [-1315.946] (-1323.569) * (-1316.089) (-1328.524) [-1318.310] (-1314.879) -- 0:02:35
458500 -- (-1315.393) [-1331.540] (-1319.505) (-1333.240) * [-1320.446] (-1317.937) (-1310.802) (-1318.291) -- 0:02:34
459000 -- [-1313.266] (-1322.757) (-1323.670) (-1326.386) * (-1324.710) (-1331.359) [-1314.684] (-1319.770) -- 0:02:34
459500 -- [-1311.170] (-1323.226) (-1329.504) (-1322.430) * (-1324.573) (-1314.717) (-1327.285) [-1314.726] -- 0:02:34
460000 -- (-1318.046) (-1321.091) (-1318.280) [-1319.075] * (-1320.632) (-1325.988) (-1326.303) [-1315.426] -- 0:02:34
Average standard deviation of split frequencies: 0.009210
460500 -- (-1315.468) (-1319.012) (-1318.055) [-1318.925] * (-1324.215) (-1318.494) (-1318.057) [-1312.867] -- 0:02:34
461000 -- [-1328.556] (-1312.312) (-1314.280) (-1318.282) * [-1316.359] (-1314.426) (-1319.401) (-1323.652) -- 0:02:34
461500 -- (-1321.161) (-1321.118) [-1312.135] (-1324.186) * (-1324.711) (-1319.757) (-1322.078) [-1317.349] -- 0:02:34
462000 -- (-1313.338) (-1331.404) [-1321.836] (-1317.331) * (-1321.866) (-1330.369) [-1314.158] (-1320.060) -- 0:02:33
462500 -- [-1312.993] (-1324.681) (-1329.727) (-1317.420) * (-1312.254) (-1315.616) (-1316.258) [-1314.398] -- 0:02:33
463000 -- (-1316.452) (-1332.233) (-1323.126) [-1309.220] * (-1318.690) [-1316.918] (-1313.905) (-1315.732) -- 0:02:34
463500 -- (-1316.501) (-1320.221) [-1313.565] (-1318.771) * (-1313.283) (-1324.677) [-1319.038] (-1326.503) -- 0:02:33
464000 -- (-1314.013) (-1325.658) (-1315.515) [-1315.101] * (-1314.768) (-1320.727) (-1317.714) [-1314.005] -- 0:02:33
464500 -- (-1321.189) (-1325.326) [-1313.419] (-1328.429) * (-1316.570) [-1315.243] (-1328.377) (-1314.973) -- 0:02:33
465000 -- [-1313.008] (-1329.303) (-1312.523) (-1319.119) * [-1312.943] (-1314.282) (-1319.613) (-1322.200) -- 0:02:33
Average standard deviation of split frequencies: 0.009223
465500 -- (-1315.613) (-1323.510) (-1326.576) [-1311.797] * (-1319.689) [-1319.078] (-1322.361) (-1321.202) -- 0:02:33
466000 -- (-1319.653) (-1322.184) (-1323.274) [-1308.659] * (-1336.463) [-1321.491] (-1319.785) (-1318.501) -- 0:02:33
466500 -- (-1320.591) (-1328.667) (-1318.430) [-1312.827] * (-1331.898) (-1324.359) (-1319.688) [-1321.275] -- 0:02:33
467000 -- (-1320.266) (-1327.489) (-1323.756) [-1312.957] * (-1317.511) (-1326.224) [-1310.489] (-1323.193) -- 0:02:32
467500 -- (-1326.171) [-1317.274] (-1337.319) (-1320.536) * (-1312.278) (-1329.386) [-1313.165] (-1323.793) -- 0:02:32
468000 -- (-1316.848) (-1314.113) (-1317.209) [-1312.558] * (-1314.448) (-1321.690) (-1321.778) [-1318.170] -- 0:02:32
468500 -- (-1320.217) (-1327.090) (-1319.886) [-1318.351] * (-1333.069) [-1318.345] (-1315.889) (-1322.704) -- 0:02:33
469000 -- [-1317.386] (-1320.006) (-1322.193) (-1312.285) * (-1329.755) (-1317.352) [-1316.260] (-1320.873) -- 0:02:32
469500 -- (-1313.399) (-1327.901) (-1314.993) [-1311.790] * (-1322.520) (-1324.492) (-1319.838) [-1320.813] -- 0:02:32
470000 -- (-1328.650) [-1318.018] (-1325.357) (-1326.253) * (-1320.790) (-1325.200) (-1316.060) [-1312.868] -- 0:02:32
Average standard deviation of split frequencies: 0.010141
470500 -- (-1313.729) (-1318.520) (-1334.315) [-1309.807] * (-1325.200) (-1319.278) [-1320.690] (-1317.827) -- 0:02:31
471000 -- (-1321.541) (-1318.971) (-1331.471) [-1311.169] * (-1325.668) (-1315.919) (-1335.253) [-1315.421] -- 0:02:31
471500 -- [-1315.133] (-1327.389) (-1318.240) (-1314.198) * (-1320.586) (-1322.935) (-1323.599) [-1310.866] -- 0:02:31
472000 -- (-1324.153) (-1319.204) (-1318.931) [-1319.048] * (-1320.084) (-1317.768) [-1319.340] (-1318.144) -- 0:02:32
472500 -- (-1315.244) (-1322.965) [-1317.352] (-1324.315) * (-1316.386) [-1317.870] (-1312.443) (-1313.094) -- 0:02:31
473000 -- (-1312.634) (-1317.811) [-1320.020] (-1338.527) * (-1314.807) (-1323.886) (-1326.869) [-1323.773] -- 0:02:31
473500 -- [-1313.120] (-1318.530) (-1315.258) (-1329.615) * [-1315.047] (-1322.382) (-1319.301) (-1318.766) -- 0:02:31
474000 -- (-1318.583) [-1315.490] (-1320.027) (-1317.894) * [-1316.639] (-1317.913) (-1329.690) (-1324.570) -- 0:02:30
474500 -- [-1312.267] (-1320.955) (-1323.071) (-1330.540) * (-1329.039) (-1316.745) [-1316.922] (-1319.956) -- 0:02:30
475000 -- [-1317.657] (-1325.624) (-1315.786) (-1322.608) * (-1318.640) [-1313.165] (-1340.899) (-1314.979) -- 0:02:30
Average standard deviation of split frequencies: 0.008913
475500 -- [-1318.272] (-1326.577) (-1320.205) (-1315.460) * (-1318.056) [-1320.567] (-1331.793) (-1317.102) -- 0:02:31
476000 -- (-1319.843) [-1318.092] (-1311.440) (-1323.193) * [-1317.750] (-1317.426) (-1323.479) (-1320.232) -- 0:02:30
476500 -- (-1315.617) (-1316.219) (-1314.375) [-1316.844] * (-1319.095) (-1324.846) (-1326.353) [-1315.252] -- 0:02:30
477000 -- (-1326.276) (-1325.878) [-1312.950] (-1324.359) * [-1317.644] (-1312.459) (-1329.650) (-1317.616) -- 0:02:30
477500 -- (-1318.808) [-1318.334] (-1314.215) (-1316.469) * [-1310.813] (-1324.486) (-1319.045) (-1317.246) -- 0:02:29
478000 -- (-1309.453) (-1314.253) (-1316.204) [-1314.150] * (-1317.795) (-1331.400) [-1317.666] (-1316.182) -- 0:02:30
478500 -- [-1321.267] (-1323.192) (-1324.823) (-1316.271) * (-1315.394) (-1312.321) (-1318.837) [-1319.524] -- 0:02:30
479000 -- (-1324.508) (-1323.909) (-1326.941) [-1312.116] * (-1323.493) (-1321.901) [-1320.856] (-1320.586) -- 0:02:30
479500 -- [-1319.628] (-1316.952) (-1329.173) (-1317.890) * (-1321.663) (-1338.284) (-1325.530) [-1313.172] -- 0:02:29
480000 -- [-1322.484] (-1328.131) (-1312.384) (-1316.436) * (-1314.586) [-1325.943] (-1322.875) (-1320.222) -- 0:02:29
Average standard deviation of split frequencies: 0.009991
480500 -- [-1321.811] (-1325.807) (-1315.074) (-1330.579) * (-1317.850) (-1325.704) [-1315.279] (-1318.067) -- 0:02:29
481000 -- (-1328.626) (-1322.135) [-1317.602] (-1323.557) * (-1316.232) [-1327.084] (-1313.127) (-1317.725) -- 0:02:28
481500 -- (-1323.979) (-1318.191) [-1314.717] (-1315.398) * (-1325.090) (-1326.497) [-1311.105] (-1315.527) -- 0:02:29
482000 -- (-1327.895) [-1327.165] (-1317.051) (-1323.707) * (-1317.847) (-1322.808) [-1319.695] (-1335.525) -- 0:02:29
482500 -- (-1318.054) (-1326.432) (-1328.212) [-1311.833] * (-1328.874) (-1318.639) (-1312.084) [-1323.724] -- 0:02:29
483000 -- [-1315.874] (-1312.274) (-1319.047) (-1315.606) * (-1314.551) (-1320.184) [-1321.030] (-1317.086) -- 0:02:28
483500 -- (-1320.912) (-1329.084) (-1327.930) [-1312.021] * [-1318.190] (-1318.611) (-1321.529) (-1320.093) -- 0:02:28
484000 -- (-1314.458) (-1341.089) [-1314.645] (-1314.240) * (-1318.775) (-1313.795) [-1308.338] (-1325.125) -- 0:02:28
484500 -- (-1324.495) (-1331.411) (-1316.297) [-1319.759] * [-1311.166] (-1317.536) (-1315.718) (-1325.400) -- 0:02:27
485000 -- [-1315.276] (-1324.772) (-1318.016) (-1328.190) * (-1322.276) [-1320.922] (-1318.722) (-1318.663) -- 0:02:28
Average standard deviation of split frequencies: 0.009700
485500 -- (-1323.560) (-1325.506) (-1320.796) [-1315.218] * [-1320.287] (-1319.656) (-1315.719) (-1318.008) -- 0:02:28
486000 -- [-1315.198] (-1323.062) (-1321.338) (-1325.044) * (-1320.177) (-1323.604) (-1315.350) [-1316.465] -- 0:02:28
486500 -- (-1332.775) [-1322.677] (-1327.140) (-1312.081) * (-1319.662) (-1320.396) (-1318.522) [-1314.235] -- 0:02:27
487000 -- [-1323.730] (-1327.188) (-1313.310) (-1320.742) * [-1311.979] (-1322.624) (-1324.349) (-1316.891) -- 0:02:27
487500 -- [-1313.339] (-1328.034) (-1329.059) (-1322.777) * (-1321.479) (-1313.821) (-1330.198) [-1320.843] -- 0:02:27
488000 -- (-1313.395) [-1319.476] (-1319.174) (-1328.051) * (-1321.459) (-1336.588) [-1327.264] (-1325.132) -- 0:02:26
488500 -- (-1317.354) (-1322.531) (-1319.665) [-1314.300] * (-1328.213) (-1315.322) [-1321.524] (-1333.672) -- 0:02:27
489000 -- (-1323.475) (-1333.245) (-1317.240) [-1320.096] * (-1330.324) (-1315.610) (-1320.724) [-1323.541] -- 0:02:27
489500 -- [-1315.026] (-1321.317) (-1330.297) (-1320.304) * (-1330.381) (-1317.717) (-1322.856) [-1313.230] -- 0:02:27
490000 -- (-1323.645) [-1319.064] (-1325.739) (-1320.564) * (-1317.774) [-1317.922] (-1328.007) (-1319.315) -- 0:02:26
Average standard deviation of split frequencies: 0.010148
490500 -- (-1315.917) (-1326.882) [-1327.858] (-1322.755) * (-1320.263) (-1316.620) [-1314.230] (-1318.200) -- 0:02:26
491000 -- (-1319.502) (-1323.580) [-1320.674] (-1336.155) * (-1320.286) [-1319.795] (-1322.427) (-1319.967) -- 0:02:26
491500 -- [-1315.249] (-1315.639) (-1324.394) (-1316.894) * (-1318.197) [-1315.911] (-1319.284) (-1320.242) -- 0:02:25
492000 -- [-1329.146] (-1326.259) (-1318.815) (-1323.520) * [-1318.201] (-1327.970) (-1310.678) (-1319.454) -- 0:02:26
492500 -- [-1313.931] (-1325.426) (-1319.625) (-1320.692) * (-1314.628) (-1317.638) (-1349.509) [-1318.894] -- 0:02:26
493000 -- [-1312.329] (-1312.745) (-1326.561) (-1319.624) * (-1315.850) (-1327.951) (-1323.624) [-1314.625] -- 0:02:26
493500 -- (-1315.767) (-1330.044) (-1325.792) [-1314.194] * (-1329.438) (-1316.033) (-1336.715) [-1319.436] -- 0:02:25
494000 -- (-1315.647) [-1319.076] (-1326.606) (-1322.449) * (-1326.240) [-1325.349] (-1315.297) (-1310.981) -- 0:02:25
494500 -- (-1314.312) (-1320.946) (-1323.873) [-1318.146] * (-1318.190) (-1332.313) (-1318.282) [-1309.151] -- 0:02:25
495000 -- (-1311.932) (-1315.728) (-1322.569) [-1317.187] * (-1319.160) (-1320.789) [-1312.100] (-1318.545) -- 0:02:24
Average standard deviation of split frequencies: 0.010276
495500 -- (-1323.256) (-1313.374) [-1313.472] (-1329.128) * (-1319.031) (-1318.338) (-1323.164) [-1324.098] -- 0:02:25
496000 -- (-1319.227) (-1325.328) [-1313.854] (-1328.276) * (-1338.912) (-1316.043) (-1313.193) [-1329.552] -- 0:02:25
496500 -- (-1312.338) [-1319.785] (-1310.792) (-1316.215) * [-1318.563] (-1326.080) (-1308.412) (-1319.505) -- 0:02:25
497000 -- [-1312.356] (-1321.085) (-1323.947) (-1326.534) * [-1314.297] (-1321.876) (-1318.173) (-1319.703) -- 0:02:24
497500 -- (-1317.198) (-1316.358) (-1320.091) [-1316.162] * (-1325.535) [-1317.018] (-1322.360) (-1328.256) -- 0:02:24
498000 -- (-1318.627) (-1319.047) [-1318.135] (-1321.929) * [-1318.599] (-1313.890) (-1338.266) (-1333.364) -- 0:02:24
498500 -- (-1323.865) [-1320.931] (-1327.751) (-1329.731) * (-1321.647) (-1316.601) [-1314.017] (-1320.350) -- 0:02:23
499000 -- (-1318.124) (-1315.708) (-1318.971) [-1322.092] * (-1320.834) [-1317.306] (-1311.571) (-1325.015) -- 0:02:24
499500 -- (-1320.229) (-1325.256) (-1318.003) [-1311.161] * (-1319.742) (-1306.777) [-1310.074] (-1321.210) -- 0:02:24
500000 -- (-1325.127) (-1315.785) (-1319.271) [-1313.926] * (-1326.010) (-1317.967) [-1326.987] (-1321.047) -- 0:02:24
Average standard deviation of split frequencies: 0.010181
500500 -- (-1331.167) [-1312.071] (-1322.164) (-1323.991) * (-1316.606) (-1323.958) (-1321.075) [-1317.959] -- 0:02:23
501000 -- (-1319.629) (-1314.666) [-1317.285] (-1323.551) * (-1318.047) (-1316.174) (-1317.785) [-1322.886] -- 0:02:23
501500 -- (-1320.040) (-1315.699) [-1310.513] (-1322.007) * (-1321.409) [-1314.265] (-1322.118) (-1316.494) -- 0:02:23
502000 -- (-1312.847) [-1317.199] (-1323.929) (-1312.072) * (-1324.530) (-1312.990) (-1317.247) [-1320.348] -- 0:02:22
502500 -- (-1324.124) [-1322.472] (-1318.573) (-1323.414) * [-1316.528] (-1317.523) (-1318.839) (-1319.424) -- 0:02:23
503000 -- (-1316.528) (-1319.687) (-1330.710) [-1320.315] * (-1313.652) (-1318.559) [-1320.529] (-1318.092) -- 0:02:23
503500 -- [-1315.034] (-1315.808) (-1318.470) (-1323.828) * (-1318.777) (-1317.430) [-1315.160] (-1330.903) -- 0:02:22
504000 -- (-1326.137) [-1314.094] (-1324.927) (-1317.122) * (-1311.585) [-1313.438] (-1331.644) (-1321.574) -- 0:02:22
504500 -- (-1319.716) (-1319.606) (-1329.520) [-1313.704] * (-1315.329) [-1316.355] (-1318.701) (-1312.445) -- 0:02:22
505000 -- (-1319.384) (-1317.617) (-1324.508) [-1331.598] * (-1318.946) [-1317.039] (-1319.193) (-1321.083) -- 0:02:22
Average standard deviation of split frequencies: 0.009724
505500 -- (-1321.569) [-1314.153] (-1313.460) (-1324.274) * (-1325.108) (-1322.142) [-1315.710] (-1324.005) -- 0:02:21
506000 -- (-1318.472) [-1325.074] (-1318.902) (-1321.490) * [-1313.901] (-1312.233) (-1323.764) (-1315.672) -- 0:02:21
506500 -- (-1320.144) [-1320.027] (-1320.487) (-1327.246) * (-1312.155) (-1320.890) (-1324.300) [-1312.840] -- 0:02:22
507000 -- (-1315.103) (-1324.277) [-1319.893] (-1327.063) * (-1312.447) (-1313.363) (-1323.075) [-1317.982] -- 0:02:21
507500 -- (-1323.948) [-1312.748] (-1320.771) (-1318.530) * (-1323.034) [-1319.939] (-1318.677) (-1314.695) -- 0:02:21
508000 -- (-1331.237) (-1324.542) (-1313.158) [-1329.432] * (-1312.975) (-1319.650) (-1318.765) [-1310.363] -- 0:02:21
508500 -- (-1328.953) (-1316.481) [-1320.129] (-1336.635) * (-1318.831) [-1315.709] (-1319.401) (-1316.734) -- 0:02:21
509000 -- (-1321.339) (-1324.573) (-1318.771) [-1316.167] * [-1319.564] (-1322.255) (-1324.289) (-1321.610) -- 0:02:20
509500 -- (-1318.228) (-1322.193) (-1322.109) [-1310.368] * (-1319.119) (-1316.302) (-1324.643) [-1321.901] -- 0:02:20
510000 -- (-1318.709) (-1321.901) (-1320.450) [-1318.967] * (-1322.069) (-1316.946) [-1308.312] (-1326.456) -- 0:02:21
Average standard deviation of split frequencies: 0.009808
510500 -- (-1321.884) (-1317.243) [-1321.229] (-1315.430) * (-1317.786) (-1326.975) [-1325.412] (-1328.661) -- 0:02:20
511000 -- (-1330.565) [-1319.299] (-1313.790) (-1317.726) * (-1312.135) [-1323.387] (-1321.961) (-1336.705) -- 0:02:20
511500 -- (-1338.637) (-1319.029) (-1323.628) [-1317.693] * (-1319.800) (-1322.196) [-1318.563] (-1332.643) -- 0:02:20
512000 -- (-1337.452) [-1315.403] (-1326.232) (-1329.100) * [-1320.143] (-1318.634) (-1326.043) (-1316.520) -- 0:02:20
512500 -- (-1336.224) [-1320.917] (-1315.340) (-1324.728) * (-1318.954) [-1325.001] (-1315.499) (-1326.018) -- 0:02:19
513000 -- (-1321.479) [-1323.296] (-1320.668) (-1318.674) * (-1319.302) (-1326.044) (-1317.390) [-1315.043] -- 0:02:20
513500 -- (-1318.514) (-1316.034) [-1317.829] (-1317.331) * [-1312.600] (-1322.471) (-1327.733) (-1323.286) -- 0:02:20
514000 -- [-1326.923] (-1317.277) (-1325.320) (-1322.465) * [-1323.262] (-1317.657) (-1324.632) (-1318.103) -- 0:02:19
514500 -- (-1322.965) [-1310.331] (-1327.235) (-1326.389) * [-1322.757] (-1322.421) (-1319.389) (-1317.187) -- 0:02:19
515000 -- (-1326.988) (-1314.919) (-1318.066) [-1314.011] * (-1316.261) (-1314.410) [-1312.192] (-1322.959) -- 0:02:19
Average standard deviation of split frequencies: 0.008793
515500 -- [-1314.027] (-1319.452) (-1318.436) (-1324.103) * (-1325.512) (-1312.178) (-1324.392) [-1319.988] -- 0:02:19
516000 -- [-1319.926] (-1322.667) (-1317.769) (-1322.814) * (-1323.245) [-1326.169] (-1319.686) (-1325.444) -- 0:02:19
516500 -- (-1316.185) (-1325.965) [-1316.083] (-1329.122) * (-1312.280) (-1312.024) [-1320.046] (-1322.618) -- 0:02:19
517000 -- [-1318.167] (-1312.854) (-1325.357) (-1326.824) * (-1320.940) [-1309.631] (-1313.189) (-1321.087) -- 0:02:19
517500 -- [-1321.648] (-1319.108) (-1324.995) (-1322.983) * [-1307.264] (-1316.288) (-1320.523) (-1326.295) -- 0:02:18
518000 -- (-1310.875) [-1329.635] (-1328.489) (-1317.154) * (-1310.576) [-1320.157] (-1324.196) (-1316.225) -- 0:02:18
518500 -- (-1320.892) (-1312.879) (-1318.824) [-1318.474] * [-1318.008] (-1330.258) (-1319.135) (-1310.152) -- 0:02:19
519000 -- [-1322.700] (-1314.925) (-1317.986) (-1316.138) * (-1308.138) [-1319.622] (-1326.903) (-1319.237) -- 0:02:19
519500 -- [-1313.982] (-1319.313) (-1309.145) (-1323.870) * (-1319.676) (-1326.754) (-1329.684) [-1310.813] -- 0:02:18
520000 -- [-1314.811] (-1320.956) (-1315.776) (-1327.122) * (-1328.690) (-1323.918) (-1321.739) [-1314.526] -- 0:02:18
Average standard deviation of split frequencies: 0.008997
520500 -- (-1317.708) (-1322.292) [-1313.564] (-1312.841) * (-1310.668) [-1311.168] (-1332.278) (-1313.245) -- 0:02:18
521000 -- (-1318.906) (-1321.783) [-1317.707] (-1322.430) * (-1311.101) (-1322.082) [-1321.607] (-1322.582) -- 0:02:17
521500 -- (-1317.551) [-1322.810] (-1322.525) (-1323.250) * [-1327.929] (-1316.947) (-1330.821) (-1319.122) -- 0:02:18
522000 -- (-1330.426) (-1321.895) [-1314.366] (-1325.604) * [-1318.274] (-1315.076) (-1326.732) (-1314.630) -- 0:02:18
522500 -- (-1311.524) (-1318.001) [-1325.359] (-1324.537) * [-1314.281] (-1314.387) (-1323.268) (-1322.595) -- 0:02:17
523000 -- [-1322.826] (-1325.764) (-1317.461) (-1317.907) * (-1317.066) (-1321.369) [-1308.051] (-1315.586) -- 0:02:17
523500 -- [-1312.771] (-1316.051) (-1322.320) (-1321.130) * [-1329.549] (-1322.889) (-1315.457) (-1321.339) -- 0:02:17
524000 -- (-1318.289) (-1331.164) [-1313.884] (-1321.441) * [-1318.092] (-1317.460) (-1316.237) (-1323.735) -- 0:02:17
524500 -- (-1331.296) (-1313.168) [-1322.288] (-1325.203) * [-1312.312] (-1322.556) (-1324.238) (-1325.611) -- 0:02:17
525000 -- (-1318.259) (-1315.583) (-1324.294) [-1313.592] * (-1316.765) (-1323.225) (-1333.255) [-1308.956] -- 0:02:17
Average standard deviation of split frequencies: 0.009298
525500 -- (-1320.729) (-1317.679) (-1320.218) [-1313.410] * [-1315.479] (-1314.253) (-1322.686) (-1323.461) -- 0:02:17
526000 -- (-1324.706) [-1313.073] (-1321.286) (-1333.695) * (-1318.054) [-1314.866] (-1312.080) (-1333.273) -- 0:02:16
526500 -- (-1324.005) (-1328.679) [-1313.318] (-1320.592) * (-1318.805) (-1325.869) [-1324.305] (-1315.404) -- 0:02:16
527000 -- (-1325.549) [-1312.428] (-1313.255) (-1330.246) * (-1316.744) (-1327.216) [-1313.823] (-1327.336) -- 0:02:16
527500 -- [-1320.227] (-1322.487) (-1320.376) (-1329.287) * (-1323.930) (-1325.502) (-1316.176) [-1322.099] -- 0:02:17
528000 -- (-1318.676) (-1319.626) [-1323.844] (-1322.269) * [-1312.395] (-1322.286) (-1314.781) (-1325.856) -- 0:02:16
528500 -- [-1313.330] (-1323.130) (-1333.582) (-1314.088) * (-1320.163) (-1323.123) (-1319.403) [-1323.810] -- 0:02:16
529000 -- (-1314.197) [-1321.960] (-1314.814) (-1322.566) * [-1313.317] (-1321.358) (-1314.248) (-1324.541) -- 0:02:16
529500 -- [-1314.066] (-1322.397) (-1323.972) (-1315.664) * (-1310.414) (-1326.281) [-1321.521] (-1321.711) -- 0:02:15
530000 -- (-1326.828) [-1315.256] (-1317.629) (-1321.461) * (-1326.539) (-1318.805) [-1309.816] (-1328.564) -- 0:02:15
Average standard deviation of split frequencies: 0.009383
530500 -- (-1320.245) [-1318.866] (-1339.387) (-1335.337) * (-1329.799) (-1317.541) [-1321.289] (-1315.023) -- 0:02:15
531000 -- [-1314.414] (-1318.330) (-1319.494) (-1317.879) * [-1311.067] (-1319.755) (-1325.787) (-1322.723) -- 0:02:16
531500 -- (-1328.012) [-1312.117] (-1310.568) (-1331.924) * (-1318.894) [-1323.846] (-1313.439) (-1326.972) -- 0:02:15
532000 -- (-1320.716) (-1311.096) (-1317.219) [-1315.338] * (-1321.029) (-1331.605) (-1322.302) [-1326.066] -- 0:02:15
532500 -- (-1316.616) (-1327.571) [-1309.960] (-1317.114) * (-1320.447) [-1318.894] (-1318.617) (-1313.113) -- 0:02:15
533000 -- (-1329.551) (-1325.132) [-1310.416] (-1321.455) * [-1315.670] (-1326.610) (-1318.342) (-1319.168) -- 0:02:14
533500 -- (-1315.794) (-1322.644) (-1314.197) [-1319.881] * (-1317.614) (-1315.252) [-1318.855] (-1323.933) -- 0:02:15
534000 -- (-1324.876) (-1323.845) [-1320.929] (-1330.315) * (-1320.567) (-1321.585) (-1321.540) [-1316.844] -- 0:02:15
534500 -- [-1312.549] (-1326.735) (-1326.535) (-1319.393) * (-1314.337) [-1315.567] (-1317.804) (-1323.248) -- 0:02:14
535000 -- [-1314.897] (-1328.800) (-1315.168) (-1322.037) * [-1313.067] (-1312.539) (-1328.820) (-1321.425) -- 0:02:14
Average standard deviation of split frequencies: 0.009235
535500 -- (-1318.619) (-1323.293) (-1312.521) [-1321.053] * (-1311.269) (-1326.313) (-1312.937) [-1322.854] -- 0:02:14
536000 -- (-1331.103) (-1320.508) (-1326.739) [-1329.510] * (-1307.840) (-1321.443) [-1318.207] (-1321.777) -- 0:02:15
536500 -- [-1328.364] (-1315.489) (-1325.029) (-1313.454) * [-1316.949] (-1317.781) (-1332.554) (-1324.961) -- 0:02:14
537000 -- (-1323.133) (-1323.198) [-1314.180] (-1313.268) * [-1322.471] (-1319.825) (-1323.589) (-1318.190) -- 0:02:14
537500 -- (-1332.632) (-1314.419) [-1312.807] (-1308.706) * (-1321.520) (-1319.568) [-1325.942] (-1322.971) -- 0:02:14
538000 -- (-1321.637) (-1324.054) [-1314.369] (-1308.551) * (-1318.881) [-1310.886] (-1317.089) (-1315.730) -- 0:02:13
538500 -- (-1320.984) (-1322.048) [-1315.287] (-1313.957) * (-1316.141) [-1310.504] (-1321.253) (-1320.896) -- 0:02:13
539000 -- (-1322.043) (-1320.954) (-1330.703) [-1333.965] * [-1316.116] (-1311.257) (-1314.778) (-1317.658) -- 0:02:13
539500 -- (-1324.008) (-1322.835) [-1316.940] (-1314.838) * [-1313.654] (-1314.598) (-1311.532) (-1322.782) -- 0:02:14
540000 -- (-1311.942) (-1317.000) [-1314.151] (-1317.747) * (-1319.486) [-1320.365] (-1310.838) (-1318.522) -- 0:02:13
Average standard deviation of split frequencies: 0.008828
540500 -- (-1326.661) (-1325.773) (-1318.495) [-1320.358] * (-1323.275) (-1317.976) [-1310.759] (-1316.144) -- 0:02:13
541000 -- (-1328.518) [-1317.377] (-1320.664) (-1323.721) * (-1329.823) [-1315.733] (-1312.206) (-1324.907) -- 0:02:13
541500 -- (-1317.533) (-1318.997) (-1322.724) [-1320.926] * (-1327.716) (-1323.030) [-1309.867] (-1315.327) -- 0:02:12
542000 -- [-1317.076] (-1319.431) (-1313.485) (-1316.275) * [-1313.762] (-1313.525) (-1313.370) (-1319.785) -- 0:02:12
542500 -- [-1318.500] (-1325.406) (-1321.842) (-1324.997) * (-1330.861) [-1313.374] (-1311.960) (-1316.311) -- 0:02:12
543000 -- (-1319.382) (-1324.472) [-1321.408] (-1329.161) * [-1324.195] (-1331.564) (-1314.861) (-1315.399) -- 0:02:12
543500 -- (-1316.720) [-1319.591] (-1317.575) (-1316.011) * (-1315.768) [-1311.915] (-1323.399) (-1318.164) -- 0:02:12
544000 -- (-1319.953) (-1327.923) [-1315.563] (-1321.879) * (-1316.551) [-1316.998] (-1330.712) (-1316.730) -- 0:02:12
544500 -- [-1315.790] (-1319.596) (-1315.514) (-1319.475) * (-1325.562) [-1311.053] (-1329.677) (-1316.023) -- 0:02:12
545000 -- (-1316.186) [-1307.174] (-1320.521) (-1327.254) * [-1314.793] (-1317.621) (-1324.193) (-1313.476) -- 0:02:11
Average standard deviation of split frequencies: 0.009040
545500 -- (-1320.721) [-1311.324] (-1315.778) (-1319.169) * (-1325.262) (-1330.910) [-1320.754] (-1315.952) -- 0:02:12
546000 -- (-1316.788) (-1325.075) [-1317.696] (-1321.267) * (-1316.968) [-1316.424] (-1320.513) (-1315.734) -- 0:02:12
546500 -- (-1322.763) (-1325.448) [-1308.353] (-1315.494) * (-1320.732) [-1314.260] (-1330.764) (-1315.564) -- 0:02:11
547000 -- (-1320.431) (-1315.491) (-1326.702) [-1326.103] * (-1325.086) [-1313.357] (-1320.592) (-1324.561) -- 0:02:11
547500 -- (-1333.294) [-1312.352] (-1332.271) (-1326.895) * [-1309.820] (-1324.725) (-1326.836) (-1321.750) -- 0:02:11
548000 -- (-1327.902) [-1309.377] (-1322.136) (-1328.764) * (-1315.503) (-1320.719) [-1314.434] (-1319.192) -- 0:02:11
548500 -- (-1332.511) (-1319.950) [-1324.350] (-1332.233) * [-1322.899] (-1312.369) (-1316.952) (-1325.493) -- 0:02:11
549000 -- [-1319.516] (-1321.136) (-1330.298) (-1321.314) * (-1320.665) (-1314.075) [-1315.416] (-1328.179) -- 0:02:11
549500 -- (-1316.429) [-1318.537] (-1314.753) (-1312.221) * [-1318.242] (-1325.456) (-1316.682) (-1326.917) -- 0:02:11
550000 -- (-1322.586) (-1320.068) (-1327.958) [-1318.152] * (-1321.487) (-1316.493) [-1311.786] (-1316.529) -- 0:02:10
Average standard deviation of split frequencies: 0.008762
550500 -- (-1318.039) [-1325.602] (-1327.114) (-1321.135) * (-1318.854) (-1325.862) [-1324.077] (-1319.208) -- 0:02:10
551000 -- (-1328.864) (-1320.151) [-1311.672] (-1327.213) * (-1324.777) (-1312.370) [-1313.999] (-1333.731) -- 0:02:10
551500 -- (-1317.692) (-1320.328) [-1315.957] (-1312.762) * [-1316.417] (-1325.267) (-1321.921) (-1320.985) -- 0:02:10
552000 -- (-1321.771) (-1319.155) [-1321.145] (-1323.432) * (-1322.235) (-1318.571) (-1323.759) [-1317.533] -- 0:02:10
552500 -- (-1313.651) [-1325.993] (-1325.440) (-1333.232) * (-1320.233) (-1320.161) (-1320.857) [-1314.190] -- 0:02:10
553000 -- [-1312.947] (-1318.639) (-1338.156) (-1319.240) * (-1325.109) [-1315.479] (-1332.006) (-1312.268) -- 0:02:10
553500 -- [-1311.839] (-1321.724) (-1318.309) (-1327.799) * (-1333.550) (-1323.017) (-1324.244) [-1316.288] -- 0:02:09
554000 -- [-1312.191] (-1320.219) (-1323.109) (-1315.174) * (-1335.637) (-1318.220) (-1327.088) [-1316.657] -- 0:02:09
554500 -- (-1309.583) (-1321.097) [-1316.528] (-1320.289) * [-1321.164] (-1324.719) (-1322.702) (-1313.613) -- 0:02:10
555000 -- [-1317.179] (-1313.567) (-1327.044) (-1316.106) * (-1318.149) [-1314.289] (-1321.815) (-1311.782) -- 0:02:09
Average standard deviation of split frequencies: 0.009750
555500 -- (-1314.860) (-1326.614) [-1318.484] (-1335.791) * (-1328.195) (-1321.161) (-1326.778) [-1311.864] -- 0:02:09
556000 -- (-1322.118) [-1315.828] (-1326.807) (-1326.097) * (-1320.340) [-1321.014] (-1332.210) (-1318.317) -- 0:02:09
556500 -- (-1320.481) (-1318.215) (-1322.211) [-1324.595] * (-1320.882) (-1320.630) (-1323.720) [-1316.904] -- 0:02:09
557000 -- [-1318.604] (-1315.780) (-1335.415) (-1321.814) * (-1322.714) (-1313.561) (-1321.348) [-1320.286] -- 0:02:08
557500 -- (-1317.949) (-1315.777) (-1329.319) [-1318.838] * (-1338.977) (-1312.739) (-1319.286) [-1320.828] -- 0:02:09
558000 -- [-1315.616] (-1326.318) (-1316.347) (-1318.856) * (-1319.081) (-1322.644) [-1315.485] (-1320.151) -- 0:02:09
558500 -- (-1323.752) [-1312.655] (-1320.693) (-1316.803) * (-1324.212) (-1314.104) (-1320.477) [-1314.666] -- 0:02:08
559000 -- (-1325.008) (-1320.132) (-1323.844) [-1322.916] * (-1322.643) [-1317.265] (-1323.775) (-1317.562) -- 0:02:08
559500 -- [-1314.485] (-1317.868) (-1317.142) (-1325.007) * (-1324.938) [-1312.310] (-1332.703) (-1313.081) -- 0:02:08
560000 -- (-1323.247) (-1314.580) [-1323.820] (-1331.992) * (-1324.868) [-1311.836] (-1311.607) (-1324.374) -- 0:02:08
Average standard deviation of split frequencies: 0.009774
560500 -- [-1313.667] (-1336.750) (-1320.139) (-1321.438) * (-1314.965) (-1316.673) (-1322.712) [-1316.415] -- 0:02:08
561000 -- (-1334.323) (-1315.532) [-1312.124] (-1334.117) * (-1324.143) [-1315.923] (-1312.795) (-1316.062) -- 0:02:08
561500 -- (-1324.779) [-1313.698] (-1318.425) (-1329.968) * (-1321.436) (-1318.307) (-1318.745) [-1313.107] -- 0:02:08
562000 -- (-1333.708) [-1321.393] (-1325.788) (-1318.081) * [-1314.043] (-1338.536) (-1327.808) (-1332.073) -- 0:02:07
562500 -- (-1326.777) (-1321.599) (-1317.701) [-1312.018] * (-1321.740) [-1318.793] (-1321.331) (-1318.691) -- 0:02:07
563000 -- (-1319.254) (-1319.910) (-1309.737) [-1317.362] * (-1317.297) (-1321.050) (-1325.520) [-1317.211] -- 0:02:07
563500 -- (-1320.806) (-1322.993) [-1318.599] (-1329.012) * (-1324.833) (-1318.935) (-1314.897) [-1312.428] -- 0:02:07
564000 -- (-1319.648) [-1316.594] (-1316.472) (-1314.170) * (-1318.273) (-1322.638) [-1314.204] (-1313.672) -- 0:02:07
564500 -- (-1325.757) [-1321.995] (-1327.042) (-1321.436) * (-1319.065) (-1322.999) (-1319.646) [-1320.959] -- 0:02:07
565000 -- [-1318.541] (-1323.303) (-1312.098) (-1320.987) * (-1315.155) [-1315.513] (-1316.003) (-1310.414) -- 0:02:07
Average standard deviation of split frequencies: 0.010359
565500 -- (-1323.634) (-1322.429) [-1309.659] (-1322.837) * (-1320.014) [-1310.265] (-1322.206) (-1308.953) -- 0:02:06
566000 -- (-1337.280) (-1319.197) [-1313.480] (-1321.838) * (-1323.625) [-1314.334] (-1324.886) (-1321.354) -- 0:02:06
566500 -- (-1330.421) [-1316.114] (-1331.922) (-1329.950) * (-1319.175) (-1329.867) (-1316.519) [-1318.973] -- 0:02:07
567000 -- [-1319.588] (-1311.218) (-1314.066) (-1315.359) * [-1313.518] (-1325.050) (-1316.855) (-1320.885) -- 0:02:06
567500 -- (-1315.335) (-1312.800) [-1318.714] (-1325.250) * (-1318.954) (-1329.914) [-1314.409] (-1323.243) -- 0:02:06
568000 -- (-1324.255) (-1312.125) (-1319.818) [-1330.775] * (-1319.408) (-1327.567) (-1317.107) [-1322.316] -- 0:02:06
568500 -- [-1320.323] (-1325.530) (-1317.704) (-1321.740) * (-1313.978) (-1326.038) [-1311.714] (-1323.370) -- 0:02:05
569000 -- (-1319.528) (-1327.546) [-1314.564] (-1327.646) * (-1316.859) (-1334.051) (-1323.527) [-1315.265] -- 0:02:05
569500 -- [-1313.793] (-1322.324) (-1335.282) (-1314.704) * (-1324.093) [-1318.083] (-1320.781) (-1322.542) -- 0:02:05
570000 -- (-1316.326) [-1311.995] (-1324.055) (-1321.577) * (-1318.052) [-1314.639] (-1321.441) (-1314.036) -- 0:02:05
Average standard deviation of split frequencies: 0.010481
570500 -- (-1320.174) [-1317.200] (-1317.932) (-1314.764) * (-1321.989) (-1316.620) (-1330.008) [-1313.694] -- 0:02:05
571000 -- [-1311.298] (-1317.565) (-1320.101) (-1319.480) * (-1319.535) [-1318.317] (-1323.733) (-1320.563) -- 0:02:05
571500 -- (-1315.306) (-1329.665) (-1322.460) [-1322.885] * (-1318.962) (-1323.196) [-1310.393] (-1319.087) -- 0:02:05
572000 -- [-1323.327] (-1339.102) (-1317.002) (-1321.457) * (-1327.207) [-1319.131] (-1319.016) (-1327.964) -- 0:02:04
572500 -- (-1315.986) (-1327.973) (-1315.470) [-1320.248] * (-1333.167) (-1317.417) (-1323.048) [-1322.389] -- 0:02:04
573000 -- [-1315.362] (-1326.868) (-1331.562) (-1320.925) * [-1320.914] (-1315.036) (-1330.438) (-1323.693) -- 0:02:04
573500 -- [-1319.657] (-1318.813) (-1329.433) (-1314.641) * [-1319.899] (-1318.810) (-1327.688) (-1329.866) -- 0:02:04
574000 -- [-1318.060] (-1330.922) (-1323.117) (-1321.129) * (-1319.920) [-1316.208] (-1319.517) (-1328.212) -- 0:02:04
574500 -- [-1318.533] (-1323.566) (-1326.675) (-1335.797) * [-1319.345] (-1320.102) (-1320.181) (-1322.280) -- 0:02:04
575000 -- (-1324.767) (-1317.877) (-1317.933) [-1313.831] * (-1328.184) (-1322.366) (-1333.913) [-1313.535] -- 0:02:04
Average standard deviation of split frequencies: 0.010026
575500 -- [-1314.615] (-1330.616) (-1322.349) (-1320.374) * (-1318.333) (-1326.740) [-1317.771] (-1313.466) -- 0:02:03
576000 -- [-1316.287] (-1328.062) (-1324.181) (-1320.766) * [-1321.925] (-1319.633) (-1318.432) (-1322.186) -- 0:02:04
576500 -- (-1313.136) [-1324.437] (-1321.425) (-1316.863) * [-1317.345] (-1313.970) (-1320.851) (-1325.134) -- 0:02:04
577000 -- (-1316.087) [-1320.103] (-1321.886) (-1311.042) * (-1325.882) [-1315.102] (-1330.504) (-1317.697) -- 0:02:03
577500 -- [-1323.676] (-1325.449) (-1322.943) (-1314.073) * [-1320.318] (-1321.984) (-1324.055) (-1323.466) -- 0:02:03
578000 -- (-1326.784) (-1320.742) (-1323.437) [-1316.606] * [-1312.954] (-1317.624) (-1322.976) (-1324.354) -- 0:02:03
578500 -- (-1314.340) [-1311.499] (-1321.770) (-1312.645) * (-1324.816) (-1315.582) (-1316.539) [-1317.249] -- 0:02:03
579000 -- (-1314.562) (-1321.354) (-1326.572) [-1326.522] * [-1314.478] (-1324.058) (-1307.415) (-1320.590) -- 0:02:02
579500 -- (-1327.535) (-1319.150) (-1318.498) [-1311.177] * (-1318.235) (-1323.798) [-1331.293] (-1319.096) -- 0:02:03
580000 -- (-1309.720) (-1329.207) (-1322.241) [-1312.764] * [-1315.149] (-1319.790) (-1316.341) (-1324.992) -- 0:02:03
Average standard deviation of split frequencies: 0.009996
580500 -- [-1315.750] (-1322.276) (-1323.515) (-1316.102) * [-1324.241] (-1322.651) (-1323.001) (-1314.652) -- 0:02:02
581000 -- [-1318.759] (-1320.516) (-1320.807) (-1326.639) * (-1318.010) (-1316.639) (-1320.901) [-1314.941] -- 0:02:02
581500 -- (-1317.279) [-1314.196] (-1330.655) (-1318.747) * (-1315.332) [-1319.892] (-1318.547) (-1322.588) -- 0:02:02
582000 -- (-1316.268) (-1316.143) [-1316.160] (-1318.851) * (-1319.628) (-1327.105) (-1318.048) [-1314.690] -- 0:02:02
582500 -- (-1314.331) (-1316.097) (-1323.700) [-1320.057] * (-1324.280) (-1330.766) (-1321.040) [-1322.499] -- 0:02:02
583000 -- (-1314.217) (-1318.938) (-1320.535) [-1315.615] * (-1325.994) (-1327.405) (-1323.074) [-1319.513] -- 0:02:02
583500 -- [-1312.791] (-1320.657) (-1322.235) (-1313.249) * (-1335.323) (-1339.983) (-1315.716) [-1321.519] -- 0:02:02
584000 -- (-1314.071) (-1323.732) (-1326.269) [-1312.241] * (-1332.278) (-1323.469) (-1327.607) [-1312.476] -- 0:02:01
584500 -- (-1314.640) [-1324.234] (-1320.908) (-1317.766) * (-1333.759) [-1318.458] (-1323.231) (-1320.695) -- 0:02:01
585000 -- (-1322.594) (-1332.454) (-1317.770) [-1313.096] * (-1323.181) (-1319.533) (-1318.684) [-1311.132] -- 0:02:01
Average standard deviation of split frequencies: 0.009503
585500 -- [-1315.081] (-1322.702) (-1315.762) (-1315.019) * (-1329.804) [-1314.961] (-1322.468) (-1312.382) -- 0:02:01
586000 -- (-1324.761) (-1316.599) [-1309.338] (-1315.652) * (-1328.822) [-1317.514] (-1312.140) (-1316.539) -- 0:02:01
586500 -- (-1315.029) (-1332.087) [-1312.887] (-1323.341) * [-1316.395] (-1317.987) (-1325.188) (-1336.387) -- 0:02:01
587000 -- (-1329.032) (-1327.107) (-1312.908) [-1314.394] * [-1317.000] (-1319.239) (-1325.030) (-1325.309) -- 0:02:01
587500 -- (-1316.484) (-1313.410) (-1321.721) [-1314.089] * [-1313.504] (-1317.977) (-1325.889) (-1316.111) -- 0:02:00
588000 -- (-1326.029) [-1315.204] (-1319.843) (-1319.744) * (-1323.358) (-1315.482) [-1311.589] (-1318.204) -- 0:02:00
588500 -- (-1327.074) (-1317.977) [-1314.889] (-1325.530) * (-1313.720) [-1317.088] (-1335.346) (-1323.518) -- 0:02:00
589000 -- (-1326.692) (-1318.077) [-1321.227] (-1318.464) * (-1314.579) (-1313.825) [-1323.793] (-1312.374) -- 0:02:00
589500 -- (-1331.259) [-1315.235] (-1323.186) (-1312.642) * (-1315.927) [-1320.839] (-1330.597) (-1324.323) -- 0:02:00
590000 -- (-1322.790) [-1311.428] (-1334.063) (-1314.819) * (-1315.442) [-1315.185] (-1318.175) (-1322.272) -- 0:02:00
Average standard deviation of split frequencies: 0.009826
590500 -- (-1314.140) [-1317.860] (-1315.155) (-1312.003) * (-1322.405) (-1325.469) [-1312.185] (-1322.549) -- 0:01:59
591000 -- (-1309.597) (-1315.315) [-1316.598] (-1322.797) * (-1323.053) (-1317.237) [-1313.132] (-1315.013) -- 0:01:59
591500 -- [-1311.094] (-1325.710) (-1319.123) (-1321.413) * (-1326.801) [-1318.688] (-1310.943) (-1313.565) -- 0:01:59
592000 -- (-1314.339) (-1326.451) (-1318.457) [-1317.286] * [-1309.272] (-1321.919) (-1317.771) (-1316.150) -- 0:01:59
592500 -- (-1319.424) (-1327.313) (-1324.255) [-1323.560] * [-1317.047] (-1308.754) (-1320.685) (-1312.571) -- 0:01:59
593000 -- (-1326.886) (-1317.367) [-1321.336] (-1314.497) * [-1318.709] (-1319.871) (-1315.900) (-1316.506) -- 0:01:59
593500 -- (-1316.181) (-1334.189) (-1316.194) [-1321.107] * (-1321.860) (-1323.162) [-1320.590] (-1322.041) -- 0:01:59
594000 -- [-1318.303] (-1324.094) (-1327.205) (-1313.850) * (-1317.594) (-1320.931) (-1317.697) [-1319.069] -- 0:01:58
594500 -- (-1327.754) [-1322.473] (-1325.668) (-1316.977) * (-1320.225) (-1335.886) [-1321.153] (-1317.426) -- 0:01:58
595000 -- (-1318.524) (-1316.211) (-1323.098) [-1317.953] * (-1315.667) [-1320.827] (-1316.084) (-1317.428) -- 0:01:59
Average standard deviation of split frequencies: 0.010183
595500 -- (-1318.647) (-1322.673) [-1316.764] (-1319.080) * [-1312.676] (-1324.152) (-1321.155) (-1323.044) -- 0:01:58
596000 -- (-1321.466) (-1321.859) [-1316.924] (-1323.647) * (-1323.274) [-1317.444] (-1328.132) (-1318.325) -- 0:01:58
596500 -- (-1314.551) [-1319.234] (-1336.571) (-1325.580) * (-1314.701) [-1327.077] (-1321.193) (-1320.122) -- 0:01:58
597000 -- (-1329.389) (-1326.168) (-1321.446) [-1321.467] * [-1316.851] (-1320.118) (-1325.134) (-1318.934) -- 0:01:58
597500 -- (-1319.059) (-1331.411) [-1318.624] (-1322.185) * (-1319.847) [-1323.366] (-1321.010) (-1324.148) -- 0:01:57
598000 -- (-1323.399) [-1321.807] (-1325.426) (-1318.759) * [-1324.760] (-1322.599) (-1311.521) (-1324.159) -- 0:01:57
598500 -- (-1316.463) [-1318.702] (-1321.361) (-1322.062) * (-1323.598) (-1321.011) (-1316.100) [-1322.862] -- 0:01:58
599000 -- (-1318.526) (-1325.948) [-1316.802] (-1318.502) * (-1323.878) [-1317.415] (-1316.429) (-1317.663) -- 0:01:57
599500 -- (-1321.516) (-1324.459) [-1311.592] (-1317.127) * [-1330.557] (-1320.244) (-1313.177) (-1327.480) -- 0:01:57
600000 -- (-1326.638) (-1318.049) [-1309.623] (-1312.293) * (-1326.807) (-1317.394) (-1330.822) [-1314.659] -- 0:01:57
Average standard deviation of split frequencies: 0.010251
600500 -- (-1323.123) (-1316.734) (-1315.025) [-1319.268] * (-1330.838) [-1316.780] (-1327.679) (-1315.239) -- 0:01:57
601000 -- (-1314.781) (-1315.706) (-1319.161) [-1319.879] * (-1315.864) [-1311.505] (-1326.643) (-1311.215) -- 0:01:56
601500 -- [-1310.438] (-1315.642) (-1328.060) (-1321.303) * (-1310.104) (-1315.188) [-1309.298] (-1332.442) -- 0:01:56
602000 -- [-1315.679] (-1313.084) (-1317.992) (-1317.407) * [-1313.329] (-1318.225) (-1316.099) (-1319.620) -- 0:01:57
602500 -- (-1322.500) (-1310.043) (-1324.218) [-1314.472] * (-1316.964) [-1311.013] (-1327.751) (-1318.547) -- 0:01:56
603000 -- (-1315.062) (-1323.634) (-1326.510) [-1316.110] * (-1317.645) (-1317.198) [-1317.222] (-1325.653) -- 0:01:56
603500 -- (-1319.766) (-1308.724) [-1316.339] (-1317.376) * (-1326.850) (-1320.533) (-1311.333) [-1316.064] -- 0:01:56
604000 -- (-1318.319) (-1315.645) (-1325.134) [-1314.626] * (-1324.579) (-1319.335) [-1319.036] (-1334.686) -- 0:01:56
604500 -- (-1330.333) [-1312.379] (-1324.195) (-1325.115) * [-1320.894] (-1314.904) (-1319.669) (-1324.749) -- 0:01:55
605000 -- (-1318.332) [-1324.094] (-1316.225) (-1316.297) * (-1311.062) [-1311.663] (-1325.061) (-1322.785) -- 0:01:55
Average standard deviation of split frequencies: 0.010307
605500 -- [-1317.167] (-1323.709) (-1318.619) (-1319.963) * (-1319.412) [-1314.848] (-1325.395) (-1321.556) -- 0:01:55
606000 -- [-1324.864] (-1319.559) (-1322.398) (-1315.184) * (-1317.861) [-1314.439] (-1322.519) (-1323.828) -- 0:01:55
606500 -- [-1319.245] (-1321.225) (-1309.771) (-1319.398) * (-1329.834) (-1325.380) (-1325.183) [-1323.644] -- 0:01:55
607000 -- (-1325.549) (-1315.741) [-1316.124] (-1322.996) * [-1309.029] (-1325.480) (-1317.919) (-1316.585) -- 0:01:55
607500 -- (-1326.187) [-1314.860] (-1324.336) (-1321.637) * (-1316.554) [-1315.580] (-1317.055) (-1312.234) -- 0:01:55
608000 -- [-1323.722] (-1319.086) (-1314.258) (-1316.783) * (-1321.651) [-1314.676] (-1313.689) (-1332.628) -- 0:01:54
608500 -- (-1323.924) [-1315.520] (-1329.833) (-1320.937) * (-1326.143) (-1321.140) [-1318.045] (-1319.281) -- 0:01:54
609000 -- (-1329.244) [-1313.319] (-1319.992) (-1328.209) * (-1322.826) [-1318.511] (-1332.541) (-1319.808) -- 0:01:54
609500 -- (-1319.290) [-1320.076] (-1314.196) (-1316.028) * (-1319.899) (-1325.838) [-1323.422] (-1324.650) -- 0:01:54
610000 -- [-1314.523] (-1312.843) (-1324.562) (-1326.442) * [-1317.289] (-1316.354) (-1326.571) (-1339.685) -- 0:01:54
Average standard deviation of split frequencies: 0.010344
610500 -- [-1316.768] (-1326.559) (-1319.932) (-1322.286) * [-1318.630] (-1322.702) (-1314.870) (-1318.818) -- 0:01:54
611000 -- (-1317.678) [-1327.402] (-1317.292) (-1325.408) * (-1317.798) (-1317.913) (-1318.484) [-1316.819] -- 0:01:53
611500 -- (-1316.157) (-1337.227) [-1324.605] (-1332.568) * (-1325.894) (-1337.111) (-1316.374) [-1322.440] -- 0:01:53
612000 -- (-1323.650) (-1328.009) [-1318.414] (-1324.582) * [-1324.384] (-1328.927) (-1319.969) (-1316.258) -- 0:01:53
612500 -- (-1319.261) [-1316.792] (-1322.841) (-1320.731) * [-1314.459] (-1328.340) (-1321.484) (-1326.153) -- 0:01:53
613000 -- [-1312.427] (-1316.907) (-1328.248) (-1318.032) * [-1320.226] (-1333.140) (-1322.836) (-1313.103) -- 0:01:53
613500 -- (-1316.068) (-1331.711) (-1321.705) [-1329.208] * (-1319.508) (-1324.252) [-1321.720] (-1327.150) -- 0:01:53
614000 -- (-1326.279) (-1322.424) [-1327.365] (-1322.306) * (-1322.189) [-1325.592] (-1324.228) (-1328.873) -- 0:01:53
614500 -- [-1315.027] (-1321.624) (-1325.035) (-1325.301) * (-1320.313) (-1326.328) [-1313.498] (-1320.204) -- 0:01:52
615000 -- [-1310.555] (-1308.627) (-1317.612) (-1327.074) * [-1320.685] (-1329.818) (-1324.530) (-1322.479) -- 0:01:52
Average standard deviation of split frequencies: 0.009805
615500 -- (-1325.641) [-1313.893] (-1329.079) (-1317.730) * [-1316.069] (-1325.010) (-1325.975) (-1339.173) -- 0:01:52
616000 -- (-1326.127) [-1315.053] (-1326.565) (-1320.276) * [-1315.504] (-1326.714) (-1321.083) (-1331.212) -- 0:01:52
616500 -- (-1315.571) (-1323.913) (-1321.849) [-1310.524] * (-1318.543) [-1316.107] (-1321.830) (-1323.622) -- 0:01:52
617000 -- (-1326.410) (-1322.150) (-1323.970) [-1313.676] * (-1324.896) (-1319.944) (-1322.811) [-1319.221] -- 0:01:52
617500 -- [-1316.764] (-1322.154) (-1330.378) (-1318.548) * (-1321.418) [-1323.628] (-1327.563) (-1319.769) -- 0:01:52
618000 -- [-1321.106] (-1317.450) (-1318.630) (-1319.113) * (-1318.847) [-1317.359] (-1324.818) (-1319.855) -- 0:01:51
618500 -- (-1326.073) [-1324.241] (-1324.496) (-1313.239) * [-1317.626] (-1318.187) (-1323.887) (-1320.922) -- 0:01:51
619000 -- [-1316.889] (-1319.142) (-1315.092) (-1321.250) * (-1325.479) (-1329.658) (-1328.643) [-1318.537] -- 0:01:51
619500 -- (-1314.738) [-1322.462] (-1313.568) (-1317.214) * (-1319.423) (-1332.720) [-1317.683] (-1318.321) -- 0:01:51
620000 -- (-1316.883) [-1327.664] (-1323.799) (-1315.910) * (-1311.509) [-1314.669] (-1321.423) (-1321.815) -- 0:01:50
Average standard deviation of split frequencies: 0.010111
620500 -- (-1321.295) (-1331.178) (-1309.281) [-1316.887] * (-1321.659) [-1318.196] (-1319.086) (-1320.505) -- 0:01:51
621000 -- (-1319.079) (-1321.206) [-1312.499] (-1317.401) * (-1323.547) (-1319.089) (-1314.842) [-1318.478] -- 0:01:51
621500 -- [-1324.546] (-1319.061) (-1320.948) (-1322.436) * (-1323.907) (-1313.158) [-1315.650] (-1319.057) -- 0:01:50
622000 -- (-1326.723) (-1324.089) [-1316.507] (-1323.227) * (-1322.523) [-1316.582] (-1331.773) (-1321.005) -- 0:01:50
622500 -- (-1322.178) [-1326.201] (-1319.600) (-1336.513) * (-1328.007) [-1313.140] (-1325.486) (-1309.196) -- 0:01:50
623000 -- (-1317.001) (-1341.547) [-1316.734] (-1331.235) * (-1325.606) (-1313.522) (-1318.606) [-1323.691] -- 0:01:50
623500 -- [-1317.974] (-1329.299) (-1325.652) (-1320.652) * (-1327.075) (-1311.723) (-1318.073) [-1313.567] -- 0:01:49
624000 -- (-1315.892) (-1322.242) (-1329.977) [-1323.393] * (-1321.555) (-1335.913) (-1313.791) [-1314.313] -- 0:01:50
624500 -- (-1316.807) (-1321.357) (-1322.359) [-1316.257] * (-1317.795) (-1320.253) [-1313.564] (-1325.987) -- 0:01:50
625000 -- (-1313.957) (-1314.995) [-1318.849] (-1320.086) * (-1321.937) (-1339.405) [-1315.494] (-1317.962) -- 0:01:49
Average standard deviation of split frequencies: 0.010307
625500 -- (-1325.165) [-1319.914] (-1324.010) (-1321.916) * [-1313.873] (-1317.195) (-1321.433) (-1311.679) -- 0:01:49
626000 -- [-1313.515] (-1320.066) (-1324.811) (-1326.648) * (-1314.631) (-1327.494) [-1320.171] (-1318.890) -- 0:01:49
626500 -- (-1315.197) (-1322.858) (-1322.074) [-1316.597] * [-1325.662] (-1323.028) (-1326.606) (-1327.975) -- 0:01:49
627000 -- (-1336.168) (-1317.549) (-1323.052) [-1314.802] * (-1320.686) [-1319.127] (-1322.782) (-1322.455) -- 0:01:48
627500 -- (-1322.583) [-1316.008] (-1326.162) (-1312.523) * (-1314.000) (-1323.368) [-1318.278] (-1318.657) -- 0:01:49
628000 -- (-1319.609) (-1315.406) [-1315.466] (-1312.006) * (-1317.245) (-1320.831) (-1321.275) [-1318.683] -- 0:01:48
628500 -- (-1319.996) (-1315.526) [-1310.428] (-1319.703) * (-1312.547) [-1316.428] (-1325.093) (-1321.996) -- 0:01:48
629000 -- (-1325.530) (-1320.832) (-1318.192) [-1314.516] * (-1314.792) [-1316.668] (-1325.010) (-1314.661) -- 0:01:48
629500 -- (-1327.621) (-1321.564) (-1313.685) [-1319.444] * (-1320.681) (-1324.358) [-1313.875] (-1323.359) -- 0:01:48
630000 -- [-1318.965] (-1315.348) (-1322.020) (-1321.079) * (-1329.503) (-1314.031) [-1318.389] (-1323.495) -- 0:01:48
Average standard deviation of split frequencies: 0.009811
630500 -- (-1320.453) (-1322.139) (-1317.886) [-1315.284] * (-1341.060) (-1322.076) [-1315.588] (-1329.894) -- 0:01:47
631000 -- (-1324.027) (-1317.039) (-1318.221) [-1322.190] * (-1328.677) (-1318.687) (-1316.759) [-1325.658] -- 0:01:48
631500 -- (-1325.409) (-1323.824) (-1318.397) [-1315.440] * (-1326.485) (-1318.085) [-1311.392] (-1322.246) -- 0:01:47
632000 -- [-1309.688] (-1317.775) (-1322.414) (-1338.959) * (-1320.082) [-1315.184] (-1330.690) (-1324.799) -- 0:01:47
632500 -- (-1317.398) (-1322.534) (-1315.366) [-1322.613] * [-1323.789] (-1328.271) (-1319.715) (-1326.846) -- 0:01:47
633000 -- [-1321.705] (-1328.438) (-1316.444) (-1326.642) * (-1329.337) (-1317.224) (-1325.067) [-1317.365] -- 0:01:47
633500 -- (-1319.324) (-1312.023) [-1318.944] (-1319.661) * (-1324.644) (-1328.663) (-1317.717) [-1330.099] -- 0:01:47
634000 -- (-1326.392) (-1319.132) [-1317.288] (-1324.413) * (-1324.440) [-1310.159] (-1316.974) (-1323.310) -- 0:01:46
634500 -- (-1329.546) [-1315.576] (-1321.989) (-1317.057) * (-1329.771) (-1326.551) (-1307.997) [-1319.749] -- 0:01:47
635000 -- (-1322.777) (-1323.982) [-1307.224] (-1326.730) * (-1312.882) (-1320.612) [-1321.312] (-1318.654) -- 0:01:46
Average standard deviation of split frequencies: 0.009636
635500 -- (-1314.528) (-1316.412) [-1315.406] (-1322.402) * (-1319.637) [-1312.147] (-1315.940) (-1318.766) -- 0:01:46
636000 -- (-1317.582) (-1316.205) [-1322.328] (-1329.425) * (-1316.521) (-1323.394) (-1315.813) [-1311.049] -- 0:01:46
636500 -- (-1325.954) (-1320.020) [-1311.863] (-1331.420) * (-1324.618) [-1324.227] (-1316.531) (-1318.612) -- 0:01:46
637000 -- (-1320.209) (-1312.921) (-1326.268) [-1316.713] * (-1319.414) (-1320.325) (-1313.369) [-1315.491] -- 0:01:45
637500 -- (-1317.935) (-1315.206) (-1318.500) [-1318.800] * (-1312.638) (-1325.973) [-1317.974] (-1323.301) -- 0:01:45
638000 -- (-1319.850) [-1324.989] (-1323.473) (-1327.611) * (-1313.145) (-1317.408) [-1310.810] (-1329.243) -- 0:01:46
638500 -- (-1314.182) (-1314.430) [-1319.604] (-1325.042) * (-1314.579) (-1317.687) [-1313.881] (-1313.278) -- 0:01:45
639000 -- (-1322.399) (-1320.456) (-1334.112) [-1325.276] * (-1316.304) (-1330.069) (-1312.642) [-1316.030] -- 0:01:45
639500 -- (-1320.049) (-1321.009) (-1324.619) [-1315.715] * (-1315.994) (-1323.387) (-1312.928) [-1311.548] -- 0:01:45
640000 -- (-1316.731) (-1324.875) (-1322.728) [-1314.020] * (-1310.242) (-1331.934) (-1327.011) [-1317.318] -- 0:01:45
Average standard deviation of split frequencies: 0.009106
640500 -- [-1316.430] (-1314.093) (-1319.526) (-1315.639) * (-1318.804) [-1323.940] (-1322.858) (-1320.474) -- 0:01:44
641000 -- [-1312.979] (-1317.936) (-1323.432) (-1324.269) * (-1317.536) (-1320.856) (-1314.183) [-1314.312] -- 0:01:45
641500 -- (-1317.006) (-1320.486) [-1316.104] (-1324.845) * (-1320.579) [-1316.046] (-1317.208) (-1320.536) -- 0:01:45
642000 -- (-1316.699) (-1324.928) (-1326.403) [-1314.684] * (-1319.226) (-1325.811) (-1314.304) [-1311.865] -- 0:01:44
642500 -- (-1320.693) (-1320.886) [-1329.882] (-1319.820) * (-1324.044) (-1318.803) [-1314.349] (-1314.792) -- 0:01:44
643000 -- [-1313.996] (-1326.288) (-1330.673) (-1322.446) * (-1322.353) (-1325.298) (-1313.297) [-1317.923] -- 0:01:44
643500 -- [-1320.499] (-1313.744) (-1320.114) (-1326.171) * [-1327.651] (-1325.474) (-1327.569) (-1317.934) -- 0:01:44
644000 -- (-1317.094) (-1322.100) [-1316.980] (-1325.450) * (-1326.400) [-1319.743] (-1319.496) (-1319.784) -- 0:01:43
644500 -- [-1317.160] (-1319.921) (-1318.972) (-1316.093) * (-1326.992) [-1322.127] (-1334.525) (-1315.205) -- 0:01:44
645000 -- [-1314.512] (-1320.710) (-1315.847) (-1325.287) * (-1320.997) [-1311.249] (-1326.713) (-1321.402) -- 0:01:44
Average standard deviation of split frequencies: 0.009486
645500 -- [-1315.855] (-1332.084) (-1316.195) (-1326.565) * (-1309.434) (-1316.126) [-1315.347] (-1322.684) -- 0:01:43
646000 -- [-1319.548] (-1312.941) (-1316.803) (-1320.876) * [-1314.462] (-1335.573) (-1321.607) (-1313.233) -- 0:01:43
646500 -- [-1314.639] (-1324.992) (-1322.178) (-1328.510) * (-1315.415) (-1319.400) [-1319.606] (-1316.478) -- 0:01:43
647000 -- (-1331.214) [-1320.830] (-1331.347) (-1313.776) * (-1318.822) (-1321.830) [-1324.846] (-1325.852) -- 0:01:43
647500 -- (-1317.674) (-1329.911) (-1320.107) [-1310.556] * [-1318.982] (-1324.903) (-1327.287) (-1324.115) -- 0:01:42
648000 -- (-1318.695) (-1322.938) (-1316.619) [-1311.718] * (-1315.284) [-1315.755] (-1330.423) (-1319.753) -- 0:01:42
648500 -- (-1323.897) (-1324.116) (-1314.915) [-1312.728] * (-1315.472) [-1315.040] (-1329.530) (-1316.021) -- 0:01:42
649000 -- [-1315.276] (-1322.162) (-1317.398) (-1321.525) * (-1320.798) (-1315.200) (-1323.898) [-1317.400] -- 0:01:42
649500 -- (-1326.149) (-1318.918) (-1310.836) [-1313.232] * (-1315.623) (-1328.619) [-1312.798] (-1324.495) -- 0:01:42
650000 -- (-1330.742) [-1314.967] (-1320.667) (-1315.836) * (-1319.857) [-1317.562] (-1333.577) (-1318.077) -- 0:01:42
Average standard deviation of split frequencies: 0.010415
650500 -- (-1330.976) (-1324.401) [-1313.724] (-1317.610) * (-1320.424) (-1312.743) [-1320.621] (-1317.646) -- 0:01:42
651000 -- [-1317.823] (-1320.167) (-1318.489) (-1333.245) * (-1329.063) [-1324.567] (-1323.538) (-1326.045) -- 0:01:42
651500 -- (-1325.734) (-1320.615) [-1314.799] (-1315.203) * (-1321.296) [-1325.028] (-1322.479) (-1318.952) -- 0:01:42
652000 -- (-1319.533) (-1323.000) [-1317.507] (-1327.588) * (-1316.271) [-1319.568] (-1326.013) (-1308.324) -- 0:01:41
652500 -- (-1323.509) (-1322.595) (-1323.176) [-1316.253] * (-1319.660) (-1325.315) (-1320.427) [-1311.252] -- 0:01:41
653000 -- (-1326.815) [-1322.017] (-1320.173) (-1320.557) * [-1318.467] (-1314.698) (-1316.952) (-1308.550) -- 0:01:41
653500 -- [-1318.369] (-1306.828) (-1320.516) (-1322.919) * (-1321.662) (-1317.993) [-1316.724] (-1315.789) -- 0:01:41
654000 -- (-1311.875) [-1317.461] (-1315.208) (-1319.270) * (-1325.411) [-1313.361] (-1321.230) (-1319.588) -- 0:01:41
654500 -- [-1308.122] (-1320.660) (-1325.966) (-1319.730) * (-1323.122) [-1319.568] (-1312.209) (-1319.543) -- 0:01:41
655000 -- (-1308.857) (-1336.053) (-1320.679) [-1327.793] * (-1321.338) (-1314.617) [-1323.599] (-1318.537) -- 0:01:41
Average standard deviation of split frequencies: 0.010285
655500 -- (-1314.167) [-1316.355] (-1318.151) (-1319.506) * (-1320.658) [-1314.630] (-1318.902) (-1326.104) -- 0:01:40
656000 -- (-1325.314) (-1312.900) (-1322.004) [-1312.262] * (-1318.112) [-1322.251] (-1319.492) (-1321.135) -- 0:01:40
656500 -- (-1316.664) (-1320.938) (-1325.951) [-1323.038] * (-1321.298) [-1314.575] (-1322.274) (-1318.736) -- 0:01:40
657000 -- (-1319.673) (-1310.607) [-1315.267] (-1325.436) * [-1320.871] (-1313.242) (-1322.515) (-1313.253) -- 0:01:40
657500 -- (-1325.597) [-1312.049] (-1319.285) (-1325.585) * (-1319.912) [-1325.442] (-1328.120) (-1313.062) -- 0:01:40
658000 -- (-1317.735) [-1316.071] (-1330.452) (-1322.760) * (-1317.747) (-1321.104) (-1316.707) [-1318.394] -- 0:01:40
658500 -- (-1328.242) (-1327.409) (-1326.895) [-1313.754] * [-1312.450] (-1317.332) (-1319.735) (-1325.608) -- 0:01:40
659000 -- (-1320.196) (-1316.452) [-1326.974] (-1318.688) * (-1338.605) (-1318.498) [-1312.326] (-1329.325) -- 0:01:40
659500 -- (-1331.179) [-1317.225] (-1318.572) (-1326.993) * (-1324.713) (-1318.634) (-1327.891) [-1315.429] -- 0:01:40
660000 -- (-1320.303) [-1318.928] (-1318.426) (-1315.779) * (-1325.209) (-1324.270) [-1314.778] (-1324.863) -- 0:01:39
Average standard deviation of split frequencies: 0.009811
660500 -- (-1316.796) (-1313.867) [-1318.693] (-1330.984) * [-1323.245] (-1315.094) (-1335.723) (-1327.103) -- 0:01:39
661000 -- [-1318.006] (-1317.517) (-1326.963) (-1321.331) * (-1313.259) [-1313.071] (-1330.377) (-1329.226) -- 0:01:39
661500 -- [-1319.514] (-1320.783) (-1316.891) (-1317.070) * (-1316.228) (-1315.246) [-1318.001] (-1322.569) -- 0:01:39
662000 -- (-1324.402) [-1313.612] (-1319.382) (-1312.999) * (-1321.166) (-1311.890) (-1316.645) [-1307.769] -- 0:01:39
662500 -- (-1320.624) (-1309.264) [-1324.979] (-1328.326) * (-1317.869) [-1318.420] (-1322.395) (-1315.967) -- 0:01:39
663000 -- (-1326.039) [-1319.932] (-1314.274) (-1322.619) * (-1316.858) (-1314.912) [-1317.359] (-1324.933) -- 0:01:39
663500 -- [-1312.575] (-1316.366) (-1313.406) (-1327.088) * (-1322.832) (-1316.581) [-1318.407] (-1321.494) -- 0:01:38
664000 -- (-1320.846) (-1321.240) (-1322.557) [-1319.169] * (-1318.203) (-1318.778) (-1320.925) [-1327.364] -- 0:01:39
664500 -- [-1317.658] (-1318.514) (-1319.489) (-1317.457) * [-1314.083] (-1317.523) (-1315.857) (-1320.431) -- 0:01:38
665000 -- (-1332.255) (-1321.983) [-1322.198] (-1316.494) * [-1310.502] (-1313.146) (-1331.428) (-1317.593) -- 0:01:38
Average standard deviation of split frequencies: 0.009865
665500 -- [-1316.035] (-1321.590) (-1319.805) (-1331.623) * [-1314.574] (-1314.743) (-1314.324) (-1321.346) -- 0:01:38
666000 -- [-1318.024] (-1321.554) (-1318.068) (-1323.861) * (-1316.624) (-1320.592) [-1313.510] (-1326.105) -- 0:01:38
666500 -- (-1310.194) (-1317.317) [-1328.874] (-1320.316) * [-1320.584] (-1315.894) (-1316.580) (-1335.143) -- 0:01:38
667000 -- (-1320.932) [-1310.485] (-1321.329) (-1320.632) * (-1317.422) [-1313.229] (-1320.016) (-1326.749) -- 0:01:38
667500 -- (-1313.528) [-1312.276] (-1323.612) (-1314.877) * [-1309.374] (-1313.316) (-1318.463) (-1311.270) -- 0:01:38
668000 -- (-1318.236) (-1326.560) [-1317.281] (-1316.023) * (-1323.223) (-1314.371) (-1325.419) [-1315.959] -- 0:01:37
668500 -- (-1322.565) (-1320.255) (-1311.483) [-1309.695] * (-1327.432) (-1316.033) [-1322.681] (-1315.262) -- 0:01:37
669000 -- (-1316.662) (-1318.591) [-1312.326] (-1321.017) * [-1322.164] (-1322.564) (-1323.516) (-1316.789) -- 0:01:37
669500 -- (-1317.481) (-1321.883) [-1305.194] (-1325.599) * (-1312.170) [-1315.443] (-1311.817) (-1322.476) -- 0:01:37
670000 -- [-1309.799] (-1326.190) (-1314.181) (-1316.920) * (-1317.643) (-1315.094) (-1309.607) [-1315.189] -- 0:01:37
Average standard deviation of split frequencies: 0.009621
670500 -- (-1308.564) [-1333.662] (-1326.616) (-1330.754) * (-1312.550) (-1325.265) (-1320.212) [-1312.926] -- 0:01:37
671000 -- [-1316.302] (-1320.036) (-1316.981) (-1321.726) * [-1317.847] (-1318.143) (-1319.170) (-1318.106) -- 0:01:37
671500 -- (-1317.192) [-1324.869] (-1325.346) (-1326.224) * [-1316.182] (-1319.589) (-1315.461) (-1312.043) -- 0:01:36
672000 -- (-1317.179) (-1315.266) [-1315.627] (-1326.009) * (-1326.194) (-1319.347) [-1318.612] (-1310.974) -- 0:01:37
672500 -- [-1321.874] (-1326.629) (-1324.157) (-1319.976) * [-1312.263] (-1319.566) (-1317.523) (-1314.361) -- 0:01:36
673000 -- (-1316.812) (-1323.127) (-1316.728) [-1317.170] * (-1312.553) (-1324.468) [-1328.327] (-1318.294) -- 0:01:36
673500 -- (-1323.676) (-1315.131) (-1313.691) [-1312.277] * (-1313.085) [-1321.226] (-1323.551) (-1332.333) -- 0:01:36
674000 -- (-1317.002) [-1319.619] (-1319.292) (-1312.039) * (-1320.987) (-1321.678) [-1325.838] (-1320.369) -- 0:01:36
674500 -- (-1331.184) [-1312.517] (-1331.142) (-1313.604) * (-1325.578) (-1325.472) (-1317.817) [-1318.762] -- 0:01:36
675000 -- (-1316.479) (-1317.667) (-1325.043) [-1317.284] * (-1324.860) [-1323.722] (-1317.560) (-1320.417) -- 0:01:36
Average standard deviation of split frequencies: 0.009371
675500 -- (-1315.545) (-1319.669) (-1331.896) [-1314.167] * (-1321.190) (-1313.015) [-1318.449] (-1322.811) -- 0:01:36
676000 -- (-1318.265) [-1318.697] (-1315.454) (-1312.800) * [-1311.135] (-1322.178) (-1310.959) (-1311.379) -- 0:01:35
676500 -- (-1323.851) (-1327.683) [-1318.090] (-1316.706) * (-1320.503) (-1322.491) (-1315.727) [-1314.747] -- 0:01:35
677000 -- (-1321.673) [-1316.230] (-1323.612) (-1317.979) * [-1312.224] (-1328.715) (-1320.678) (-1315.768) -- 0:01:35
677500 -- (-1331.667) (-1322.497) [-1321.958] (-1324.378) * (-1314.650) (-1327.809) (-1324.694) [-1313.487] -- 0:01:35
678000 -- (-1319.527) (-1314.147) [-1310.599] (-1317.005) * (-1315.020) [-1328.638] (-1314.797) (-1319.956) -- 0:01:34
678500 -- (-1319.238) (-1317.053) [-1313.059] (-1316.924) * [-1310.703] (-1314.740) (-1317.338) (-1312.712) -- 0:01:35
679000 -- (-1321.917) [-1319.728] (-1314.031) (-1321.738) * (-1322.890) (-1312.761) (-1322.171) [-1314.068] -- 0:01:35
679500 -- (-1323.881) (-1321.280) [-1315.043] (-1322.873) * (-1314.578) (-1320.975) (-1338.491) [-1315.562] -- 0:01:34
680000 -- (-1322.900) [-1317.253] (-1321.772) (-1320.843) * (-1314.814) (-1331.647) [-1315.603] (-1318.075) -- 0:01:34
Average standard deviation of split frequencies: 0.009696
680500 -- [-1316.008] (-1320.951) (-1329.563) (-1322.083) * (-1316.780) (-1326.298) [-1310.315] (-1317.023) -- 0:01:34
681000 -- [-1314.800] (-1320.672) (-1321.083) (-1321.330) * (-1323.419) (-1313.727) (-1317.293) [-1315.395] -- 0:01:34
681500 -- (-1328.265) (-1321.795) [-1325.547] (-1317.984) * (-1318.981) (-1320.260) (-1322.665) [-1319.307] -- 0:01:33
682000 -- (-1313.149) [-1316.377] (-1327.384) (-1317.109) * (-1317.302) [-1318.509] (-1316.005) (-1318.012) -- 0:01:33
682500 -- [-1312.910] (-1313.753) (-1316.916) (-1315.839) * (-1321.901) [-1320.065] (-1316.626) (-1320.180) -- 0:01:33
683000 -- (-1321.527) (-1322.939) [-1313.857] (-1318.929) * (-1315.899) (-1311.510) (-1316.273) [-1317.862] -- 0:01:33
683500 -- [-1317.822] (-1323.172) (-1315.207) (-1332.535) * (-1313.077) (-1332.993) [-1311.776] (-1330.553) -- 0:01:33
684000 -- (-1320.370) (-1325.564) [-1312.971] (-1316.340) * (-1319.198) [-1322.017] (-1326.113) (-1320.422) -- 0:01:33
684500 -- [-1315.231] (-1322.737) (-1321.170) (-1318.545) * (-1328.218) [-1321.750] (-1311.430) (-1314.971) -- 0:01:33
685000 -- (-1322.192) [-1322.539] (-1322.987) (-1319.326) * (-1319.027) (-1323.776) [-1314.233] (-1324.367) -- 0:01:32
Average standard deviation of split frequencies: 0.009483
685500 -- (-1325.101) (-1315.508) (-1323.835) [-1304.769] * (-1326.846) (-1314.990) [-1315.244] (-1326.599) -- 0:01:32
686000 -- [-1319.768] (-1319.375) (-1319.913) (-1311.590) * (-1320.721) (-1320.843) [-1314.640] (-1330.109) -- 0:01:32
686500 -- (-1319.082) (-1315.907) [-1313.875] (-1325.374) * (-1319.124) [-1314.754] (-1324.555) (-1319.104) -- 0:01:32
687000 -- [-1317.206] (-1321.888) (-1320.977) (-1322.130) * (-1316.600) [-1318.785] (-1324.590) (-1335.396) -- 0:01:32
687500 -- (-1322.701) [-1314.625] (-1311.569) (-1331.501) * [-1315.871] (-1325.263) (-1312.866) (-1320.329) -- 0:01:32
688000 -- [-1314.388] (-1318.588) (-1320.551) (-1312.713) * (-1320.549) (-1322.031) [-1320.993] (-1314.878) -- 0:01:32
688500 -- (-1319.302) [-1330.938] (-1316.776) (-1333.052) * [-1318.514] (-1327.334) (-1309.040) (-1322.979) -- 0:01:31
689000 -- (-1322.244) [-1318.821] (-1327.850) (-1330.559) * [-1316.190] (-1314.992) (-1320.673) (-1317.200) -- 0:01:31
689500 -- (-1316.532) (-1312.439) [-1321.974] (-1321.620) * (-1319.698) (-1328.556) [-1314.173] (-1323.190) -- 0:01:31
690000 -- [-1314.846] (-1322.992) (-1321.319) (-1331.782) * (-1312.118) (-1331.358) [-1310.816] (-1319.004) -- 0:01:31
Average standard deviation of split frequencies: 0.009470
690500 -- (-1317.983) (-1317.935) (-1318.639) [-1315.690] * (-1325.682) (-1313.651) [-1321.709] (-1322.622) -- 0:01:31
691000 -- (-1328.486) [-1324.630] (-1317.866) (-1320.368) * [-1321.833] (-1327.225) (-1314.936) (-1321.512) -- 0:01:31
691500 -- (-1328.425) (-1320.555) (-1316.478) [-1324.401] * [-1318.562] (-1315.981) (-1316.518) (-1330.730) -- 0:01:31
692000 -- (-1330.372) (-1313.097) [-1321.353] (-1315.548) * (-1316.809) (-1319.638) [-1325.032] (-1320.746) -- 0:01:30
692500 -- [-1320.306] (-1319.916) (-1320.090) (-1327.733) * (-1323.147) (-1319.977) (-1329.127) [-1321.862] -- 0:01:31
693000 -- (-1314.058) [-1315.387] (-1313.243) (-1324.983) * (-1318.062) [-1319.114] (-1324.043) (-1314.549) -- 0:01:30
693500 -- (-1316.987) (-1320.153) (-1322.452) [-1321.974] * (-1316.432) (-1318.317) [-1316.878] (-1319.279) -- 0:01:30
694000 -- (-1319.816) [-1313.915] (-1328.886) (-1319.572) * [-1322.379] (-1313.871) (-1325.255) (-1318.847) -- 0:01:30
694500 -- (-1320.171) (-1326.889) [-1323.588] (-1320.846) * (-1326.037) (-1324.085) [-1317.340] (-1312.884) -- 0:01:30
695000 -- (-1311.615) (-1326.228) (-1333.295) [-1317.344] * (-1326.009) [-1317.755] (-1323.383) (-1329.735) -- 0:01:29
Average standard deviation of split frequencies: 0.009821
695500 -- (-1320.613) [-1321.219] (-1325.985) (-1325.110) * (-1322.061) (-1320.074) (-1314.578) [-1317.898] -- 0:01:29
696000 -- [-1320.169] (-1318.562) (-1313.085) (-1326.520) * (-1330.140) (-1317.030) [-1315.919] (-1315.135) -- 0:01:29
696500 -- (-1324.217) (-1323.645) (-1322.592) [-1318.715] * (-1330.412) (-1325.032) (-1323.729) [-1322.247] -- 0:01:29
697000 -- (-1324.868) (-1322.167) [-1318.011] (-1323.699) * [-1318.928] (-1328.503) (-1334.796) (-1315.799) -- 0:01:29
697500 -- (-1317.573) (-1324.929) (-1322.122) [-1319.291] * [-1326.441] (-1317.869) (-1334.474) (-1319.788) -- 0:01:29
698000 -- (-1322.498) (-1323.564) [-1322.328] (-1328.507) * (-1315.119) (-1321.642) (-1319.609) [-1308.994] -- 0:01:29
698500 -- (-1330.709) (-1313.118) (-1332.989) [-1311.961] * [-1319.685] (-1320.939) (-1330.407) (-1314.385) -- 0:01:29
699000 -- (-1323.522) (-1315.661) (-1321.625) [-1307.670] * [-1319.894] (-1316.126) (-1322.693) (-1316.782) -- 0:01:29
699500 -- (-1324.133) (-1317.980) (-1327.259) [-1310.738] * (-1327.027) [-1318.174] (-1324.370) (-1319.533) -- 0:01:28
700000 -- (-1318.333) [-1313.768] (-1324.615) (-1317.383) * (-1319.536) [-1311.694] (-1317.252) (-1320.026) -- 0:01:28
Average standard deviation of split frequencies: 0.009060
700500 -- (-1321.179) (-1323.058) [-1313.108] (-1323.446) * (-1329.158) [-1319.033] (-1322.292) (-1312.774) -- 0:01:28
701000 -- (-1324.698) [-1311.407] (-1314.257) (-1328.536) * (-1330.675) (-1311.052) [-1309.803] (-1326.341) -- 0:01:28
701500 -- (-1325.886) [-1319.698] (-1335.588) (-1323.108) * (-1317.679) (-1323.260) [-1317.622] (-1315.986) -- 0:01:28
702000 -- (-1321.653) [-1318.728] (-1322.130) (-1322.674) * (-1320.981) (-1317.052) (-1319.355) [-1312.386] -- 0:01:28
702500 -- (-1322.172) (-1320.417) [-1319.499] (-1318.417) * (-1320.010) (-1319.402) [-1310.580] (-1313.742) -- 0:01:28
703000 -- (-1324.665) (-1314.664) (-1317.039) [-1319.195] * [-1322.743] (-1316.774) (-1326.042) (-1325.029) -- 0:01:27
703500 -- (-1323.827) [-1316.919] (-1316.964) (-1320.411) * (-1321.010) (-1318.591) [-1324.325] (-1322.324) -- 0:01:27
704000 -- (-1313.203) (-1320.282) (-1322.782) [-1311.261] * (-1314.401) (-1325.058) (-1314.785) [-1318.990] -- 0:01:27
704500 -- (-1321.490) [-1321.381] (-1317.540) (-1318.276) * (-1313.469) (-1329.750) (-1316.482) [-1312.853] -- 0:01:27
705000 -- (-1319.938) [-1327.890] (-1311.093) (-1321.088) * [-1313.301] (-1316.820) (-1313.618) (-1323.775) -- 0:01:27
Average standard deviation of split frequencies: 0.008555
705500 -- (-1320.674) (-1329.418) [-1321.517] (-1316.902) * (-1327.433) [-1314.928] (-1315.304) (-1330.951) -- 0:01:27
706000 -- (-1326.813) (-1318.338) (-1320.260) [-1319.005] * (-1316.485) [-1313.764] (-1325.580) (-1320.852) -- 0:01:27
706500 -- (-1321.831) (-1324.262) (-1318.434) [-1316.059] * (-1332.738) [-1315.322] (-1317.131) (-1327.977) -- 0:01:26
707000 -- (-1316.175) (-1320.447) (-1321.983) [-1313.437] * (-1322.138) (-1318.608) [-1325.154] (-1316.438) -- 0:01:26
707500 -- (-1316.769) (-1327.707) (-1324.485) [-1318.046] * (-1319.214) (-1313.943) (-1322.015) [-1323.548] -- 0:01:26
708000 -- (-1329.881) [-1312.803] (-1316.681) (-1320.853) * (-1321.539) (-1316.667) (-1315.858) [-1316.785] -- 0:01:26
708500 -- [-1322.990] (-1326.531) (-1323.793) (-1314.732) * (-1321.188) (-1328.472) [-1312.110] (-1324.589) -- 0:01:26
709000 -- (-1320.435) (-1313.729) (-1317.746) [-1309.788] * (-1321.472) [-1315.394] (-1317.350) (-1320.328) -- 0:01:26
709500 -- [-1320.680] (-1320.673) (-1318.678) (-1320.955) * (-1324.103) (-1319.456) [-1318.052] (-1328.801) -- 0:01:25
710000 -- [-1314.748] (-1321.936) (-1313.823) (-1319.783) * (-1318.501) (-1311.563) (-1322.559) [-1317.691] -- 0:01:25
Average standard deviation of split frequencies: 0.007877
710500 -- (-1321.612) (-1326.852) [-1313.290] (-1316.020) * (-1317.446) (-1326.014) (-1313.174) [-1313.623] -- 0:01:25
711000 -- (-1319.449) [-1317.584] (-1318.221) (-1328.853) * (-1323.813) [-1315.522] (-1321.781) (-1320.076) -- 0:01:25
711500 -- (-1316.938) (-1323.511) (-1325.028) [-1317.540] * [-1320.243] (-1321.387) (-1316.469) (-1329.195) -- 0:01:25
712000 -- (-1313.359) (-1318.664) [-1320.207] (-1321.373) * [-1315.568] (-1325.134) (-1328.663) (-1323.185) -- 0:01:25
712500 -- (-1320.960) [-1325.596] (-1328.330) (-1318.894) * [-1312.027] (-1321.952) (-1320.536) (-1329.019) -- 0:01:25
713000 -- [-1323.047] (-1323.774) (-1322.627) (-1315.539) * (-1319.831) (-1318.735) (-1321.834) [-1314.376] -- 0:01:24
713500 -- (-1315.027) [-1309.932] (-1319.526) (-1318.087) * (-1332.761) [-1324.879] (-1323.618) (-1312.358) -- 0:01:24
714000 -- (-1320.380) (-1339.367) [-1321.740] (-1324.900) * [-1318.207] (-1324.371) (-1334.933) (-1313.739) -- 0:01:24
714500 -- (-1320.502) (-1322.777) [-1313.687] (-1324.654) * (-1324.561) [-1312.967] (-1329.818) (-1317.182) -- 0:01:24
715000 -- (-1326.177) (-1311.478) (-1320.136) [-1315.870] * (-1323.390) (-1316.794) (-1326.422) [-1321.314] -- 0:01:24
Average standard deviation of split frequencies: 0.007901
715500 -- (-1321.620) (-1315.135) [-1319.611] (-1327.467) * (-1312.581) (-1328.746) (-1325.174) [-1324.442] -- 0:01:24
716000 -- (-1316.609) [-1316.637] (-1324.089) (-1315.702) * (-1313.657) (-1321.981) [-1317.267] (-1322.822) -- 0:01:24
716500 -- [-1316.101] (-1319.338) (-1320.768) (-1321.523) * (-1314.771) [-1316.546] (-1317.156) (-1315.915) -- 0:01:23
717000 -- (-1323.600) (-1319.509) (-1310.076) [-1320.128] * (-1322.953) (-1315.676) [-1316.844] (-1316.482) -- 0:01:23
717500 -- (-1315.358) [-1317.775] (-1312.905) (-1321.474) * (-1317.118) (-1331.482) [-1323.422] (-1324.999) -- 0:01:23
718000 -- (-1312.182) (-1327.199) [-1319.950] (-1325.441) * (-1326.660) [-1313.099] (-1314.501) (-1315.109) -- 0:01:23
718500 -- (-1320.707) [-1322.049] (-1318.803) (-1327.378) * (-1314.263) (-1336.106) (-1315.709) [-1314.887] -- 0:01:23
719000 -- [-1310.694] (-1323.685) (-1318.719) (-1333.762) * [-1310.919] (-1331.560) (-1320.950) (-1319.748) -- 0:01:23
719500 -- (-1318.129) [-1316.340] (-1319.533) (-1324.040) * (-1317.375) (-1319.392) (-1324.280) [-1322.905] -- 0:01:23
720000 -- (-1316.127) [-1314.576] (-1322.201) (-1319.848) * (-1322.641) [-1325.043] (-1320.504) (-1334.366) -- 0:01:22
Average standard deviation of split frequencies: 0.007849
720500 -- (-1318.143) (-1316.707) [-1323.499] (-1323.193) * (-1314.797) [-1316.409] (-1314.393) (-1315.033) -- 0:01:22
721000 -- (-1311.383) (-1313.945) [-1310.977] (-1317.361) * (-1323.799) (-1321.129) [-1311.994] (-1316.891) -- 0:01:22
721500 -- [-1313.953] (-1323.544) (-1326.906) (-1324.219) * (-1327.199) (-1316.220) (-1316.925) [-1321.115] -- 0:01:22
722000 -- [-1316.910] (-1330.252) (-1332.400) (-1321.463) * [-1313.678] (-1326.921) (-1314.813) (-1317.578) -- 0:01:22
722500 -- (-1315.736) (-1330.745) (-1319.404) [-1321.138] * (-1315.167) (-1330.726) (-1319.435) [-1316.467] -- 0:01:22
723000 -- (-1323.215) [-1319.704] (-1325.809) (-1326.473) * [-1318.282] (-1314.700) (-1327.150) (-1318.549) -- 0:01:21
723500 -- (-1316.219) [-1311.505] (-1323.841) (-1323.556) * (-1319.127) (-1318.605) [-1314.075] (-1320.790) -- 0:01:21
724000 -- (-1317.491) (-1314.486) (-1326.422) [-1325.450] * [-1309.905] (-1328.843) (-1323.709) (-1313.540) -- 0:01:21
724500 -- [-1316.401] (-1317.717) (-1323.503) (-1325.309) * (-1319.551) (-1323.674) (-1325.494) [-1322.761] -- 0:01:21
725000 -- (-1314.866) [-1317.810] (-1323.285) (-1329.155) * (-1313.168) [-1316.906] (-1317.650) (-1324.004) -- 0:01:21
Average standard deviation of split frequencies: 0.008319
725500 -- (-1320.620) (-1328.335) [-1317.796] (-1325.944) * [-1312.447] (-1315.310) (-1330.597) (-1311.054) -- 0:01:21
726000 -- (-1313.111) (-1315.101) [-1313.803] (-1327.230) * (-1322.676) (-1323.072) [-1312.461] (-1323.532) -- 0:01:21
726500 -- [-1315.516] (-1318.142) (-1313.810) (-1326.741) * (-1322.748) (-1321.062) (-1316.903) [-1311.651] -- 0:01:20
727000 -- [-1317.262] (-1324.623) (-1340.423) (-1336.676) * (-1326.437) [-1320.833] (-1320.636) (-1321.087) -- 0:01:20
727500 -- (-1321.040) (-1327.005) (-1324.614) [-1326.867] * (-1315.820) [-1313.737] (-1325.176) (-1322.563) -- 0:01:20
728000 -- (-1314.730) (-1320.704) (-1314.263) [-1323.747] * [-1315.998] (-1325.913) (-1317.586) (-1325.638) -- 0:01:20
728500 -- (-1315.613) (-1324.347) (-1313.328) [-1316.501] * (-1315.604) (-1321.993) [-1320.509] (-1326.506) -- 0:01:20
729000 -- (-1320.571) (-1326.072) [-1314.936] (-1320.278) * (-1320.173) [-1315.200] (-1326.147) (-1316.597) -- 0:01:20
729500 -- (-1315.715) (-1322.063) [-1319.546] (-1321.375) * (-1322.508) (-1322.205) (-1326.823) [-1323.185] -- 0:01:20
730000 -- [-1317.269] (-1321.705) (-1319.948) (-1318.619) * (-1326.763) [-1314.170] (-1319.298) (-1324.539) -- 0:01:19
Average standard deviation of split frequencies: 0.008774
730500 -- (-1332.677) (-1338.173) (-1323.036) [-1326.298] * (-1317.756) (-1316.373) [-1322.086] (-1318.451) -- 0:01:20
731000 -- [-1315.177] (-1315.831) (-1319.803) (-1327.806) * [-1318.091] (-1312.933) (-1321.755) (-1321.294) -- 0:01:19
731500 -- (-1325.146) (-1331.140) (-1312.806) [-1315.757] * (-1316.192) [-1318.614] (-1326.340) (-1330.373) -- 0:01:19
732000 -- (-1332.772) (-1317.962) (-1318.370) [-1314.123] * (-1326.175) (-1315.680) (-1321.496) [-1317.511] -- 0:01:19
732500 -- (-1316.974) (-1326.360) (-1321.752) [-1316.148] * [-1321.057] (-1323.006) (-1323.455) (-1321.550) -- 0:01:19
733000 -- [-1326.369] (-1318.504) (-1319.537) (-1316.025) * (-1319.308) (-1319.150) (-1321.320) [-1317.850] -- 0:01:19
733500 -- (-1320.944) (-1316.622) [-1315.368] (-1310.574) * [-1326.600] (-1316.813) (-1321.490) (-1313.542) -- 0:01:19
734000 -- (-1326.350) (-1321.562) [-1312.974] (-1313.891) * (-1322.313) (-1325.051) (-1318.747) [-1328.556] -- 0:01:19
734500 -- (-1336.699) [-1308.900] (-1320.405) (-1332.848) * [-1321.202] (-1320.996) (-1319.229) (-1326.816) -- 0:01:18
735000 -- [-1323.713] (-1319.457) (-1321.771) (-1322.033) * (-1338.841) (-1326.565) (-1315.793) [-1323.408] -- 0:01:18
Average standard deviation of split frequencies: 0.008839
735500 -- [-1319.523] (-1324.627) (-1324.275) (-1326.900) * (-1316.463) (-1323.257) (-1320.359) [-1320.821] -- 0:01:18
736000 -- (-1315.106) (-1327.201) (-1317.519) [-1309.750] * (-1319.922) [-1309.978] (-1320.220) (-1318.258) -- 0:01:18
736500 -- (-1323.884) [-1319.404] (-1320.034) (-1316.778) * [-1315.966] (-1321.450) (-1321.073) (-1318.480) -- 0:01:18
737000 -- [-1317.620] (-1318.340) (-1321.740) (-1329.291) * (-1320.946) [-1322.395] (-1314.307) (-1319.581) -- 0:01:18
737500 -- (-1315.224) [-1313.969] (-1310.665) (-1320.074) * [-1323.903] (-1326.449) (-1322.442) (-1328.218) -- 0:01:17
738000 -- (-1318.132) (-1322.394) (-1314.566) [-1317.405] * (-1322.017) [-1313.614] (-1323.556) (-1314.235) -- 0:01:17
738500 -- (-1319.158) [-1310.297] (-1316.099) (-1326.025) * [-1316.830] (-1316.904) (-1314.954) (-1325.261) -- 0:01:17
739000 -- (-1322.915) [-1308.200] (-1327.146) (-1321.158) * (-1334.383) (-1334.178) (-1315.817) [-1323.410] -- 0:01:17
739500 -- (-1311.809) [-1310.603] (-1322.119) (-1310.182) * (-1320.037) [-1316.790] (-1323.026) (-1323.251) -- 0:01:17
740000 -- (-1321.929) (-1318.635) (-1330.616) [-1316.816] * (-1321.461) [-1322.570] (-1326.531) (-1315.111) -- 0:01:17
Average standard deviation of split frequencies: 0.008401
740500 -- (-1324.330) (-1314.001) [-1320.655] (-1319.684) * (-1316.445) (-1319.829) [-1315.788] (-1312.327) -- 0:01:17
741000 -- (-1325.751) [-1324.526] (-1327.852) (-1317.292) * [-1316.776] (-1317.209) (-1312.534) (-1326.716) -- 0:01:16
741500 -- (-1313.615) (-1316.404) [-1317.724] (-1327.001) * (-1323.052) (-1316.391) (-1324.483) [-1324.064] -- 0:01:17
742000 -- (-1311.251) [-1312.622] (-1310.750) (-1319.551) * (-1323.237) (-1313.342) (-1321.952) [-1314.728] -- 0:01:16
742500 -- (-1318.503) [-1316.049] (-1313.695) (-1315.193) * (-1332.062) [-1312.434] (-1322.667) (-1322.932) -- 0:01:16
743000 -- [-1315.166] (-1322.411) (-1319.282) (-1316.668) * [-1327.920] (-1318.749) (-1321.505) (-1322.908) -- 0:01:16
743500 -- (-1318.754) (-1316.930) [-1316.969] (-1330.109) * (-1327.905) (-1316.848) [-1324.081] (-1318.146) -- 0:01:16
744000 -- [-1320.166] (-1327.402) (-1320.898) (-1312.384) * (-1330.185) [-1317.522] (-1328.736) (-1322.808) -- 0:01:16
744500 -- [-1320.887] (-1315.126) (-1324.849) (-1319.745) * (-1322.444) (-1321.800) (-1319.932) [-1314.668] -- 0:01:16
745000 -- [-1313.281] (-1320.237) (-1317.995) (-1314.719) * (-1324.061) (-1321.876) [-1317.977] (-1316.375) -- 0:01:15
Average standard deviation of split frequencies: 0.008175
745500 -- (-1316.911) (-1316.961) (-1328.377) [-1317.624] * (-1317.615) [-1319.354] (-1315.544) (-1319.414) -- 0:01:15
746000 -- (-1319.574) [-1323.268] (-1331.953) (-1323.964) * [-1324.527] (-1323.595) (-1309.837) (-1318.417) -- 0:01:15
746500 -- (-1323.124) (-1328.421) [-1315.361] (-1320.714) * (-1324.071) (-1317.100) (-1323.231) [-1314.267] -- 0:01:15
747000 -- (-1320.665) (-1316.808) (-1335.178) [-1316.895] * (-1316.164) (-1322.931) [-1314.334] (-1320.661) -- 0:01:15
747500 -- [-1316.928] (-1312.515) (-1320.814) (-1321.293) * (-1325.648) (-1320.557) [-1323.081] (-1316.634) -- 0:01:15
748000 -- (-1316.177) (-1323.518) (-1314.433) [-1311.815] * (-1318.987) (-1330.960) [-1313.138] (-1323.901) -- 0:01:15
748500 -- (-1317.610) (-1317.731) (-1316.278) [-1315.470] * (-1328.948) (-1316.700) (-1315.665) [-1312.739] -- 0:01:14
749000 -- (-1318.303) (-1318.398) (-1325.607) [-1314.863] * (-1324.513) (-1308.556) [-1317.090] (-1317.329) -- 0:01:14
749500 -- (-1314.318) [-1308.970] (-1321.919) (-1314.371) * (-1318.755) (-1321.393) (-1315.418) [-1314.577] -- 0:01:14
750000 -- (-1316.600) (-1313.537) [-1315.807] (-1316.763) * (-1313.097) [-1321.321] (-1322.793) (-1334.275) -- 0:01:14
Average standard deviation of split frequencies: 0.008909
750500 -- [-1316.657] (-1320.853) (-1320.137) (-1327.126) * [-1319.626] (-1314.502) (-1332.734) (-1323.264) -- 0:01:14
751000 -- (-1324.093) (-1321.344) [-1324.611] (-1317.171) * (-1324.609) [-1322.601] (-1329.741) (-1328.386) -- 0:01:14
751500 -- [-1320.029] (-1330.991) (-1322.070) (-1318.878) * (-1315.554) [-1338.407] (-1326.211) (-1325.254) -- 0:01:14
752000 -- (-1320.397) (-1327.966) (-1325.878) [-1312.060] * (-1317.069) (-1328.798) [-1315.575] (-1323.955) -- 0:01:13
752500 -- (-1324.570) (-1322.180) (-1313.419) [-1316.672] * [-1317.304] (-1316.664) (-1326.964) (-1322.055) -- 0:01:14
753000 -- (-1329.659) (-1324.127) [-1322.974] (-1309.654) * (-1317.504) (-1320.309) [-1322.871] (-1326.155) -- 0:01:13
753500 -- (-1327.516) (-1324.506) (-1318.402) [-1323.218] * (-1323.227) [-1314.478] (-1316.483) (-1331.594) -- 0:01:13
754000 -- (-1324.720) (-1316.150) (-1311.059) [-1315.629] * [-1322.385] (-1320.533) (-1320.608) (-1321.878) -- 0:01:13
754500 -- (-1315.082) (-1320.479) (-1328.805) [-1324.385] * (-1335.112) (-1322.346) (-1334.768) [-1315.474] -- 0:01:13
755000 -- (-1311.719) (-1317.019) [-1315.027] (-1329.636) * [-1311.926] (-1341.298) (-1317.700) (-1326.028) -- 0:01:13
Average standard deviation of split frequencies: 0.008574
755500 -- [-1316.385] (-1323.148) (-1321.762) (-1319.014) * (-1310.067) (-1320.773) (-1324.073) [-1325.655] -- 0:01:13
756000 -- (-1321.181) (-1318.635) [-1318.181] (-1324.904) * [-1312.436] (-1321.776) (-1317.689) (-1322.460) -- 0:01:12
756500 -- (-1316.369) [-1314.096] (-1321.099) (-1323.857) * (-1321.742) (-1313.194) (-1323.232) [-1315.331] -- 0:01:12
757000 -- [-1323.118] (-1318.931) (-1312.460) (-1322.229) * (-1321.259) (-1329.620) [-1316.815] (-1331.452) -- 0:01:12
757500 -- [-1315.529] (-1326.176) (-1314.963) (-1327.268) * (-1318.454) (-1325.277) [-1321.144] (-1320.268) -- 0:01:12
758000 -- (-1320.073) (-1317.526) [-1315.090] (-1330.857) * (-1329.757) (-1316.967) [-1315.745] (-1322.430) -- 0:01:12
758500 -- (-1326.155) [-1316.070] (-1314.991) (-1319.720) * (-1310.002) [-1313.266] (-1322.020) (-1318.643) -- 0:01:12
759000 -- (-1314.818) (-1324.408) [-1313.504] (-1318.827) * (-1316.453) (-1329.238) (-1314.361) [-1308.954] -- 0:01:12
759500 -- (-1322.165) (-1316.523) [-1314.466] (-1315.467) * (-1324.460) [-1318.100] (-1315.223) (-1313.156) -- 0:01:11
760000 -- (-1315.666) (-1318.997) [-1316.448] (-1313.920) * (-1319.766) (-1319.037) [-1315.732] (-1318.302) -- 0:01:11
Average standard deviation of split frequencies: 0.007979
760500 -- (-1324.882) [-1320.279] (-1323.538) (-1317.074) * (-1314.646) (-1318.803) (-1318.380) [-1320.371] -- 0:01:11
761000 -- (-1331.611) (-1322.401) [-1318.786] (-1316.165) * (-1322.323) (-1318.946) [-1321.501] (-1319.825) -- 0:01:11
761500 -- (-1310.051) [-1316.119] (-1319.453) (-1322.304) * (-1327.676) (-1321.284) (-1325.384) [-1320.013] -- 0:01:11
762000 -- [-1312.431] (-1320.274) (-1318.866) (-1312.607) * (-1326.151) (-1328.845) (-1333.228) [-1315.011] -- 0:01:11
762500 -- (-1322.696) [-1316.742] (-1322.528) (-1317.968) * (-1319.412) (-1323.504) (-1326.774) [-1318.801] -- 0:01:11
763000 -- (-1313.627) [-1319.865] (-1325.677) (-1320.310) * (-1327.261) (-1328.543) [-1324.342] (-1321.619) -- 0:01:10
763500 -- (-1322.891) (-1316.730) (-1317.658) [-1321.730] * (-1312.515) (-1329.411) (-1312.860) [-1316.331] -- 0:01:10
764000 -- [-1314.029] (-1324.523) (-1324.206) (-1319.841) * (-1325.290) (-1324.900) [-1310.488] (-1322.881) -- 0:01:10
764500 -- (-1317.959) [-1322.363] (-1329.628) (-1321.736) * (-1318.205) (-1316.982) [-1314.449] (-1318.411) -- 0:01:10
765000 -- [-1316.840] (-1320.703) (-1322.153) (-1340.517) * [-1323.827] (-1321.344) (-1320.732) (-1312.180) -- 0:01:10
Average standard deviation of split frequencies: 0.007693
765500 -- (-1321.617) (-1320.291) (-1324.038) [-1308.607] * (-1323.931) [-1317.898] (-1322.375) (-1307.263) -- 0:01:10
766000 -- (-1328.611) (-1317.310) [-1312.040] (-1316.291) * (-1318.007) (-1323.814) [-1321.440] (-1324.005) -- 0:01:09
766500 -- (-1321.893) [-1320.402] (-1312.618) (-1316.113) * (-1316.537) [-1318.613] (-1334.067) (-1336.898) -- 0:01:09
767000 -- (-1318.983) (-1331.589) [-1316.978] (-1324.942) * (-1311.909) (-1313.533) (-1330.209) [-1314.598] -- 0:01:09
767500 -- [-1322.960] (-1318.227) (-1322.685) (-1313.166) * (-1313.129) (-1325.108) (-1317.582) [-1312.503] -- 0:01:09
768000 -- (-1325.677) (-1315.489) (-1314.894) [-1313.664] * (-1321.866) (-1322.022) [-1316.859] (-1322.276) -- 0:01:09
768500 -- (-1333.612) (-1314.734) [-1319.295] (-1318.588) * (-1319.659) [-1319.185] (-1329.150) (-1315.439) -- 0:01:09
769000 -- [-1329.712] (-1314.151) (-1330.066) (-1319.325) * [-1319.782] (-1320.569) (-1330.744) (-1328.405) -- 0:01:09
769500 -- [-1321.338] (-1311.938) (-1340.975) (-1316.086) * (-1317.292) [-1311.025] (-1321.318) (-1323.972) -- 0:01:08
770000 -- (-1320.341) [-1314.591] (-1330.909) (-1315.046) * (-1326.186) (-1319.770) [-1319.493] (-1317.551) -- 0:01:09
Average standard deviation of split frequencies: 0.007493
770500 -- (-1326.044) [-1315.877] (-1321.140) (-1328.103) * (-1315.012) (-1318.581) [-1318.834] (-1319.041) -- 0:01:08
771000 -- (-1324.679) [-1320.654] (-1318.534) (-1322.412) * (-1311.738) (-1321.714) [-1321.213] (-1317.447) -- 0:01:08
771500 -- (-1334.852) (-1316.716) [-1316.295] (-1314.490) * (-1323.857) (-1319.862) (-1344.739) [-1323.748] -- 0:01:08
772000 -- [-1316.371] (-1323.490) (-1323.466) (-1330.230) * (-1324.022) (-1319.882) (-1319.833) [-1321.008] -- 0:01:08
772500 -- (-1318.087) (-1319.239) (-1318.490) [-1314.077] * (-1310.529) (-1319.192) [-1315.181] (-1317.996) -- 0:01:08
773000 -- (-1314.713) (-1323.729) (-1324.378) [-1318.696] * (-1316.805) (-1321.545) [-1313.059] (-1325.241) -- 0:01:08
773500 -- [-1315.941] (-1315.969) (-1334.501) (-1320.103) * (-1333.538) (-1313.557) [-1317.543] (-1322.016) -- 0:01:07
774000 -- (-1322.170) (-1321.377) [-1316.892] (-1326.075) * [-1313.227] (-1325.702) (-1333.802) (-1315.640) -- 0:01:07
774500 -- (-1316.221) (-1322.896) (-1322.205) [-1312.981] * [-1312.174] (-1331.622) (-1326.115) (-1314.358) -- 0:01:07
775000 -- [-1316.868] (-1317.573) (-1326.014) (-1317.730) * (-1332.285) [-1328.592] (-1320.987) (-1322.254) -- 0:01:07
Average standard deviation of split frequencies: 0.008125
775500 -- (-1319.428) [-1314.637] (-1333.075) (-1322.772) * (-1326.543) (-1314.818) (-1316.950) [-1313.299] -- 0:01:07
776000 -- [-1315.827] (-1324.962) (-1323.374) (-1315.600) * [-1326.146] (-1324.341) (-1317.183) (-1317.518) -- 0:01:07
776500 -- (-1318.530) (-1324.393) [-1319.110] (-1318.614) * (-1338.893) (-1331.917) (-1314.403) [-1322.960] -- 0:01:07
777000 -- (-1323.820) [-1316.490] (-1325.283) (-1321.562) * (-1325.577) (-1331.016) (-1310.794) [-1320.734] -- 0:01:06
777500 -- [-1315.538] (-1316.197) (-1326.264) (-1313.359) * (-1325.218) (-1336.326) [-1314.700] (-1322.085) -- 0:01:06
778000 -- (-1332.758) (-1324.361) (-1326.348) [-1311.386] * [-1319.343] (-1326.543) (-1315.621) (-1320.343) -- 0:01:06
778500 -- [-1323.261] (-1318.660) (-1322.733) (-1328.631) * (-1323.906) (-1314.290) [-1311.012] (-1327.748) -- 0:01:06
779000 -- [-1320.024] (-1308.270) (-1321.780) (-1315.524) * (-1322.263) (-1319.707) (-1322.718) [-1311.744] -- 0:01:06
779500 -- (-1314.818) (-1322.019) (-1318.968) [-1315.218] * (-1316.762) (-1311.720) [-1308.969] (-1321.293) -- 0:01:06
780000 -- [-1310.346] (-1316.258) (-1315.719) (-1320.888) * (-1318.754) (-1326.467) (-1325.082) [-1311.882] -- 0:01:06
Average standard deviation of split frequencies: 0.007850
780500 -- (-1325.564) (-1315.371) (-1314.337) [-1316.784] * [-1315.506] (-1319.860) (-1327.965) (-1317.242) -- 0:01:05
781000 -- (-1313.509) [-1316.153] (-1316.671) (-1331.540) * (-1315.779) (-1326.358) [-1318.211] (-1322.087) -- 0:01:05
781500 -- [-1319.524] (-1326.713) (-1320.745) (-1322.212) * (-1316.523) (-1321.450) [-1318.795] (-1320.626) -- 0:01:05
782000 -- [-1322.041] (-1334.530) (-1320.068) (-1313.861) * (-1325.433) (-1325.221) [-1320.374] (-1329.477) -- 0:01:05
782500 -- (-1321.707) (-1325.206) (-1315.573) [-1309.351] * [-1319.597] (-1315.587) (-1336.632) (-1318.053) -- 0:01:05
783000 -- [-1314.939] (-1326.250) (-1326.966) (-1317.643) * (-1328.415) [-1319.966] (-1321.559) (-1326.824) -- 0:01:05
783500 -- (-1324.784) [-1313.975] (-1323.778) (-1310.518) * (-1322.168) (-1323.005) (-1319.018) [-1327.573] -- 0:01:04
784000 -- (-1325.654) (-1328.862) (-1322.204) [-1317.145] * (-1323.087) (-1323.740) [-1318.542] (-1317.664) -- 0:01:04
784500 -- [-1312.266] (-1322.759) (-1318.123) (-1319.606) * (-1332.204) (-1312.565) (-1318.912) [-1315.069] -- 0:01:04
785000 -- [-1319.482] (-1323.132) (-1325.426) (-1320.773) * (-1325.837) (-1321.471) [-1317.506] (-1327.589) -- 0:01:04
Average standard deviation of split frequencies: 0.007647
785500 -- (-1320.383) [-1315.645] (-1322.342) (-1332.267) * (-1320.011) (-1321.047) (-1316.557) [-1313.069] -- 0:01:04
786000 -- (-1319.714) (-1318.664) (-1312.362) [-1312.805] * (-1317.873) [-1313.890] (-1319.380) (-1318.324) -- 0:01:04
786500 -- (-1320.736) (-1317.804) (-1319.926) [-1320.930] * (-1330.577) (-1310.986) (-1317.184) [-1314.059] -- 0:01:04
787000 -- (-1313.102) (-1316.094) (-1327.444) [-1320.061] * (-1323.597) (-1328.058) (-1328.093) [-1317.887] -- 0:01:03
787500 -- (-1323.845) [-1315.665] (-1323.984) (-1315.540) * (-1315.386) (-1317.253) [-1320.513] (-1318.186) -- 0:01:03
788000 -- (-1318.516) (-1321.616) [-1315.391] (-1317.370) * (-1312.331) (-1314.571) [-1320.294] (-1319.509) -- 0:01:03
788500 -- [-1314.051] (-1326.922) (-1326.074) (-1315.173) * (-1315.590) (-1322.768) (-1312.898) [-1324.315] -- 0:01:03
789000 -- (-1321.000) (-1310.211) (-1328.288) [-1312.896] * (-1310.382) [-1321.978] (-1318.041) (-1319.887) -- 0:01:03
789500 -- [-1311.525] (-1316.251) (-1323.582) (-1312.706) * (-1319.632) (-1325.815) (-1321.271) [-1313.077] -- 0:01:03
790000 -- (-1319.087) [-1312.130] (-1324.605) (-1312.942) * (-1314.939) (-1334.438) [-1323.489] (-1324.038) -- 0:01:02
Average standard deviation of split frequencies: 0.007564
790500 -- [-1319.188] (-1316.949) (-1322.367) (-1332.363) * (-1328.549) [-1322.645] (-1332.212) (-1314.555) -- 0:01:03
791000 -- (-1317.286) [-1319.047] (-1314.443) (-1317.396) * (-1321.990) (-1321.917) [-1322.723] (-1311.644) -- 0:01:02
791500 -- (-1320.304) [-1318.047] (-1332.448) (-1322.013) * (-1320.095) [-1310.511] (-1313.595) (-1317.236) -- 0:01:02
792000 -- [-1315.030] (-1315.244) (-1325.453) (-1320.618) * (-1319.553) [-1312.868] (-1321.729) (-1317.788) -- 0:01:02
792500 -- (-1312.815) [-1320.013] (-1331.683) (-1310.376) * (-1329.181) [-1315.562] (-1324.389) (-1316.407) -- 0:01:02
793000 -- (-1319.964) [-1314.996] (-1321.604) (-1311.708) * (-1320.740) (-1312.906) (-1328.334) [-1309.150] -- 0:01:02
793500 -- (-1324.591) (-1320.532) (-1322.800) [-1314.081] * (-1332.634) (-1313.365) [-1317.540] (-1317.178) -- 0:01:01
794000 -- (-1318.518) (-1320.026) (-1322.306) [-1317.912] * (-1326.209) (-1316.516) [-1310.931] (-1321.012) -- 0:01:02
794500 -- (-1325.571) (-1318.131) (-1326.360) [-1315.818] * (-1328.670) (-1317.118) (-1315.861) [-1314.229] -- 0:01:01
795000 -- [-1310.126] (-1319.010) (-1315.386) (-1326.967) * (-1318.082) (-1329.078) [-1314.822] (-1322.612) -- 0:01:01
Average standard deviation of split frequencies: 0.007625
795500 -- (-1317.883) (-1316.616) (-1323.704) [-1309.996] * (-1317.199) (-1316.638) [-1319.712] (-1327.192) -- 0:01:01
796000 -- (-1324.172) (-1317.449) (-1331.772) [-1319.551] * (-1320.137) [-1319.825] (-1320.306) (-1315.046) -- 0:01:01
796500 -- (-1320.649) (-1328.560) (-1323.800) [-1325.532] * (-1320.283) (-1313.426) (-1316.562) [-1310.756] -- 0:01:01
797000 -- (-1321.529) (-1325.310) [-1325.507] (-1329.096) * (-1318.594) [-1321.162] (-1320.708) (-1325.065) -- 0:01:01
797500 -- [-1315.122] (-1329.605) (-1323.040) (-1316.323) * (-1325.328) (-1319.302) [-1320.763] (-1317.004) -- 0:01:00
798000 -- (-1321.033) (-1331.046) (-1320.023) [-1313.790] * (-1333.158) (-1316.888) (-1320.398) [-1310.242] -- 0:01:00
798500 -- (-1321.351) (-1326.548) [-1318.872] (-1321.665) * [-1315.480] (-1307.635) (-1322.694) (-1317.652) -- 0:01:00
799000 -- (-1316.608) (-1320.480) (-1313.745) [-1311.469] * (-1316.058) (-1319.836) [-1324.819] (-1341.320) -- 0:01:00
799500 -- (-1309.228) (-1321.785) (-1318.662) [-1313.102] * (-1317.366) (-1321.398) [-1312.673] (-1332.565) -- 0:01:00
800000 -- [-1319.479] (-1322.745) (-1326.291) (-1315.971) * (-1325.107) (-1326.770) [-1313.595] (-1331.192) -- 0:01:00
Average standard deviation of split frequencies: 0.007396
800500 -- (-1314.707) [-1323.376] (-1316.230) (-1320.794) * (-1319.005) (-1312.814) [-1318.712] (-1312.525) -- 0:01:00
801000 -- (-1314.508) [-1318.827] (-1313.490) (-1319.250) * (-1318.569) (-1314.868) [-1321.172] (-1314.114) -- 0:00:59
801500 -- (-1309.541) (-1315.750) [-1313.804] (-1321.576) * (-1316.721) (-1328.139) [-1311.216] (-1325.032) -- 0:00:59
802000 -- (-1313.062) (-1330.205) (-1323.717) [-1319.165] * (-1319.373) (-1325.262) [-1319.052] (-1334.649) -- 0:00:59
802500 -- (-1323.176) (-1319.869) (-1317.853) [-1318.159] * (-1312.357) (-1315.672) (-1318.811) [-1309.652] -- 0:00:59
803000 -- (-1319.716) (-1313.519) (-1321.790) [-1319.161] * (-1329.659) (-1318.001) (-1312.485) [-1314.939] -- 0:00:59
803500 -- [-1317.033] (-1315.736) (-1319.879) (-1311.408) * (-1323.633) (-1316.036) (-1321.883) [-1318.506] -- 0:00:59
804000 -- [-1316.300] (-1323.044) (-1313.659) (-1317.763) * (-1313.158) (-1320.683) (-1318.060) [-1321.626] -- 0:00:58
804500 -- [-1314.824] (-1319.152) (-1316.990) (-1324.864) * (-1319.662) [-1315.267] (-1325.709) (-1317.111) -- 0:00:58
805000 -- (-1324.192) (-1317.301) [-1320.760] (-1317.139) * (-1316.450) (-1321.139) (-1324.613) [-1318.082] -- 0:00:58
Average standard deviation of split frequencies: 0.007092
805500 -- [-1315.964] (-1322.181) (-1324.174) (-1332.726) * [-1323.757] (-1323.997) (-1327.384) (-1313.495) -- 0:00:58
806000 -- (-1324.246) [-1322.432] (-1321.380) (-1316.694) * (-1324.945) (-1311.354) (-1321.224) [-1316.449] -- 0:00:58
806500 -- (-1320.839) (-1329.402) [-1317.617] (-1315.323) * (-1315.567) (-1321.481) (-1324.122) [-1319.790] -- 0:00:58
807000 -- (-1321.300) (-1315.166) [-1316.944] (-1314.080) * [-1318.951] (-1329.113) (-1317.775) (-1310.994) -- 0:00:58
807500 -- (-1319.992) (-1315.887) [-1319.799] (-1309.988) * (-1334.172) (-1332.714) (-1315.963) [-1314.438] -- 0:00:57
808000 -- (-1331.248) (-1325.965) (-1315.795) [-1311.024] * (-1317.952) (-1322.217) (-1330.663) [-1312.967] -- 0:00:57
808500 -- [-1319.956] (-1333.189) (-1318.629) (-1330.373) * [-1322.035] (-1324.276) (-1325.053) (-1315.452) -- 0:00:57
809000 -- (-1321.486) (-1315.617) [-1319.218] (-1325.068) * (-1325.856) [-1319.882] (-1322.860) (-1320.381) -- 0:00:57
809500 -- (-1321.630) (-1325.547) [-1317.794] (-1317.822) * (-1321.762) (-1327.114) (-1323.607) [-1314.132] -- 0:00:57
810000 -- (-1313.083) (-1324.553) [-1320.421] (-1328.342) * (-1328.562) (-1320.686) (-1317.636) [-1316.273] -- 0:00:57
Average standard deviation of split frequencies: 0.007269
810500 -- (-1320.254) (-1327.451) [-1322.045] (-1331.355) * (-1327.768) (-1323.171) [-1316.433] (-1328.091) -- 0:00:57
811000 -- (-1332.389) (-1323.594) [-1313.329] (-1315.092) * (-1328.498) (-1321.060) [-1317.344] (-1313.113) -- 0:00:57
811500 -- [-1313.859] (-1314.127) (-1319.832) (-1319.157) * (-1323.277) (-1333.470) (-1323.042) [-1310.176] -- 0:00:56
812000 -- (-1323.280) (-1313.300) [-1313.892] (-1317.609) * [-1327.026] (-1319.435) (-1316.535) (-1317.910) -- 0:00:56
812500 -- [-1326.857] (-1337.445) (-1326.001) (-1320.848) * (-1325.058) (-1328.911) (-1312.930) [-1313.217] -- 0:00:56
813000 -- (-1333.247) (-1315.202) (-1321.699) [-1317.722] * [-1316.963] (-1317.809) (-1310.474) (-1313.982) -- 0:00:56
813500 -- [-1316.309] (-1319.239) (-1321.631) (-1327.957) * [-1311.887] (-1321.571) (-1313.840) (-1323.851) -- 0:00:56
814000 -- (-1314.486) (-1324.725) (-1330.816) [-1326.907] * [-1310.107] (-1323.366) (-1319.588) (-1319.553) -- 0:00:56
814500 -- (-1327.999) (-1323.118) (-1319.097) [-1322.621] * [-1319.877] (-1324.004) (-1317.639) (-1326.068) -- 0:00:56
815000 -- (-1321.758) [-1322.271] (-1324.105) (-1333.449) * (-1313.011) (-1320.241) [-1320.499] (-1326.326) -- 0:00:55
Average standard deviation of split frequencies: 0.007438
815500 -- (-1317.781) (-1324.960) (-1323.977) [-1317.730] * (-1326.641) (-1328.344) [-1324.547] (-1321.417) -- 0:00:55
816000 -- [-1312.348] (-1312.138) (-1321.431) (-1322.068) * (-1324.150) (-1323.024) (-1329.702) [-1321.597] -- 0:00:55
816500 -- (-1320.419) (-1321.410) (-1314.651) [-1316.283] * (-1316.479) (-1313.406) (-1326.322) [-1328.229] -- 0:00:55
817000 -- (-1320.488) (-1330.305) (-1319.279) [-1319.476] * (-1319.828) (-1314.907) [-1315.318] (-1323.630) -- 0:00:55
817500 -- (-1322.871) (-1317.759) (-1334.905) [-1329.805] * (-1317.382) [-1309.603] (-1317.247) (-1322.415) -- 0:00:55
818000 -- (-1308.738) (-1323.698) (-1318.397) [-1320.416] * (-1329.558) [-1315.274] (-1319.429) (-1322.247) -- 0:00:54
818500 -- [-1314.180] (-1313.155) (-1322.220) (-1333.619) * [-1318.612] (-1320.764) (-1320.415) (-1326.464) -- 0:00:54
819000 -- (-1317.358) (-1316.914) [-1316.790] (-1323.581) * (-1316.273) [-1317.885] (-1329.841) (-1316.117) -- 0:00:54
819500 -- (-1315.130) (-1315.772) (-1317.853) [-1319.087] * [-1310.673] (-1328.609) (-1328.890) (-1312.379) -- 0:00:54
820000 -- (-1325.016) [-1312.402] (-1315.942) (-1320.106) * (-1325.686) [-1319.419] (-1322.037) (-1320.364) -- 0:00:54
Average standard deviation of split frequencies: 0.007697
820500 -- [-1321.830] (-1323.393) (-1318.695) (-1321.893) * (-1331.431) (-1311.118) (-1321.621) [-1312.623] -- 0:00:54
821000 -- (-1323.515) (-1313.808) (-1328.439) [-1327.319] * (-1325.179) (-1323.785) [-1322.444] (-1313.880) -- 0:00:54
821500 -- [-1318.189] (-1316.033) (-1316.307) (-1326.320) * (-1317.014) (-1323.415) (-1327.904) [-1308.412] -- 0:00:53
822000 -- (-1324.409) [-1315.229] (-1329.115) (-1316.078) * (-1312.209) (-1309.056) [-1320.664] (-1323.188) -- 0:00:53
822500 -- (-1317.144) (-1319.289) (-1331.947) [-1314.804] * (-1324.235) [-1316.357] (-1318.396) (-1314.604) -- 0:00:53
823000 -- (-1323.467) (-1324.960) (-1321.251) [-1323.199] * (-1312.090) [-1319.048] (-1319.145) (-1333.765) -- 0:00:53
823500 -- (-1325.264) (-1313.278) [-1322.905] (-1317.066) * [-1315.556] (-1317.913) (-1319.722) (-1326.470) -- 0:00:53
824000 -- (-1325.053) [-1311.297] (-1325.863) (-1320.050) * [-1315.472] (-1320.880) (-1320.659) (-1316.418) -- 0:00:53
824500 -- (-1321.400) (-1318.486) (-1322.750) [-1315.527] * [-1326.864] (-1326.499) (-1320.307) (-1333.139) -- 0:00:53
825000 -- [-1313.489] (-1327.223) (-1318.857) (-1321.498) * [-1311.265] (-1314.038) (-1333.266) (-1312.799) -- 0:00:52
Average standard deviation of split frequencies: 0.007457
825500 -- [-1311.774] (-1325.718) (-1315.197) (-1322.649) * (-1328.416) [-1317.668] (-1332.918) (-1319.997) -- 0:00:52
826000 -- [-1318.999] (-1316.662) (-1320.514) (-1323.654) * (-1330.211) (-1325.239) [-1317.887] (-1321.056) -- 0:00:52
826500 -- [-1314.271] (-1311.562) (-1316.803) (-1318.858) * (-1323.399) (-1330.560) [-1318.206] (-1325.276) -- 0:00:52
827000 -- (-1327.526) [-1317.080] (-1326.357) (-1320.843) * [-1312.943] (-1322.647) (-1319.761) (-1326.521) -- 0:00:52
827500 -- (-1322.099) (-1320.911) [-1318.597] (-1315.255) * [-1320.708] (-1327.416) (-1322.396) (-1318.704) -- 0:00:52
828000 -- (-1316.834) (-1325.199) [-1315.348] (-1325.273) * (-1316.984) (-1327.748) [-1308.681] (-1323.753) -- 0:00:51
828500 -- (-1311.858) (-1313.841) (-1320.833) [-1312.587] * (-1320.546) (-1324.311) [-1312.321] (-1326.132) -- 0:00:51
829000 -- (-1322.106) (-1318.596) (-1320.079) [-1317.385] * (-1313.223) (-1322.454) (-1319.698) [-1316.582] -- 0:00:51
829500 -- [-1309.565] (-1324.540) (-1316.468) (-1325.556) * (-1313.180) (-1317.126) [-1317.375] (-1318.032) -- 0:00:51
830000 -- (-1315.865) (-1321.762) (-1326.648) [-1315.219] * (-1321.604) [-1308.617] (-1314.024) (-1316.797) -- 0:00:51
Average standard deviation of split frequencies: 0.007129
830500 -- (-1330.392) [-1317.397] (-1316.983) (-1310.954) * (-1320.840) [-1316.510] (-1318.490) (-1324.556) -- 0:00:51
831000 -- (-1323.373) (-1321.836) (-1322.202) [-1314.345] * (-1315.405) (-1314.429) [-1322.859] (-1313.844) -- 0:00:51
831500 -- [-1312.450] (-1311.503) (-1326.438) (-1316.859) * [-1313.750] (-1320.067) (-1317.744) (-1326.891) -- 0:00:50
832000 -- (-1322.300) (-1314.380) (-1316.573) [-1312.173] * [-1309.842] (-1314.497) (-1325.054) (-1316.102) -- 0:00:50
832500 -- (-1322.637) [-1313.530] (-1326.182) (-1317.328) * (-1309.289) (-1317.916) (-1323.714) [-1310.828] -- 0:00:50
833000 -- [-1315.652] (-1311.813) (-1325.022) (-1328.710) * (-1317.774) (-1321.075) (-1328.679) [-1323.129] -- 0:00:50
833500 -- (-1339.732) (-1322.026) (-1320.714) [-1319.154] * (-1319.472) (-1320.749) [-1316.308] (-1318.142) -- 0:00:50
834000 -- (-1318.381) (-1318.720) [-1318.313] (-1327.004) * (-1317.817) (-1325.567) [-1319.918] (-1315.474) -- 0:00:50
834500 -- [-1313.040] (-1322.591) (-1316.630) (-1331.359) * (-1325.423) (-1327.337) (-1327.330) [-1316.035] -- 0:00:49
835000 -- (-1320.726) (-1324.520) (-1315.459) [-1318.842] * (-1320.169) (-1321.680) [-1309.628] (-1316.741) -- 0:00:49
Average standard deviation of split frequencies: 0.007471
835500 -- (-1315.906) (-1318.320) [-1312.052] (-1321.860) * (-1318.071) (-1313.645) [-1314.541] (-1331.006) -- 0:00:49
836000 -- (-1324.193) [-1311.313] (-1321.828) (-1320.680) * (-1312.938) (-1317.631) (-1318.434) [-1311.309] -- 0:00:49
836500 -- (-1329.151) (-1332.177) (-1323.382) [-1317.615] * (-1311.235) (-1313.315) (-1318.170) [-1326.012] -- 0:00:49
837000 -- [-1312.662] (-1329.037) (-1322.343) (-1317.401) * [-1314.205] (-1322.822) (-1324.835) (-1332.134) -- 0:00:49
837500 -- (-1314.278) [-1323.786] (-1316.102) (-1322.372) * (-1315.081) (-1319.551) [-1313.274] (-1321.683) -- 0:00:49
838000 -- [-1311.058] (-1321.211) (-1310.095) (-1319.914) * (-1324.627) (-1323.396) (-1315.819) [-1331.089] -- 0:00:48
838500 -- (-1317.556) (-1324.715) [-1308.157] (-1332.940) * (-1322.813) [-1319.134] (-1328.233) (-1327.868) -- 0:00:48
839000 -- (-1318.085) (-1323.022) [-1315.453] (-1317.649) * (-1322.099) (-1318.561) (-1311.211) [-1318.643] -- 0:00:48
839500 -- [-1310.301] (-1317.060) (-1317.666) (-1307.656) * (-1323.588) (-1315.817) (-1321.083) [-1322.942] -- 0:00:48
840000 -- (-1316.318) (-1320.197) (-1325.451) [-1315.297] * [-1314.431] (-1317.930) (-1309.755) (-1326.496) -- 0:00:48
Average standard deviation of split frequencies: 0.007220
840500 -- [-1323.255] (-1321.969) (-1316.079) (-1317.665) * [-1317.960] (-1325.474) (-1318.696) (-1326.666) -- 0:00:48
841000 -- (-1319.795) (-1332.197) [-1316.227] (-1318.215) * [-1316.221] (-1327.693) (-1317.328) (-1322.285) -- 0:00:48
841500 -- (-1316.475) (-1318.957) (-1323.378) [-1314.279] * (-1314.395) (-1321.065) [-1308.579] (-1320.171) -- 0:00:48
842000 -- (-1322.233) (-1315.865) [-1315.564] (-1323.265) * (-1317.009) (-1331.871) (-1321.784) [-1312.575] -- 0:00:47
842500 -- (-1319.618) [-1314.688] (-1317.022) (-1323.003) * (-1318.273) (-1333.471) (-1315.672) [-1317.055] -- 0:00:47
843000 -- (-1322.302) [-1327.036] (-1314.847) (-1328.359) * (-1323.452) (-1327.715) [-1314.327] (-1325.503) -- 0:00:47
843500 -- (-1319.098) [-1316.340] (-1319.997) (-1318.724) * (-1319.940) [-1326.435] (-1312.845) (-1332.543) -- 0:00:47
844000 -- (-1326.715) [-1327.547] (-1316.480) (-1315.397) * (-1325.128) (-1313.147) [-1312.819] (-1314.288) -- 0:00:47
844500 -- [-1314.217] (-1324.383) (-1320.139) (-1319.247) * (-1324.277) [-1316.239] (-1315.246) (-1323.572) -- 0:00:47
845000 -- (-1314.239) (-1312.351) (-1330.876) [-1313.678] * (-1316.392) (-1321.703) (-1316.302) [-1310.852] -- 0:00:46
Average standard deviation of split frequencies: 0.007697
845500 -- (-1324.577) (-1328.790) (-1311.749) [-1319.827] * (-1332.204) [-1315.115] (-1314.009) (-1313.969) -- 0:00:46
846000 -- (-1329.672) (-1320.200) [-1311.511] (-1312.714) * (-1320.289) [-1314.865] (-1325.063) (-1317.268) -- 0:00:46
846500 -- (-1325.042) (-1324.689) [-1326.618] (-1331.084) * (-1325.768) (-1331.612) (-1318.582) [-1319.849] -- 0:00:46
847000 -- (-1327.935) (-1318.693) [-1322.129] (-1319.263) * (-1333.237) [-1319.573] (-1316.449) (-1315.822) -- 0:00:46
847500 -- (-1322.123) (-1324.187) (-1337.822) [-1313.784] * (-1329.920) (-1319.926) [-1316.406] (-1313.976) -- 0:00:46
848000 -- (-1322.456) (-1322.766) (-1327.735) [-1316.159] * (-1319.078) (-1323.294) [-1309.400] (-1319.934) -- 0:00:46
848500 -- (-1315.148) [-1314.517] (-1321.788) (-1326.594) * (-1321.464) [-1324.032] (-1323.666) (-1323.551) -- 0:00:45
849000 -- [-1318.257] (-1324.464) (-1319.790) (-1314.810) * (-1310.543) (-1319.066) (-1321.170) [-1316.339] -- 0:00:45
849500 -- (-1322.086) (-1326.750) [-1321.001] (-1309.559) * [-1314.785] (-1323.630) (-1325.065) (-1325.695) -- 0:00:45
850000 -- (-1326.349) (-1323.418) [-1320.859] (-1314.032) * (-1323.093) (-1319.338) (-1320.431) [-1327.401] -- 0:00:45
Average standard deviation of split frequencies: 0.007689
850500 -- [-1323.269] (-1326.237) (-1314.863) (-1332.475) * (-1310.177) [-1319.958] (-1320.048) (-1320.641) -- 0:00:45
851000 -- (-1316.444) (-1334.977) (-1313.600) [-1317.654] * [-1315.983] (-1320.779) (-1322.944) (-1318.027) -- 0:00:45
851500 -- (-1316.125) (-1329.579) [-1313.876] (-1317.774) * (-1325.496) (-1313.847) (-1320.651) [-1307.204] -- 0:00:44
852000 -- (-1319.335) (-1332.142) (-1322.106) [-1316.425] * (-1321.513) (-1319.815) [-1312.568] (-1322.952) -- 0:00:44
852500 -- (-1319.396) (-1321.984) [-1316.469] (-1317.294) * (-1323.594) (-1319.564) [-1316.370] (-1322.590) -- 0:00:44
853000 -- (-1332.280) [-1314.230] (-1322.295) (-1315.004) * (-1325.703) (-1317.219) [-1316.910] (-1324.715) -- 0:00:44
853500 -- (-1316.694) [-1318.809] (-1324.217) (-1311.124) * (-1327.226) (-1308.436) (-1311.949) [-1318.964] -- 0:00:44
854000 -- (-1317.080) [-1316.832] (-1330.235) (-1315.812) * (-1327.729) [-1315.731] (-1317.153) (-1321.889) -- 0:00:44
854500 -- (-1319.452) [-1327.341] (-1316.036) (-1325.581) * (-1326.958) [-1307.217] (-1315.078) (-1320.178) -- 0:00:44
855000 -- (-1319.123) (-1317.126) [-1318.187] (-1323.922) * (-1314.099) (-1320.395) [-1311.413] (-1321.934) -- 0:00:43
Average standard deviation of split frequencies: 0.007882
855500 -- [-1315.577] (-1319.991) (-1318.911) (-1318.181) * (-1317.914) (-1318.027) (-1323.571) [-1311.587] -- 0:00:43
856000 -- (-1318.391) (-1315.770) [-1318.172] (-1321.143) * (-1317.778) (-1320.952) (-1317.673) [-1313.491] -- 0:00:43
856500 -- (-1328.708) (-1317.782) [-1314.772] (-1322.673) * (-1330.249) (-1327.642) [-1314.212] (-1307.993) -- 0:00:43
857000 -- (-1314.771) (-1326.333) (-1315.586) [-1321.538] * (-1314.841) [-1313.798] (-1318.229) (-1318.884) -- 0:00:43
857500 -- (-1313.305) (-1320.861) (-1312.887) [-1321.243] * (-1318.805) (-1327.785) [-1318.470] (-1323.166) -- 0:00:43
858000 -- (-1321.428) (-1322.295) (-1313.921) [-1317.834] * (-1326.596) (-1327.333) [-1319.635] (-1328.253) -- 0:00:43
858500 -- (-1325.157) (-1319.521) (-1320.613) [-1315.879] * (-1324.870) [-1321.917] (-1316.742) (-1324.734) -- 0:00:43
859000 -- (-1320.872) (-1318.885) [-1325.350] (-1324.623) * [-1316.330] (-1320.976) (-1333.208) (-1314.135) -- 0:00:42
859500 -- (-1320.277) (-1329.642) [-1316.868] (-1322.172) * [-1321.185] (-1318.436) (-1319.601) (-1317.801) -- 0:00:42
860000 -- (-1319.822) (-1317.774) [-1320.096] (-1327.259) * (-1320.053) (-1330.312) [-1317.822] (-1319.703) -- 0:00:42
Average standard deviation of split frequencies: 0.008319
860500 -- (-1323.653) [-1317.085] (-1321.473) (-1318.861) * (-1321.718) (-1319.299) [-1314.859] (-1319.145) -- 0:00:42
861000 -- [-1313.524] (-1325.239) (-1316.689) (-1315.373) * (-1314.923) [-1314.682] (-1321.385) (-1321.038) -- 0:00:42
861500 -- (-1322.978) (-1318.989) [-1325.912] (-1315.330) * [-1316.411] (-1309.940) (-1322.786) (-1320.306) -- 0:00:41
862000 -- (-1318.050) (-1325.000) (-1320.226) [-1319.660] * [-1312.709] (-1314.618) (-1315.206) (-1324.888) -- 0:00:41
862500 -- [-1321.576] (-1315.849) (-1327.748) (-1321.738) * (-1332.866) (-1316.479) [-1308.431] (-1324.550) -- 0:00:41
863000 -- [-1308.073] (-1307.446) (-1322.443) (-1325.304) * (-1324.486) [-1314.230] (-1319.830) (-1318.827) -- 0:00:41
863500 -- [-1316.014] (-1314.626) (-1316.103) (-1317.579) * (-1325.025) [-1314.731] (-1319.757) (-1321.621) -- 0:00:41
864000 -- (-1329.837) [-1319.551] (-1316.468) (-1319.678) * [-1318.004] (-1312.366) (-1315.457) (-1317.500) -- 0:00:41
864500 -- (-1327.934) (-1311.876) (-1319.650) [-1315.046] * [-1317.204] (-1318.433) (-1320.854) (-1319.539) -- 0:00:41
865000 -- (-1318.613) (-1318.959) (-1314.531) [-1318.463] * (-1322.470) (-1317.004) [-1322.582] (-1325.427) -- 0:00:40
Average standard deviation of split frequencies: 0.008233
865500 -- (-1318.684) [-1314.500] (-1327.591) (-1331.629) * (-1320.376) [-1313.139] (-1325.401) (-1315.075) -- 0:00:40
866000 -- (-1318.977) [-1328.818] (-1319.246) (-1318.798) * [-1314.727] (-1316.644) (-1314.071) (-1327.423) -- 0:00:40
866500 -- (-1316.514) (-1310.257) (-1320.540) [-1312.937] * (-1331.445) [-1323.898] (-1328.340) (-1321.913) -- 0:00:40
867000 -- [-1312.739] (-1316.522) (-1329.640) (-1326.206) * (-1321.297) (-1316.112) [-1316.268] (-1321.823) -- 0:00:40
867500 -- (-1319.184) (-1317.128) [-1311.038] (-1321.651) * (-1316.464) (-1325.684) [-1319.754] (-1322.989) -- 0:00:40
868000 -- (-1315.897) (-1322.830) (-1328.166) [-1313.968] * (-1330.524) (-1319.117) (-1329.466) [-1317.748] -- 0:00:39
868500 -- (-1318.978) (-1325.507) (-1320.382) [-1316.026] * (-1326.970) (-1319.888) [-1313.685] (-1318.409) -- 0:00:39
869000 -- (-1321.460) [-1318.866] (-1334.434) (-1320.249) * (-1321.069) (-1321.065) [-1318.960] (-1320.081) -- 0:00:39
869500 -- (-1321.869) (-1316.496) (-1322.078) [-1317.377] * (-1326.799) [-1327.431] (-1326.265) (-1316.414) -- 0:00:39
870000 -- (-1318.574) [-1312.545] (-1321.084) (-1328.631) * [-1321.791] (-1315.789) (-1320.681) (-1315.778) -- 0:00:39
Average standard deviation of split frequencies: 0.008257
870500 -- (-1315.600) [-1314.773] (-1325.725) (-1321.812) * (-1320.293) [-1319.270] (-1324.294) (-1322.053) -- 0:00:39
871000 -- (-1319.392) (-1321.033) (-1323.746) [-1322.643] * (-1313.281) (-1321.658) [-1321.313] (-1326.171) -- 0:00:39
871500 -- (-1319.148) [-1324.407] (-1323.780) (-1311.019) * (-1315.249) [-1319.534] (-1323.028) (-1320.560) -- 0:00:38
872000 -- (-1310.598) (-1320.300) (-1329.001) [-1323.342] * (-1319.760) [-1313.335] (-1326.421) (-1330.769) -- 0:00:38
872500 -- [-1320.512] (-1318.154) (-1323.052) (-1311.871) * (-1324.616) [-1319.416] (-1317.313) (-1317.955) -- 0:00:38
873000 -- (-1312.947) (-1315.441) (-1332.515) [-1314.851] * (-1322.776) (-1316.056) (-1317.506) [-1326.658] -- 0:00:38
873500 -- (-1318.403) [-1320.728] (-1319.525) (-1321.755) * (-1312.784) (-1328.766) (-1324.771) [-1324.652] -- 0:00:38
874000 -- (-1313.842) [-1317.681] (-1318.073) (-1320.352) * (-1317.480) [-1319.740] (-1311.262) (-1318.311) -- 0:00:38
874500 -- (-1319.374) (-1315.720) [-1312.713] (-1330.127) * (-1320.402) (-1346.588) (-1316.482) [-1314.303] -- 0:00:38
875000 -- [-1314.189] (-1319.399) (-1313.448) (-1324.550) * (-1334.656) [-1316.966] (-1314.158) (-1332.442) -- 0:00:38
Average standard deviation of split frequencies: 0.008341
875500 -- [-1325.115] (-1335.107) (-1320.598) (-1320.465) * (-1319.014) (-1321.005) (-1317.026) [-1313.421] -- 0:00:37
876000 -- (-1319.581) (-1320.204) (-1318.860) [-1316.222] * (-1320.763) (-1316.119) (-1329.449) [-1324.254] -- 0:00:37
876500 -- [-1320.892] (-1318.126) (-1322.709) (-1320.216) * (-1318.137) (-1314.896) [-1310.966] (-1324.720) -- 0:00:37
877000 -- (-1324.160) (-1320.268) [-1316.503] (-1323.116) * (-1318.013) [-1325.800] (-1328.552) (-1324.298) -- 0:00:37
877500 -- [-1325.135] (-1320.871) (-1321.011) (-1328.913) * (-1321.680) [-1318.007] (-1317.796) (-1325.588) -- 0:00:37
878000 -- (-1316.700) (-1318.778) (-1317.675) [-1315.105] * (-1319.124) (-1320.939) [-1315.478] (-1325.342) -- 0:00:37
878500 -- (-1326.789) [-1323.328] (-1318.702) (-1323.975) * (-1321.176) [-1318.468] (-1322.526) (-1316.873) -- 0:00:36
879000 -- [-1330.563] (-1322.683) (-1319.446) (-1323.509) * (-1327.439) (-1314.668) [-1311.050] (-1330.609) -- 0:00:36
879500 -- (-1323.946) (-1313.894) [-1318.013] (-1315.508) * (-1328.649) (-1331.041) (-1321.740) [-1314.304] -- 0:00:36
880000 -- (-1319.658) (-1318.275) (-1318.736) [-1318.235] * (-1324.628) (-1320.999) [-1316.358] (-1323.141) -- 0:00:36
Average standard deviation of split frequencies: 0.008866
880500 -- (-1315.431) [-1312.651] (-1315.613) (-1320.132) * (-1320.091) (-1336.262) (-1313.485) [-1321.681] -- 0:00:36
881000 -- (-1320.542) (-1328.319) (-1308.950) [-1312.020] * (-1312.371) (-1322.452) [-1316.384] (-1324.616) -- 0:00:36
881500 -- (-1323.003) (-1314.360) [-1313.601] (-1322.597) * [-1319.998] (-1318.682) (-1325.719) (-1323.471) -- 0:00:36
882000 -- (-1321.837) [-1314.523] (-1317.163) (-1313.516) * (-1314.289) [-1313.687] (-1324.101) (-1308.532) -- 0:00:35
882500 -- (-1316.490) (-1322.337) [-1316.908] (-1322.236) * (-1319.760) [-1315.148] (-1318.131) (-1322.807) -- 0:00:35
883000 -- (-1328.499) [-1314.587] (-1327.652) (-1317.201) * (-1319.011) (-1318.137) [-1318.967] (-1319.381) -- 0:00:35
883500 -- (-1325.351) [-1317.353] (-1322.475) (-1315.400) * [-1320.470] (-1319.207) (-1324.975) (-1337.997) -- 0:00:35
884000 -- [-1316.388] (-1324.470) (-1320.127) (-1314.900) * (-1323.923) [-1316.270] (-1322.954) (-1319.860) -- 0:00:35
884500 -- (-1312.864) [-1315.238] (-1315.246) (-1328.143) * (-1319.325) [-1320.848] (-1317.398) (-1322.014) -- 0:00:35
885000 -- (-1313.854) (-1319.971) [-1319.686] (-1322.036) * (-1324.249) (-1314.318) (-1319.480) [-1317.615] -- 0:00:34
Average standard deviation of split frequencies: 0.008480
885500 -- (-1326.144) [-1313.030] (-1319.786) (-1322.333) * [-1312.715] (-1311.761) (-1330.858) (-1323.665) -- 0:00:34
886000 -- [-1317.117] (-1317.785) (-1322.608) (-1324.268) * [-1315.979] (-1315.573) (-1318.660) (-1311.826) -- 0:00:34
886500 -- (-1329.165) (-1323.283) [-1319.054] (-1322.265) * (-1322.389) [-1313.873] (-1322.342) (-1326.144) -- 0:00:34
887000 -- [-1320.504] (-1316.565) (-1315.222) (-1322.637) * (-1322.529) (-1325.267) [-1310.777] (-1326.841) -- 0:00:34
887500 -- (-1318.727) (-1322.894) [-1317.397] (-1316.068) * (-1323.298) (-1320.202) [-1313.166] (-1326.540) -- 0:00:34
888000 -- (-1317.053) (-1316.670) (-1313.353) [-1319.821] * (-1315.484) (-1325.434) [-1318.231] (-1322.769) -- 0:00:34
888500 -- (-1313.860) (-1320.165) [-1314.438] (-1313.271) * (-1317.256) (-1322.484) [-1313.440] (-1319.438) -- 0:00:33
889000 -- [-1321.732] (-1326.288) (-1318.815) (-1315.701) * (-1320.269) (-1314.305) (-1319.021) [-1319.633] -- 0:00:33
889500 -- (-1322.475) (-1323.671) [-1325.296] (-1318.940) * (-1329.467) [-1316.755] (-1328.881) (-1313.415) -- 0:00:33
890000 -- (-1324.756) (-1319.181) (-1319.173) [-1314.886] * (-1326.641) [-1319.188] (-1323.388) (-1330.677) -- 0:00:33
Average standard deviation of split frequencies: 0.008568
890500 -- (-1312.997) (-1321.207) (-1328.056) [-1319.141] * (-1322.204) [-1308.807] (-1319.608) (-1325.394) -- 0:00:33
891000 -- [-1319.539] (-1315.002) (-1317.746) (-1323.369) * [-1313.453] (-1321.647) (-1323.174) (-1331.757) -- 0:00:33
891500 -- (-1322.137) (-1316.065) [-1318.496] (-1323.403) * (-1330.458) (-1318.408) [-1313.125] (-1324.944) -- 0:00:32
892000 -- (-1330.905) (-1321.100) [-1319.489] (-1313.847) * (-1321.751) [-1310.687] (-1333.208) (-1315.282) -- 0:00:32
892500 -- (-1319.999) (-1312.791) [-1309.652] (-1323.457) * (-1317.538) (-1326.225) (-1316.633) [-1317.816] -- 0:00:32
893000 -- (-1310.597) (-1331.398) [-1312.901] (-1323.294) * [-1316.666] (-1321.304) (-1312.408) (-1325.645) -- 0:00:32
893500 -- (-1325.903) [-1317.489] (-1316.984) (-1320.560) * (-1322.402) (-1318.339) [-1309.551] (-1325.719) -- 0:00:32
894000 -- (-1318.774) (-1322.960) (-1322.948) [-1308.007] * (-1327.102) (-1312.969) (-1319.469) [-1318.421] -- 0:00:32
894500 -- [-1327.674] (-1318.253) (-1320.680) (-1313.577) * (-1330.914) (-1317.776) (-1317.677) [-1309.860] -- 0:00:32
895000 -- (-1327.102) (-1321.464) (-1323.439) [-1315.320] * (-1317.534) (-1331.472) (-1315.087) [-1323.138] -- 0:00:31
Average standard deviation of split frequencies: 0.008023
895500 -- [-1316.234] (-1312.727) (-1315.108) (-1319.772) * [-1324.432] (-1319.025) (-1340.245) (-1324.613) -- 0:00:31
896000 -- [-1313.858] (-1320.918) (-1318.589) (-1319.356) * (-1327.594) (-1314.559) (-1314.773) [-1312.366] -- 0:00:31
896500 -- (-1318.619) (-1317.280) (-1319.684) [-1316.535] * [-1317.408] (-1323.846) (-1321.630) (-1321.916) -- 0:00:31
897000 -- [-1315.927] (-1320.345) (-1320.296) (-1314.715) * (-1322.863) (-1330.432) [-1319.568] (-1324.437) -- 0:00:31
897500 -- (-1315.934) (-1320.205) (-1315.762) [-1313.578] * [-1317.384] (-1322.577) (-1320.081) (-1319.409) -- 0:00:31
898000 -- [-1329.391] (-1319.331) (-1315.698) (-1315.769) * (-1315.412) (-1316.963) (-1321.751) [-1312.360] -- 0:00:31
898500 -- (-1329.537) (-1315.619) (-1320.456) [-1311.856] * (-1321.993) (-1315.262) [-1308.930] (-1317.872) -- 0:00:30
899000 -- (-1328.496) [-1321.356] (-1319.677) (-1317.868) * (-1337.869) [-1316.059] (-1314.965) (-1323.066) -- 0:00:30
899500 -- [-1318.116] (-1315.500) (-1329.838) (-1327.684) * (-1324.772) (-1320.281) [-1313.367] (-1320.027) -- 0:00:30
900000 -- [-1317.342] (-1313.557) (-1328.114) (-1321.672) * (-1321.758) (-1316.785) [-1312.795] (-1315.898) -- 0:00:30
Average standard deviation of split frequencies: 0.007328
900500 -- [-1315.538] (-1324.067) (-1314.709) (-1315.512) * (-1317.736) [-1315.859] (-1318.399) (-1324.715) -- 0:00:30
901000 -- (-1320.936) [-1321.238] (-1320.569) (-1334.705) * (-1315.296) (-1318.789) [-1318.917] (-1324.735) -- 0:00:30
901500 -- [-1312.127] (-1316.925) (-1327.312) (-1327.523) * (-1315.235) [-1313.813] (-1316.912) (-1312.535) -- 0:00:29
902000 -- [-1313.479] (-1321.506) (-1319.668) (-1313.018) * [-1316.455] (-1316.556) (-1325.721) (-1328.333) -- 0:00:29
902500 -- (-1311.153) (-1326.511) [-1314.292] (-1317.521) * (-1312.306) (-1322.771) (-1323.303) [-1328.394] -- 0:00:29
903000 -- (-1325.325) (-1312.389) (-1318.702) [-1319.569] * (-1318.867) [-1309.802] (-1322.570) (-1325.119) -- 0:00:29
903500 -- (-1330.829) [-1322.540] (-1322.867) (-1324.741) * (-1312.123) [-1309.956] (-1320.955) (-1320.401) -- 0:00:29
904000 -- (-1335.188) [-1315.202] (-1315.563) (-1334.529) * (-1311.160) [-1313.702] (-1323.568) (-1323.637) -- 0:00:29
904500 -- (-1328.825) [-1316.867] (-1309.369) (-1318.997) * (-1314.780) (-1325.030) (-1317.800) [-1317.351] -- 0:00:29
905000 -- (-1317.653) (-1311.893) [-1315.550] (-1327.527) * (-1323.149) (-1317.190) (-1322.456) [-1324.449] -- 0:00:28
Average standard deviation of split frequencies: 0.007252
905500 -- [-1312.171] (-1324.777) (-1326.352) (-1310.910) * (-1317.836) [-1314.978] (-1315.928) (-1342.506) -- 0:00:28
906000 -- (-1320.704) (-1317.592) [-1317.541] (-1320.442) * [-1312.148] (-1313.205) (-1314.944) (-1318.824) -- 0:00:28
906500 -- (-1321.912) (-1325.667) (-1328.717) [-1312.801] * (-1316.609) (-1318.860) (-1322.194) [-1306.054] -- 0:00:28
907000 -- (-1324.488) (-1322.482) (-1327.881) [-1318.198] * (-1317.498) (-1321.125) (-1317.959) [-1318.218] -- 0:00:28
907500 -- [-1310.982] (-1319.534) (-1325.470) (-1312.564) * [-1314.984] (-1319.060) (-1322.336) (-1318.975) -- 0:00:28
908000 -- (-1320.716) [-1320.445] (-1316.024) (-1319.724) * (-1315.837) (-1325.030) [-1319.723] (-1325.582) -- 0:00:27
908500 -- [-1318.167] (-1320.270) (-1317.556) (-1311.453) * (-1310.720) [-1320.296] (-1324.882) (-1324.536) -- 0:00:27
909000 -- [-1317.528] (-1319.073) (-1319.744) (-1315.725) * (-1328.289) [-1313.603] (-1338.079) (-1318.375) -- 0:00:27
909500 -- [-1317.137] (-1323.039) (-1320.229) (-1328.958) * (-1319.530) (-1326.796) (-1322.656) [-1314.489] -- 0:00:27
910000 -- [-1311.609] (-1330.977) (-1326.035) (-1328.239) * [-1328.495] (-1315.087) (-1324.823) (-1319.977) -- 0:00:27
Average standard deviation of split frequencies: 0.006794
910500 -- (-1321.678) (-1323.248) [-1319.700] (-1322.774) * [-1324.252] (-1336.805) (-1318.032) (-1323.765) -- 0:00:27
911000 -- (-1329.226) (-1325.943) [-1320.444] (-1333.329) * [-1314.219] (-1319.572) (-1315.033) (-1319.333) -- 0:00:27
911500 -- (-1324.747) [-1328.934] (-1322.226) (-1315.707) * (-1312.898) (-1313.390) (-1311.352) [-1311.123] -- 0:00:26
912000 -- (-1317.372) (-1317.845) [-1322.486] (-1319.435) * (-1318.223) (-1315.389) [-1312.907] (-1315.063) -- 0:00:26
912500 -- (-1318.591) (-1317.682) [-1318.474] (-1315.080) * (-1311.894) (-1331.410) (-1312.502) [-1313.960] -- 0:00:26
913000 -- (-1316.662) (-1340.285) (-1316.730) [-1318.622] * (-1317.347) (-1329.606) [-1314.389] (-1317.963) -- 0:00:26
913500 -- (-1319.124) (-1325.037) (-1320.479) [-1318.327] * (-1315.711) (-1316.150) (-1321.346) [-1313.675] -- 0:00:26
914000 -- (-1313.989) (-1330.532) (-1335.809) [-1314.686] * [-1315.111] (-1326.312) (-1320.130) (-1323.295) -- 0:00:26
914500 -- (-1318.659) [-1316.526] (-1328.251) (-1319.355) * (-1327.078) (-1330.266) [-1311.620] (-1314.115) -- 0:00:25
915000 -- (-1317.268) [-1320.076] (-1320.206) (-1339.345) * (-1317.469) (-1329.832) [-1320.552] (-1318.709) -- 0:00:25
Average standard deviation of split frequencies: 0.007205
915500 -- (-1332.867) (-1318.299) [-1317.760] (-1329.835) * (-1320.821) (-1320.562) [-1314.841] (-1319.523) -- 0:00:25
916000 -- (-1315.372) [-1309.819] (-1336.360) (-1327.336) * (-1320.855) (-1327.603) [-1319.577] (-1318.664) -- 0:00:25
916500 -- (-1319.316) [-1324.837] (-1334.493) (-1319.182) * (-1308.218) [-1324.796] (-1318.438) (-1325.866) -- 0:00:25
917000 -- (-1322.150) [-1315.152] (-1320.312) (-1329.004) * (-1311.912) (-1330.952) [-1320.010] (-1320.696) -- 0:00:25
917500 -- (-1319.803) (-1321.418) [-1313.712] (-1325.537) * (-1309.288) (-1323.007) [-1326.398] (-1328.181) -- 0:00:25
918000 -- [-1310.619] (-1324.954) (-1322.677) (-1324.240) * [-1317.961] (-1331.119) (-1322.394) (-1332.442) -- 0:00:25
918500 -- (-1322.972) (-1320.619) [-1320.501] (-1321.907) * (-1315.100) [-1320.129] (-1315.609) (-1323.346) -- 0:00:24
919000 -- (-1322.660) (-1318.006) (-1315.571) [-1310.638] * (-1319.965) (-1321.737) (-1311.492) [-1325.167] -- 0:00:24
919500 -- (-1336.746) (-1318.622) (-1319.383) [-1314.057] * (-1321.107) (-1330.781) [-1326.584] (-1315.113) -- 0:00:24
920000 -- (-1311.657) (-1315.225) [-1317.401] (-1321.055) * (-1315.922) [-1316.900] (-1318.466) (-1316.293) -- 0:00:24
Average standard deviation of split frequencies: 0.007296
920500 -- (-1317.365) (-1338.608) [-1312.603] (-1321.346) * (-1315.301) (-1316.524) (-1319.480) [-1314.907] -- 0:00:24
921000 -- (-1315.425) (-1319.456) [-1322.367] (-1324.916) * [-1320.680] (-1327.426) (-1315.770) (-1316.771) -- 0:00:24
921500 -- (-1326.498) (-1317.318) (-1318.142) [-1317.107] * (-1320.533) (-1325.221) (-1319.628) [-1315.989] -- 0:00:23
922000 -- (-1333.049) (-1310.248) [-1316.620] (-1310.721) * (-1324.892) (-1327.576) (-1320.063) [-1316.001] -- 0:00:23
922500 -- (-1323.270) [-1320.846] (-1323.907) (-1315.752) * (-1328.721) (-1321.611) (-1317.910) [-1318.814] -- 0:00:23
923000 -- (-1324.538) (-1323.008) (-1317.589) [-1317.324] * (-1329.555) [-1323.824] (-1328.158) (-1319.947) -- 0:00:23
923500 -- (-1319.250) (-1314.208) (-1329.456) [-1318.667] * (-1321.441) [-1321.571] (-1316.563) (-1323.839) -- 0:00:23
924000 -- [-1319.086] (-1313.449) (-1320.940) (-1314.896) * (-1324.867) [-1318.812] (-1310.509) (-1326.827) -- 0:00:23
924500 -- (-1336.606) (-1317.449) [-1312.036] (-1320.623) * (-1318.101) [-1315.956] (-1316.174) (-1337.517) -- 0:00:23
925000 -- (-1327.178) (-1322.662) (-1317.068) [-1328.689] * [-1320.375] (-1320.123) (-1318.410) (-1320.714) -- 0:00:22
Average standard deviation of split frequencies: 0.007509
925500 -- (-1334.903) (-1313.640) (-1313.148) [-1321.137] * (-1326.291) [-1313.464] (-1325.729) (-1330.299) -- 0:00:22
926000 -- (-1334.076) (-1313.293) (-1322.574) [-1314.173] * (-1317.473) (-1312.408) (-1334.502) [-1323.491] -- 0:00:22
926500 -- (-1312.984) (-1328.667) [-1314.275] (-1318.877) * (-1317.398) (-1312.311) (-1334.553) [-1318.296] -- 0:00:22
927000 -- (-1313.121) [-1320.027] (-1311.783) (-1319.325) * (-1321.788) (-1323.923) [-1322.510] (-1314.901) -- 0:00:22
927500 -- (-1333.186) (-1317.214) (-1320.542) [-1315.026] * [-1314.925] (-1317.941) (-1312.028) (-1315.679) -- 0:00:22
928000 -- (-1319.432) (-1317.090) [-1320.662] (-1315.147) * (-1314.793) [-1316.934] (-1323.694) (-1319.410) -- 0:00:21
928500 -- [-1318.466] (-1316.924) (-1316.516) (-1316.675) * (-1321.665) (-1313.313) (-1323.228) [-1316.812] -- 0:00:21
929000 -- (-1322.398) (-1317.604) [-1320.151] (-1317.740) * (-1313.858) (-1327.108) (-1322.415) [-1317.999] -- 0:00:21
929500 -- (-1318.376) (-1326.584) (-1320.102) [-1314.232] * [-1315.746] (-1315.075) (-1319.260) (-1311.000) -- 0:00:21
930000 -- (-1316.182) (-1326.543) (-1323.401) [-1317.977] * (-1315.755) [-1317.777] (-1328.174) (-1314.715) -- 0:00:21
Average standard deviation of split frequencies: 0.007408
930500 -- (-1320.189) (-1325.100) [-1319.166] (-1323.431) * [-1315.140] (-1312.423) (-1329.087) (-1321.440) -- 0:00:21
931000 -- (-1317.017) (-1316.923) (-1322.752) [-1313.930] * (-1321.986) (-1314.992) [-1319.941] (-1317.714) -- 0:00:21
931500 -- (-1327.931) (-1321.915) (-1330.115) [-1308.245] * (-1328.189) (-1322.490) [-1315.280] (-1324.482) -- 0:00:20
932000 -- [-1313.915] (-1316.425) (-1323.264) (-1329.620) * [-1323.170] (-1320.987) (-1318.769) (-1319.758) -- 0:00:20
932500 -- (-1319.631) (-1319.884) [-1325.744] (-1319.493) * (-1319.710) (-1327.195) [-1319.988] (-1314.080) -- 0:00:20
933000 -- [-1313.365] (-1323.056) (-1322.618) (-1320.529) * (-1323.912) [-1307.783] (-1322.443) (-1322.287) -- 0:00:20
933500 -- (-1322.435) [-1323.843] (-1324.039) (-1331.546) * (-1321.780) (-1312.958) [-1325.187] (-1318.076) -- 0:00:20
934000 -- (-1319.041) (-1317.640) [-1316.294] (-1327.546) * (-1322.812) (-1320.576) (-1325.677) [-1314.436] -- 0:00:20
934500 -- (-1314.516) (-1321.220) [-1314.361] (-1312.548) * (-1318.094) [-1316.229] (-1319.832) (-1318.232) -- 0:00:19
935000 -- (-1317.808) (-1318.015) (-1330.779) [-1310.247] * (-1327.782) [-1315.288] (-1319.070) (-1319.948) -- 0:00:19
Average standard deviation of split frequencies: 0.006925
935500 -- (-1315.684) [-1323.864] (-1322.235) (-1332.465) * [-1312.108] (-1324.305) (-1317.479) (-1318.686) -- 0:00:19
936000 -- (-1316.508) (-1316.680) (-1319.762) [-1316.340] * (-1312.584) (-1328.167) (-1314.745) [-1311.034] -- 0:00:19
936500 -- (-1325.110) (-1317.394) (-1325.681) [-1322.184] * (-1318.211) (-1319.354) (-1315.514) [-1314.270] -- 0:00:19
937000 -- (-1324.680) (-1317.556) [-1317.090] (-1322.561) * (-1317.642) [-1320.070] (-1328.110) (-1319.279) -- 0:00:19
937500 -- (-1322.069) (-1326.875) (-1319.324) [-1316.033] * (-1321.907) (-1320.711) (-1329.318) [-1320.513] -- 0:00:19
938000 -- (-1312.480) (-1321.021) (-1314.352) [-1320.805] * (-1322.429) [-1310.562] (-1315.599) (-1321.699) -- 0:00:18
938500 -- (-1318.102) [-1313.335] (-1314.868) (-1328.524) * [-1318.295] (-1321.842) (-1319.348) (-1321.651) -- 0:00:18
939000 -- (-1329.660) (-1326.704) [-1312.902] (-1314.855) * (-1322.871) (-1316.335) [-1319.575] (-1320.500) -- 0:00:18
939500 -- (-1325.213) (-1318.265) [-1319.872] (-1318.395) * (-1312.843) [-1317.283] (-1315.204) (-1315.318) -- 0:00:18
940000 -- (-1328.422) (-1316.063) [-1315.054] (-1311.239) * (-1322.095) (-1315.043) (-1325.137) [-1317.992] -- 0:00:18
Average standard deviation of split frequencies: 0.006390
940500 -- (-1314.894) (-1321.193) (-1321.541) [-1312.945] * [-1322.602] (-1314.441) (-1338.054) (-1322.499) -- 0:00:18
941000 -- (-1322.576) (-1322.399) (-1323.502) [-1315.853] * (-1317.399) (-1324.893) (-1319.930) [-1318.832] -- 0:00:17
941500 -- (-1319.380) [-1309.923] (-1331.668) (-1319.989) * (-1318.189) [-1326.994] (-1320.641) (-1318.116) -- 0:00:17
942000 -- (-1329.270) (-1322.926) [-1320.447] (-1327.213) * (-1318.667) [-1312.850] (-1324.351) (-1331.197) -- 0:00:17
942500 -- (-1313.593) (-1320.815) (-1329.686) [-1314.957] * (-1321.454) (-1319.113) (-1320.030) [-1312.092] -- 0:00:17
943000 -- (-1314.514) (-1332.781) (-1322.801) [-1309.030] * (-1318.873) [-1318.306] (-1321.384) (-1315.889) -- 0:00:17
943500 -- (-1316.536) (-1317.126) [-1316.585] (-1322.298) * (-1316.431) (-1319.070) (-1319.679) [-1319.161] -- 0:00:17
944000 -- (-1310.587) (-1324.862) (-1315.421) [-1321.495] * (-1338.869) [-1313.373] (-1314.833) (-1313.596) -- 0:00:17
944500 -- (-1314.265) (-1314.826) (-1328.559) [-1322.730] * (-1321.310) (-1318.767) (-1320.708) [-1316.395] -- 0:00:16
945000 -- (-1327.888) (-1327.905) (-1322.029) [-1319.578] * (-1320.288) [-1325.372] (-1319.121) (-1320.931) -- 0:00:16
Average standard deviation of split frequencies: 0.006537
945500 -- (-1321.901) [-1306.442] (-1317.062) (-1319.280) * (-1321.742) (-1321.738) (-1317.335) [-1314.842] -- 0:00:16
946000 -- (-1311.705) [-1309.518] (-1320.299) (-1325.481) * [-1314.339] (-1319.926) (-1324.446) (-1317.214) -- 0:00:16
946500 -- (-1320.442) (-1320.787) (-1317.319) [-1316.895] * (-1321.792) (-1319.537) [-1312.849] (-1321.204) -- 0:00:16
947000 -- (-1319.912) (-1319.845) [-1310.645] (-1317.187) * (-1312.520) (-1327.360) (-1325.920) [-1317.931] -- 0:00:16
947500 -- (-1316.820) (-1320.000) (-1324.869) [-1320.025] * (-1331.741) [-1317.400] (-1327.040) (-1324.125) -- 0:00:16
948000 -- (-1316.683) (-1319.705) (-1324.691) [-1318.584] * (-1317.971) (-1321.229) (-1319.561) [-1319.333] -- 0:00:15
948500 -- (-1321.812) [-1312.994] (-1322.134) (-1317.152) * (-1316.863) [-1320.445] (-1320.676) (-1320.115) -- 0:00:15
949000 -- (-1321.488) (-1322.767) [-1318.574] (-1317.857) * [-1316.551] (-1327.822) (-1325.200) (-1319.333) -- 0:00:15
949500 -- (-1323.762) (-1320.155) (-1320.790) [-1312.483] * (-1316.001) (-1324.418) (-1315.734) [-1327.810] -- 0:00:15
950000 -- (-1320.882) [-1312.590] (-1330.332) (-1320.585) * (-1320.897) (-1315.121) [-1313.638] (-1327.773) -- 0:00:15
Average standard deviation of split frequencies: 0.006913
950500 -- (-1323.701) (-1312.124) (-1326.743) [-1321.389] * (-1317.073) (-1316.369) [-1318.424] (-1326.722) -- 0:00:15
951000 -- (-1314.249) [-1312.080] (-1324.115) (-1323.057) * (-1320.677) (-1329.248) (-1322.820) [-1316.781] -- 0:00:14
951500 -- [-1317.995] (-1316.694) (-1345.799) (-1315.776) * (-1319.562) (-1323.178) [-1317.998] (-1314.489) -- 0:00:14
952000 -- [-1315.968] (-1323.576) (-1326.471) (-1319.003) * (-1320.161) [-1318.051] (-1329.577) (-1326.008) -- 0:00:14
952500 -- (-1315.235) [-1321.219] (-1316.447) (-1325.167) * (-1324.390) [-1323.906] (-1331.232) (-1314.771) -- 0:00:14
953000 -- (-1316.675) (-1321.862) [-1308.650] (-1324.919) * (-1321.671) [-1322.586] (-1318.347) (-1317.682) -- 0:00:14
953500 -- (-1323.274) (-1319.793) [-1306.994] (-1314.489) * (-1323.600) [-1315.553] (-1323.745) (-1321.982) -- 0:00:14
954000 -- (-1332.676) [-1319.607] (-1313.137) (-1325.617) * (-1316.259) [-1315.434] (-1323.413) (-1332.593) -- 0:00:14
954500 -- (-1319.703) (-1318.351) (-1319.061) [-1317.790] * (-1318.832) (-1327.122) (-1326.222) [-1317.743] -- 0:00:13
955000 -- (-1317.470) (-1320.980) [-1315.167] (-1314.263) * (-1333.590) [-1322.630] (-1318.232) (-1323.414) -- 0:00:13
Average standard deviation of split frequencies: 0.007199
955500 -- [-1317.201] (-1317.046) (-1317.542) (-1317.759) * (-1318.251) (-1321.429) [-1316.410] (-1323.729) -- 0:00:13
956000 -- (-1314.159) (-1312.169) [-1318.960] (-1322.596) * (-1326.655) (-1319.547) (-1323.254) [-1313.703] -- 0:00:13
956500 -- (-1332.471) (-1316.898) [-1308.552] (-1325.634) * (-1324.765) [-1316.725] (-1317.724) (-1314.132) -- 0:00:13
957000 -- [-1313.047] (-1331.032) (-1313.792) (-1318.976) * (-1322.349) (-1316.915) (-1320.432) [-1310.697] -- 0:00:13
957500 -- [-1328.917] (-1325.862) (-1325.337) (-1323.944) * (-1318.066) (-1320.349) [-1313.466] (-1329.542) -- 0:00:12
958000 -- (-1326.931) (-1324.659) [-1324.550] (-1328.946) * (-1330.272) (-1323.863) (-1316.968) [-1317.772] -- 0:00:12
958500 -- (-1313.279) (-1325.497) [-1314.313] (-1321.395) * (-1323.698) [-1322.095] (-1328.775) (-1320.200) -- 0:00:12
959000 -- [-1318.310] (-1317.301) (-1310.221) (-1325.693) * (-1328.753) (-1322.449) (-1321.200) [-1317.465] -- 0:00:12
959500 -- [-1311.469] (-1324.066) (-1331.724) (-1331.865) * [-1332.741] (-1316.509) (-1321.982) (-1319.696) -- 0:00:12
960000 -- [-1316.148] (-1323.291) (-1317.063) (-1324.804) * (-1320.976) (-1323.106) (-1319.712) [-1310.318] -- 0:00:12
Average standard deviation of split frequencies: 0.006812
960500 -- (-1324.368) (-1317.489) (-1323.197) [-1315.426] * (-1322.073) [-1317.701] (-1331.259) (-1317.670) -- 0:00:12
961000 -- (-1323.376) (-1320.646) (-1325.378) [-1320.380] * (-1319.752) (-1321.661) (-1324.348) [-1324.594] -- 0:00:11
961500 -- (-1319.063) (-1322.773) [-1318.843] (-1316.034) * (-1338.991) (-1320.473) [-1323.684] (-1319.710) -- 0:00:11
962000 -- (-1325.325) (-1320.442) (-1319.044) [-1319.210] * [-1319.046] (-1317.984) (-1315.390) (-1316.445) -- 0:00:11
962500 -- (-1329.414) [-1311.470] (-1324.593) (-1325.744) * (-1324.357) [-1314.810] (-1319.701) (-1316.528) -- 0:00:11
963000 -- (-1318.235) [-1314.685] (-1314.844) (-1323.906) * (-1327.840) (-1324.112) [-1320.877] (-1320.339) -- 0:00:11
963500 -- (-1326.367) (-1315.758) (-1322.395) [-1317.077] * [-1319.484] (-1318.778) (-1314.029) (-1322.906) -- 0:00:11
964000 -- (-1321.862) (-1314.812) (-1327.249) [-1310.682] * (-1320.351) [-1308.789] (-1324.484) (-1325.443) -- 0:00:10
964500 -- (-1319.079) (-1323.597) (-1318.252) [-1313.382] * (-1311.573) (-1314.095) (-1322.002) [-1319.566] -- 0:00:10
965000 -- (-1317.168) (-1328.195) (-1306.998) [-1313.747] * (-1315.278) (-1312.430) (-1324.157) [-1319.884] -- 0:00:10
Average standard deviation of split frequencies: 0.006688
965500 -- (-1319.383) (-1324.823) [-1312.155] (-1327.875) * (-1317.254) (-1323.024) [-1319.658] (-1319.065) -- 0:00:10
966000 -- (-1321.554) [-1317.236] (-1318.757) (-1331.118) * (-1318.122) (-1330.544) (-1319.285) [-1312.765] -- 0:00:10
966500 -- (-1322.929) [-1310.194] (-1315.266) (-1326.086) * (-1321.569) (-1312.464) (-1327.322) [-1324.662] -- 0:00:10
967000 -- (-1313.030) (-1316.309) (-1323.088) [-1316.936] * (-1325.619) (-1325.779) [-1316.720] (-1324.256) -- 0:00:10
967500 -- [-1317.487] (-1315.432) (-1322.142) (-1312.193) * [-1312.290] (-1313.114) (-1323.023) (-1327.607) -- 0:00:09
968000 -- (-1314.804) (-1312.303) (-1321.855) [-1312.903] * [-1313.187] (-1317.972) (-1331.722) (-1328.615) -- 0:00:09
968500 -- [-1313.831] (-1321.007) (-1326.096) (-1312.706) * (-1318.457) (-1324.567) (-1322.817) [-1328.208] -- 0:00:09
969000 -- (-1334.229) (-1320.871) (-1323.374) [-1312.991] * (-1321.833) [-1321.614] (-1327.750) (-1316.079) -- 0:00:09
969500 -- [-1326.998] (-1318.763) (-1336.471) (-1323.722) * (-1319.423) (-1317.104) [-1319.352] (-1310.165) -- 0:00:09
970000 -- (-1327.176) [-1314.398] (-1329.579) (-1327.709) * (-1314.251) (-1323.546) [-1322.286] (-1319.299) -- 0:00:09
Average standard deviation of split frequencies: 0.006647
970500 -- (-1321.270) (-1318.784) [-1321.340] (-1324.301) * (-1312.039) (-1315.851) [-1318.051] (-1327.089) -- 0:00:08
971000 -- (-1317.873) (-1320.616) [-1315.924] (-1322.846) * (-1316.102) [-1316.119] (-1319.930) (-1329.225) -- 0:00:08
971500 -- (-1319.693) [-1315.213] (-1315.744) (-1325.962) * (-1322.176) [-1313.087] (-1319.667) (-1333.868) -- 0:00:08
972000 -- [-1316.922] (-1318.165) (-1319.224) (-1326.911) * [-1322.405] (-1323.629) (-1324.492) (-1317.772) -- 0:00:08
972500 -- (-1318.543) (-1335.422) (-1317.124) [-1321.074] * (-1321.563) (-1327.628) (-1312.667) [-1309.114] -- 0:00:08
973000 -- (-1314.486) [-1309.555] (-1317.244) (-1321.654) * (-1332.206) [-1316.508] (-1317.012) (-1326.806) -- 0:00:08
973500 -- (-1320.505) [-1317.598] (-1316.119) (-1324.250) * (-1328.737) (-1316.374) [-1318.292] (-1319.982) -- 0:00:08
974000 -- (-1320.146) [-1314.202] (-1322.334) (-1336.732) * (-1320.857) (-1317.017) (-1320.763) [-1314.204] -- 0:00:07
974500 -- (-1316.592) [-1317.435] (-1311.452) (-1314.900) * (-1327.693) [-1315.379] (-1317.646) (-1319.474) -- 0:00:07
975000 -- (-1330.185) [-1311.590] (-1313.480) (-1323.715) * [-1318.469] (-1313.669) (-1318.188) (-1318.666) -- 0:00:07
Average standard deviation of split frequencies: 0.007181
975500 -- (-1319.383) (-1321.996) [-1322.375] (-1318.450) * (-1321.784) (-1322.751) [-1314.265] (-1321.889) -- 0:00:07
976000 -- (-1321.012) (-1314.697) (-1311.285) [-1316.278] * (-1331.612) (-1316.064) [-1311.051] (-1317.826) -- 0:00:07
976500 -- (-1312.489) [-1323.817] (-1321.991) (-1315.630) * (-1330.177) (-1318.058) (-1317.917) [-1319.148] -- 0:00:07
977000 -- [-1316.874] (-1325.092) (-1327.678) (-1317.785) * (-1322.750) (-1314.561) (-1317.724) [-1312.652] -- 0:00:07
977500 -- (-1327.725) (-1323.397) (-1313.325) [-1310.247] * (-1322.787) (-1318.120) (-1324.455) [-1319.268] -- 0:00:06
978000 -- (-1321.561) (-1331.287) [-1317.276] (-1320.221) * (-1326.526) (-1320.519) [-1325.565] (-1320.670) -- 0:00:06
978500 -- (-1326.285) (-1322.996) [-1313.105] (-1324.831) * [-1310.463] (-1323.612) (-1322.194) (-1327.451) -- 0:00:06
979000 -- [-1317.632] (-1323.457) (-1315.218) (-1321.374) * [-1318.189] (-1325.730) (-1328.233) (-1320.464) -- 0:00:06
979500 -- [-1323.775] (-1319.228) (-1308.975) (-1314.297) * (-1319.140) [-1327.685] (-1321.625) (-1324.524) -- 0:00:06
980000 -- (-1328.604) [-1315.020] (-1316.747) (-1321.151) * (-1315.216) (-1315.806) (-1318.483) [-1318.145] -- 0:00:06
Average standard deviation of split frequencies: 0.007210
980500 -- (-1325.801) [-1312.003] (-1329.322) (-1319.632) * [-1315.380] (-1314.511) (-1312.309) (-1317.994) -- 0:00:05
981000 -- (-1330.454) (-1314.087) (-1322.413) [-1313.301] * (-1320.875) [-1316.432] (-1322.930) (-1318.840) -- 0:00:05
981500 -- (-1322.058) (-1320.747) [-1311.774] (-1319.257) * (-1314.011) (-1312.340) (-1324.637) [-1313.843] -- 0:00:05
982000 -- (-1313.446) [-1317.184] (-1323.782) (-1321.558) * (-1324.219) (-1315.189) (-1324.221) [-1318.066] -- 0:00:05
982500 -- (-1318.315) (-1333.101) (-1325.886) [-1316.752] * [-1317.253] (-1313.246) (-1316.501) (-1317.161) -- 0:00:05
983000 -- (-1316.130) (-1325.147) (-1318.614) [-1310.837] * [-1313.648] (-1321.804) (-1318.370) (-1324.064) -- 0:00:05
983500 -- (-1319.885) (-1321.792) (-1314.874) [-1313.865] * (-1317.919) [-1316.555] (-1325.519) (-1320.918) -- 0:00:05
984000 -- [-1310.071] (-1319.463) (-1319.159) (-1330.153) * (-1321.278) [-1318.428] (-1320.328) (-1325.427) -- 0:00:04
984500 -- (-1316.704) [-1309.705] (-1317.008) (-1322.511) * [-1319.604] (-1324.288) (-1317.834) (-1335.060) -- 0:00:04
985000 -- [-1319.866] (-1326.029) (-1319.760) (-1322.360) * (-1312.916) (-1315.208) [-1318.068] (-1327.139) -- 0:00:04
Average standard deviation of split frequencies: 0.007873
985500 -- [-1314.898] (-1326.290) (-1321.435) (-1316.337) * (-1314.459) (-1314.246) [-1311.397] (-1323.689) -- 0:00:04
986000 -- [-1312.687] (-1314.054) (-1322.873) (-1310.843) * (-1317.552) [-1318.522] (-1311.348) (-1325.968) -- 0:00:04
986500 -- (-1316.470) [-1325.284] (-1315.825) (-1321.820) * (-1315.273) (-1313.865) [-1315.699] (-1322.564) -- 0:00:04
987000 -- [-1316.003] (-1314.889) (-1315.992) (-1331.046) * (-1325.354) (-1318.183) [-1314.437] (-1317.969) -- 0:00:03
987500 -- (-1322.889) (-1325.285) (-1322.073) [-1319.038] * [-1316.295] (-1331.010) (-1323.996) (-1318.451) -- 0:00:03
988000 -- [-1310.178] (-1326.674) (-1317.270) (-1316.656) * (-1322.602) (-1323.802) [-1316.628] (-1319.944) -- 0:00:03
988500 -- (-1316.328) [-1312.232] (-1321.101) (-1323.482) * (-1315.589) (-1324.182) [-1319.572] (-1310.502) -- 0:00:03
989000 -- (-1322.170) [-1309.071] (-1328.210) (-1322.552) * (-1319.089) [-1326.066] (-1319.616) (-1317.475) -- 0:00:03
989500 -- (-1316.914) (-1319.222) (-1320.736) [-1311.018] * (-1316.313) (-1312.789) [-1318.443] (-1322.087) -- 0:00:03
990000 -- (-1317.839) (-1319.363) (-1326.900) [-1318.071] * (-1322.623) [-1309.542] (-1314.180) (-1323.164) -- 0:00:03
Average standard deviation of split frequencies: 0.007836
990500 -- [-1318.625] (-1316.029) (-1322.651) (-1316.737) * (-1327.149) (-1316.947) [-1316.746] (-1322.809) -- 0:00:02
991000 -- (-1316.327) (-1320.458) (-1327.376) [-1316.455] * (-1317.069) [-1310.641] (-1318.750) (-1325.111) -- 0:00:02
991500 -- (-1316.744) [-1316.502] (-1324.246) (-1326.312) * [-1324.312] (-1317.862) (-1316.605) (-1317.585) -- 0:00:02
992000 -- (-1327.496) [-1312.525] (-1325.607) (-1322.826) * [-1316.542] (-1321.454) (-1310.219) (-1324.099) -- 0:00:02
992500 -- (-1317.000) [-1316.182] (-1318.398) (-1321.831) * (-1321.548) (-1316.593) (-1313.574) [-1315.696] -- 0:00:02
993000 -- (-1317.806) (-1324.656) [-1326.490] (-1315.306) * [-1320.943] (-1315.734) (-1323.008) (-1337.741) -- 0:00:02
993500 -- [-1313.372] (-1321.556) (-1320.143) (-1327.477) * (-1316.793) [-1318.038] (-1320.967) (-1321.636) -- 0:00:01
994000 -- (-1323.262) (-1323.302) (-1317.193) [-1317.541] * (-1329.736) (-1323.233) [-1316.809] (-1317.578) -- 0:00:01
994500 -- (-1313.091) [-1316.166] (-1317.595) (-1327.589) * (-1327.970) [-1316.784] (-1311.909) (-1317.691) -- 0:00:01
995000 -- (-1320.504) (-1318.506) (-1319.836) [-1318.110] * (-1321.491) (-1320.183) [-1318.403] (-1327.887) -- 0:00:01
Average standard deviation of split frequencies: 0.007888
995500 -- [-1319.136] (-1318.701) (-1326.122) (-1322.228) * (-1317.379) (-1321.773) (-1327.689) [-1317.467] -- 0:00:01
996000 -- [-1320.935] (-1322.433) (-1320.741) (-1315.713) * [-1319.573] (-1317.295) (-1316.092) (-1317.618) -- 0:00:01
996500 -- [-1310.672] (-1316.616) (-1328.899) (-1319.992) * (-1310.371) [-1321.841] (-1321.172) (-1311.629) -- 0:00:01
997000 -- (-1320.740) [-1314.931] (-1317.133) (-1321.859) * [-1317.926] (-1317.413) (-1318.148) (-1313.759) -- 0:00:00
997500 -- [-1312.285] (-1316.745) (-1318.948) (-1318.202) * (-1321.630) (-1323.787) (-1343.476) [-1310.507] -- 0:00:00
998000 -- (-1315.134) (-1323.658) [-1311.595] (-1316.856) * (-1316.923) (-1319.380) (-1322.101) [-1314.423] -- 0:00:00
998500 -- [-1318.801] (-1318.974) (-1334.619) (-1318.944) * (-1326.702) [-1325.786] (-1322.259) (-1327.349) -- 0:00:00
999000 -- (-1314.970) (-1325.855) (-1331.864) [-1317.754] * (-1315.866) [-1319.148] (-1328.082) (-1317.680) -- 0:00:00
999500 -- [-1315.752] (-1324.405) (-1311.389) (-1319.541) * [-1312.164] (-1316.172) (-1317.426) (-1319.805) -- 0:00:00
1000000 -- (-1317.245) (-1317.194) [-1312.168] (-1325.248) * [-1319.620] (-1323.897) (-1321.712) (-1319.917) -- 0:00:00
Average standard deviation of split frequencies: 0.007632
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1317.245010 -- 13.317829
Chain 1 -- -1317.245013 -- 13.317829
Chain 2 -- -1317.194491 -- 20.706200
Chain 2 -- -1317.194483 -- 20.706200
Chain 3 -- -1312.167932 -- 22.628435
Chain 3 -- -1312.167932 -- 22.628435
Chain 4 -- -1325.247911 -- 13.722960
Chain 4 -- -1325.247907 -- 13.722960
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1319.619749 -- 17.773619
Chain 1 -- -1319.619761 -- 17.773619
Chain 2 -- -1323.896755 -- 15.339388
Chain 2 -- -1323.896760 -- 15.339388
Chain 3 -- -1321.712436 -- 18.045099
Chain 3 -- -1321.712438 -- 18.045099
Chain 4 -- -1319.916957 -- 18.201383
Chain 4 -- -1319.916955 -- 18.201383
Analysis completed in 5 mins 5 seconds
Analysis used 305.07 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1304.64
Likelihood of best state for "cold" chain of run 2 was -1304.64
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.5 % ( 56 %) Dirichlet(Revmat{all})
72.7 % ( 64 %) Slider(Revmat{all})
29.2 % ( 27 %) Dirichlet(Pi{all})
31.0 % ( 24 %) Slider(Pi{all})
41.6 % ( 17 %) Multiplier(Alpha{1,2})
45.4 % ( 29 %) Multiplier(Alpha{3})
47.1 % ( 27 %) Slider(Pinvar{all})
19.8 % ( 16 %) ExtSPR(Tau{all},V{all})
6.8 % ( 4 %) ExtTBR(Tau{all},V{all})
24.5 % ( 23 %) NNI(Tau{all},V{all})
22.8 % ( 19 %) ParsSPR(Tau{all},V{all})
26.8 % ( 31 %) Multiplier(V{all})
45.6 % ( 54 %) Nodeslider(V{all})
25.8 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.7 % ( 57 %) Dirichlet(Revmat{all})
72.0 % ( 59 %) Slider(Revmat{all})
28.6 % ( 24 %) Dirichlet(Pi{all})
30.3 % ( 26 %) Slider(Pi{all})
42.0 % ( 29 %) Multiplier(Alpha{1,2})
45.2 % ( 27 %) Multiplier(Alpha{3})
47.3 % ( 24 %) Slider(Pinvar{all})
19.6 % ( 22 %) ExtSPR(Tau{all},V{all})
6.8 % ( 7 %) ExtTBR(Tau{all},V{all})
24.4 % ( 28 %) NNI(Tau{all},V{all})
22.4 % ( 15 %) ParsSPR(Tau{all},V{all})
26.8 % ( 20 %) Multiplier(V{all})
45.7 % ( 41 %) Nodeslider(V{all})
26.0 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166813 0.76 0.57
3 | 167001 167113 0.78
4 | 166483 166557 166033
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.54 0.37
2 | 166647 0.76 0.57
3 | 166443 166529 0.78
4 | 166669 166915 166797
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1314.09
| 1 |
| |
| 2 1 |
| 2 2 2 1 1 |
| 1 1 2 11|
| 1 2 1 1 1 2 |
|22 2 11 2 2 1 2 2 1 1 |
|1 1 2 2 1 2 2 1 2 2 2 1 2 |
| 121 1 2 1 111 12 222 1 1 1 2 |
| 1 2 11 22 11 22 112112 22 11 1*2 1 1 2 2|
| 2 * 2 1 1 2 |
| 2 1 2 2 2 22 2 2 |
| 2 21 1 2 1 * 2 1 2 |
| |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1319.58
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1310.85 -1327.52
2 -1311.47 -1331.11
--------------------------------------
TOTAL -1311.11 -1330.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.658259 0.013762 0.453987 0.898559 0.647138 1009.56 1120.62 1.000
r(A<->C){all} 0.072016 0.000830 0.014818 0.126066 0.069147 763.90 809.22 1.000
r(A<->G){all} 0.275334 0.004928 0.148516 0.414109 0.271217 484.17 587.35 1.000
r(A<->T){all} 0.175228 0.004541 0.057077 0.309705 0.166401 534.98 691.52 1.000
r(C<->G){all} 0.092171 0.000713 0.043655 0.143711 0.089392 796.20 964.11 1.000
r(C<->T){all} 0.343812 0.004754 0.221419 0.487133 0.339345 453.04 542.59 1.000
r(G<->T){all} 0.041439 0.000786 0.001222 0.094488 0.035807 623.21 714.04 1.000
pi(A){all} 0.252968 0.000360 0.214356 0.289849 0.252619 929.25 1018.72 1.000
pi(C){all} 0.285897 0.000366 0.250181 0.324510 0.285610 1235.74 1260.97 1.000
pi(G){all} 0.257328 0.000330 0.223823 0.294368 0.257256 1126.34 1195.13 1.000
pi(T){all} 0.203808 0.000294 0.169915 0.236151 0.203150 1125.16 1125.60 1.001
alpha{1,2} 0.074650 0.000782 0.003099 0.115703 0.078576 916.90 1082.64 1.000
alpha{3} 2.516525 0.743213 1.024810 4.121764 2.394605 1443.63 1472.32 1.000
pinvar{all} 0.585627 0.002673 0.482339 0.682849 0.589107 777.25 1068.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ...*******
12 -- .**.......
13 -- .....*****
14 -- ...**.....
15 -- .....**.**
16 -- ........**
17 -- ......***.
18 -- ......*.*.
19 -- .....*.*..
20 -- .....*...*
21 -- .......**.
22 -- ......*.**
23 -- .....**...
24 -- .....****.
25 -- ......****
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3001 0.999667 0.000471 0.999334 1.000000 2
12 2937 0.978348 0.003298 0.976016 0.980680 2
13 2867 0.955030 0.013662 0.945370 0.964690 2
14 2560 0.852765 0.010364 0.845436 0.860093 2
15 1169 0.389407 0.021199 0.374417 0.404397 2
16 949 0.316123 0.006124 0.311792 0.320453 2
17 885 0.294803 0.004240 0.291805 0.297801 2
18 809 0.269487 0.009893 0.262492 0.276482 2
19 770 0.256496 0.009422 0.249833 0.263158 2
20 764 0.254497 0.001884 0.253165 0.255829 2
21 491 0.163558 0.012719 0.154564 0.172552 2
22 441 0.146902 0.006124 0.142572 0.151233 2
23 396 0.131912 0.001884 0.130580 0.133245 2
24 348 0.115923 0.000000 0.115923 0.115923 2
25 286 0.095270 0.013191 0.085943 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.022763 0.000134 0.004703 0.045858 0.020787 1.000 2
length{all}[2] 0.016710 0.000089 0.002981 0.035545 0.014890 1.000 2
length{all}[3] 0.008424 0.000040 0.000005 0.020532 0.007003 1.000 2
length{all}[4] 0.033226 0.000205 0.008651 0.061032 0.030473 1.000 2
length{all}[5] 0.036241 0.000226 0.010863 0.065455 0.033961 1.000 2
length{all}[6] 0.070226 0.000680 0.022318 0.120360 0.067409 1.000 2
length{all}[7] 0.049544 0.000398 0.015195 0.090427 0.046850 1.000 2
length{all}[8] 0.124269 0.001391 0.056057 0.195593 0.118924 1.000 2
length{all}[9] 0.089644 0.001018 0.038972 0.156651 0.084447 1.001 2
length{all}[10] 0.055640 0.000493 0.017116 0.098697 0.051963 1.000 2
length{all}[11] 0.035175 0.000262 0.008661 0.067477 0.032696 1.000 2
length{all}[12] 0.014127 0.000079 0.001390 0.031461 0.012294 1.000 2
length{all}[13] 0.041133 0.000448 0.002128 0.082239 0.038935 1.000 2
length{all}[14] 0.015040 0.000115 0.000107 0.035928 0.012896 1.000 2
length{all}[15] 0.030495 0.000341 0.000016 0.065414 0.026884 0.999 2
length{all}[16] 0.015674 0.000138 0.000030 0.038524 0.013021 1.000 2
length{all}[17] 0.018552 0.000134 0.001931 0.041715 0.016348 0.999 2
length{all}[18] 0.014392 0.000182 0.000025 0.039960 0.010886 0.999 2
length{all}[19] 0.029826 0.000311 0.002858 0.063190 0.026572 1.000 2
length{all}[20] 0.012700 0.000137 0.000030 0.036098 0.009088 1.000 2
length{all}[21] 0.014629 0.000164 0.000011 0.040598 0.011344 0.999 2
length{all}[22] 0.008228 0.000072 0.000019 0.025514 0.005310 0.998 2
length{all}[23] 0.012193 0.000106 0.000222 0.033384 0.009440 0.999 2
length{all}[24] 0.008079 0.000073 0.000038 0.025118 0.004923 1.000 2
length{all}[25] 0.008144 0.000091 0.000020 0.026690 0.005549 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007632
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /----------------------- C4 (4)
| /-----------85----------+
| | \----------------------- C5 (5)
| |
| | /----------------------- C6 (6)
|----------100---------+ |
| | |----------------------- C7 (7)
+ | |
| \-----------96----------+----------------------- C8 (8)
| |
| |----------------------- C9 (9)
| |
| \----------------------- C10 (10)
|
| /----------------------- C2 (2)
\----------------------98----------------------+
\----------------------- C3 (3)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
| /------------ C4 (4)
| /----+
| | \------------- C5 (5)
| |
| | /-------------------------- C6 (6)
|-----------+ |
| | |------------------ C7 (7)
+ | |
| \--------------+--------------------------------------------- C8 (8)
| |
| |-------------------------------- C9 (9)
| |
| \-------------------- C10 (10)
|
| /----- C2 (2)
\----+
\-- C3 (3)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (264 trees sampled):
50 % credible set contains 14 trees
90 % credible set contains 90 trees
95 % credible set contains 136 trees
99 % credible set contains 234 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 522
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
39 ambiguity characters in seq. 9
13 sites are removed. 162 163 164 165 166 167 168 169 170 171 172 173 174
Sequences read..
Counting site patterns.. 0:00
89 patterns at 161 / 161 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
86864 bytes for conP
12104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
217160 bytes for conP, adjusted
0.028829 0.037103 0.015513 0.037822 0.040996 0.042901 0.080160 0.051610 0.119865 0.092145 0.076089 0.010592 0.011757 0.013456 0.300000 1.300000
ntime & nrate & np: 14 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 16
lnL0 = -1358.607643
Iterating by ming2
Initial: fx= 1358.607643
x= 0.02883 0.03710 0.01551 0.03782 0.04100 0.04290 0.08016 0.05161 0.11986 0.09214 0.07609 0.01059 0.01176 0.01346 0.30000 1.30000
1 h-m-p 0.0000 0.0002 212.9695 ++YCCYYC 1354.815400 5 0.0001 31 | 0/16
2 h-m-p 0.0001 0.0007 525.6463 +CYCCC 1344.864131 4 0.0003 58 | 0/16
3 h-m-p 0.0001 0.0005 488.2765 +CYCCCCC 1327.332984 6 0.0004 89 | 0/16
4 h-m-p 0.0000 0.0001 1958.1215 +YCYCCC 1317.146900 5 0.0001 117 | 0/16
5 h-m-p 0.0000 0.0001 4050.4106 +YYYYYYC 1304.749623 6 0.0001 143 | 0/16
6 h-m-p 0.0000 0.0002 338.0020 +YYCYCCC 1302.101402 6 0.0001 172 | 0/16
7 h-m-p 0.0001 0.0008 701.2717 +CCCYC 1281.278939 4 0.0005 200 | 0/16
8 h-m-p 0.0001 0.0004 1029.5545 +YCYCCC 1270.456825 5 0.0002 228 | 0/16
9 h-m-p 0.0001 0.0005 893.3554 +YYYCYYCCC 1235.470051 8 0.0005 259 | 0/16
10 h-m-p 0.0000 0.0000 21362.8226 YCYCCC 1232.903995 5 0.0000 286 | 0/16
11 h-m-p 0.0000 0.0002 250.0357 +YCYCCC 1231.714938 5 0.0001 314 | 0/16
12 h-m-p 0.0001 0.0010 171.9174 YCCCC 1229.648293 4 0.0003 340 | 0/16
13 h-m-p 0.0001 0.0007 289.4124 YCYCCC 1226.216479 5 0.0003 367 | 0/16
14 h-m-p 0.0007 0.0035 46.0532 CCYC 1225.672356 3 0.0007 391 | 0/16
15 h-m-p 0.0025 0.0187 12.4436 CYC 1225.551310 2 0.0009 413 | 0/16
16 h-m-p 0.0012 0.0097 8.9467 YCCC 1225.099249 3 0.0023 437 | 0/16
17 h-m-p 0.0018 0.0088 4.8709 YCYCCC 1220.602679 5 0.0049 464 | 0/16
18 h-m-p 0.0397 0.7929 0.6073 ++YYYCCC 1186.518971 5 0.5858 492 | 0/16
19 h-m-p 0.0547 0.2734 0.5498 CCCCC 1185.183948 4 0.0764 535 | 0/16
20 h-m-p 0.1113 0.9716 0.3777 +YCCC 1174.746120 3 0.3663 576 | 0/16
21 h-m-p 0.3495 1.7474 0.0646 +YCYCC 1170.547924 4 1.0879 618 | 0/16
22 h-m-p 0.4093 2.0467 0.0547 YCCCC 1169.019267 4 0.7639 660 | 0/16
23 h-m-p 0.4190 2.3336 0.0997 YCC 1166.790935 2 0.6399 698 | 0/16
24 h-m-p 0.7565 3.7824 0.0794 YCCCC 1162.937993 4 1.8743 740 | 0/16
25 h-m-p 1.5040 7.9212 0.0990 YCYC 1157.405654 3 2.4730 779 | 0/16
26 h-m-p 0.7941 3.9705 0.0590 YCCCCC 1153.935919 5 1.6302 823 | 0/16
27 h-m-p 0.3828 1.9141 0.0457 +YYCCC 1150.387775 4 1.4448 865 | 0/16
28 h-m-p 0.8354 4.1772 0.0700 YCCC 1147.512690 3 1.6858 905 | 0/16
29 h-m-p 1.1932 5.9661 0.0688 CYCCC 1144.948906 4 2.1349 947 | 0/16
30 h-m-p 0.7762 3.8811 0.0859 CCC 1143.050969 2 1.1457 986 | 0/16
31 h-m-p 1.6000 8.0000 0.0449 YYCCC 1139.660440 4 2.4350 1027 | 0/16
32 h-m-p 1.6000 8.0000 0.0204 CYCCC 1136.834207 4 3.0370 1069 | 0/16
33 h-m-p 1.2036 8.0000 0.0515 ++ 1133.798837 m 8.0000 1104 | 0/16
34 h-m-p 0.6084 3.0420 0.2870 YCCCC 1131.266015 4 1.3690 1146 | 0/16
35 h-m-p 1.1914 5.9572 0.0790 YCCCCC 1129.376520 5 2.4662 1190 | 0/16
36 h-m-p 0.2898 1.4488 0.1692 YCCCC 1128.436552 4 0.6592 1232 | 0/16
37 h-m-p 1.5428 7.7138 0.0399 CCCC 1127.377121 3 1.6189 1273 | 0/16
38 h-m-p 1.6000 8.0000 0.0394 YCCC 1126.440098 3 3.7381 1313 | 0/16
39 h-m-p 1.6000 8.0000 0.0178 YCCC 1126.239992 3 1.0970 1353 | 0/16
40 h-m-p 1.6000 8.0000 0.0041 CC 1126.194939 1 1.7019 1390 | 0/16
41 h-m-p 0.5004 8.0000 0.0140 +CCC 1126.169439 2 2.3993 1430 | 0/16
42 h-m-p 1.6000 8.0000 0.0012 CC 1126.158353 1 2.2098 1467 | 0/16
43 h-m-p 0.3686 8.0000 0.0073 +CC 1126.155099 1 1.3901 1505 | 0/16
44 h-m-p 1.6000 8.0000 0.0011 C 1126.154784 0 1.7341 1540 | 0/16
45 h-m-p 1.6000 8.0000 0.0010 YC 1126.154481 1 2.7320 1576 | 0/16
46 h-m-p 1.6000 8.0000 0.0001 C 1126.154385 0 1.7978 1611 | 0/16
47 h-m-p 0.8977 8.0000 0.0003 C 1126.154374 0 1.2976 1646 | 0/16
48 h-m-p 1.6000 8.0000 0.0000 Y 1126.154369 0 3.4585 1681 | 0/16
49 h-m-p 0.9688 8.0000 0.0001 C 1126.154367 0 1.5197 1716 | 0/16
50 h-m-p 1.6000 8.0000 0.0000 C 1126.154367 0 1.7756 1751 | 0/16
51 h-m-p 1.6000 8.0000 0.0000 Y 1126.154367 0 1.6000 1786 | 0/16
52 h-m-p 1.2063 8.0000 0.0000 --Y 1126.154367 0 0.0134 1823 | 0/16
53 h-m-p 0.0160 8.0000 0.0000 -C 1126.154367 0 0.0010 1859
Out..
lnL = -1126.154367
1860 lfun, 1860 eigenQcodon, 26040 P(t)
Time used: 0:07
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
0.028829 0.037103 0.015513 0.037822 0.040996 0.042901 0.080160 0.051610 0.119865 0.092145 0.076089 0.010592 0.011757 0.013456 1.381418 0.899282 0.148366
ntime & nrate & np: 14 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.167707
np = 17
lnL0 = -1175.543446
Iterating by ming2
Initial: fx= 1175.543446
x= 0.02883 0.03710 0.01551 0.03782 0.04100 0.04290 0.08016 0.05161 0.11986 0.09214 0.07609 0.01059 0.01176 0.01346 1.38142 0.89928 0.14837
1 h-m-p 0.0000 0.0002 342.1421 +++ 1155.008021 m 0.0002 23 | 0/17
2 h-m-p 0.0000 0.0000 9709.1717
h-m-p: 4.42317631e-21 2.21158816e-20 9.70917172e+03 1155.008021
.. | 0/17
3 h-m-p 0.0000 0.0003 2167.5714 YYCYYCCC 1152.496936 7 0.0000 70 | 0/17
4 h-m-p 0.0000 0.0002 396.3568 ++ 1117.609943 m 0.0002 90 | 0/17
5 h-m-p 0.0001 0.0003 164.1343 YCCCCC 1115.763958 5 0.0001 119 | 0/17
6 h-m-p 0.0001 0.0003 109.1049 CCC 1115.530093 2 0.0001 143 | 0/17
7 h-m-p 0.0002 0.0021 38.0377 YC 1115.264686 1 0.0004 164 | 0/17
8 h-m-p 0.0002 0.0016 62.9183 CCC 1114.991556 2 0.0003 188 | 0/17
9 h-m-p 0.0005 0.0163 37.6850 CYC 1114.831644 2 0.0003 211 | 0/17
10 h-m-p 0.0004 0.0020 20.7351 CYC 1114.739889 2 0.0004 234 | 0/17
11 h-m-p 0.0006 0.0044 13.2298 CYC 1114.655547 2 0.0005 257 | 0/17
12 h-m-p 0.0004 0.0087 17.5984 +YCCC 1114.402931 3 0.0010 283 | 0/17
13 h-m-p 0.0009 0.0068 19.0453 CCCC 1114.170426 3 0.0010 309 | 0/17
14 h-m-p 0.0013 0.0128 14.6145 YC 1114.105020 1 0.0007 330 | 0/17
15 h-m-p 0.0012 0.0266 8.0978 YC 1114.089862 1 0.0006 351 | 0/17
16 h-m-p 0.0026 0.1105 1.7228 CC 1114.088476 1 0.0008 373 | 0/17
17 h-m-p 0.0009 0.0956 1.4330 CC 1114.087208 1 0.0010 395 | 0/17
18 h-m-p 0.0009 0.2250 1.5735 +YC 1114.076113 1 0.0072 417 | 0/17
19 h-m-p 0.0006 0.0703 18.8976 +YCCC 1113.995506 3 0.0042 443 | 0/17
20 h-m-p 0.0016 0.0276 48.3851 YC 1113.940326 1 0.0011 464 | 0/17
21 h-m-p 0.3026 4.2287 0.1818 +YYC 1112.899964 2 1.0430 487 | 0/17
22 h-m-p 1.6000 8.0000 0.0146 CCC 1112.274054 2 2.4658 528 | 0/17
23 h-m-p 1.4410 7.2051 0.0166 CCCC 1111.997777 3 2.1361 571 | 0/17
24 h-m-p 1.6000 8.0000 0.0176 YC 1111.976342 1 1.1782 609 | 0/17
25 h-m-p 1.6000 8.0000 0.0015 YC 1111.976057 1 1.2324 647 | 0/17
26 h-m-p 1.6000 8.0000 0.0002 +YC 1111.975843 1 4.3027 686 | 0/17
27 h-m-p 1.1563 8.0000 0.0008 YC 1111.975658 1 2.7197 724 | 0/17
28 h-m-p 1.6000 8.0000 0.0003 C 1111.975620 0 1.4117 761 | 0/17
29 h-m-p 1.5251 8.0000 0.0003 Y 1111.975618 0 1.0857 798 | 0/17
30 h-m-p 1.6000 8.0000 0.0000 Y 1111.975618 0 1.2054 835 | 0/17
31 h-m-p 1.6000 8.0000 0.0000 Y 1111.975618 0 1.6000 872 | 0/17
32 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/17
33 h-m-p 0.0046 2.3025 0.0020 -Y 1111.975618 0 0.0001 961 | 0/17
34 h-m-p 0.0160 8.0000 0.0013 --------Y 1111.975618 0 0.0000 1006 | 0/17
35 h-m-p 0.0160 8.0000 0.0157 -------------.. | 0/17
36 h-m-p 0.0052 2.5868 0.0345 -----------C 1111.975618 0 0.0000 1102 | 0/17
37 h-m-p 0.0013 0.6338 0.1192 -----------.. | 0/17
38 h-m-p 0.0052 2.5868 0.0345 ------------ | 0/17
39 h-m-p 0.0052 2.5868 0.0345 ------------
Out..
lnL = -1111.975618
1243 lfun, 3729 eigenQcodon, 34804 P(t)
Time used: 0:16
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
initial w for M2:NSpselection reset.
0.028829 0.037103 0.015513 0.037822 0.040996 0.042901 0.080160 0.051610 0.119865 0.092145 0.076089 0.010592 0.011757 0.013456 1.426171 1.309770 0.264508 0.428689 2.549129
ntime & nrate & np: 14 3 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.429109
np = 19
lnL0 = -1261.517702
Iterating by ming2
Initial: fx= 1261.517702
x= 0.02883 0.03710 0.01551 0.03782 0.04100 0.04290 0.08016 0.05161 0.11986 0.09214 0.07609 0.01059 0.01176 0.01346 1.42617 1.30977 0.26451 0.42869 2.54913
1 h-m-p 0.0000 0.0003 212.0168 ++CYYCC 1257.505537 4 0.0002 52 | 0/19
2 h-m-p 0.0001 0.0023 315.5648 ++ 1183.178460 m 0.0023 93 | 1/19
3 h-m-p 0.0014 0.0072 93.6930 +YCCC 1169.218209 3 0.0048 140 | 0/19
4 h-m-p 0.0000 0.0000 1698543.2090 +YCC 1166.255242 2 0.0000 184 | 0/19
5 h-m-p 0.0024 0.0129 55.6675 CCYC 1164.543174 3 0.0025 230 | 0/19
6 h-m-p 0.0034 0.0171 29.4096 YCCCC 1161.717043 4 0.0085 278 | 0/19
7 h-m-p 0.0026 0.0128 47.1351 CCCC 1160.573535 3 0.0029 325 | 0/19
8 h-m-p 0.0021 0.0106 25.1235 YCYCCC 1159.525958 5 0.0056 374 | 0/19
9 h-m-p 0.0043 0.0493 32.2361 +YYCC 1156.972365 3 0.0139 420 | 0/19
10 h-m-p 0.0044 0.0222 37.0094 YCCC 1155.359542 3 0.0084 466 | 0/19
11 h-m-p 0.0086 0.0432 18.4550 YCYCCC 1153.367773 5 0.0232 515 | 0/19
12 h-m-p 0.0071 0.0885 60.2052 +YYCC 1147.387507 3 0.0254 561 | 0/19
13 h-m-p 0.0194 0.0968 72.4103 CCCC 1143.582935 3 0.0167 608 | 0/19
14 h-m-p 0.0310 0.1549 34.1752 CCC 1140.244107 2 0.0290 653 | 0/19
15 h-m-p 0.0405 0.2024 11.9901 CCC 1138.567582 2 0.0529 698 | 0/19
16 h-m-p 0.0449 0.2244 4.6690 YYCC 1138.289945 3 0.0329 743 | 0/19
17 h-m-p 0.0314 0.4125 4.8858 YCCC 1137.811868 3 0.0639 789 | 0/19
18 h-m-p 0.1008 0.6205 3.0978 CCCC 1137.024956 3 0.1603 836 | 0/19
19 h-m-p 0.0293 0.1465 5.4939 CCCCC 1136.636434 4 0.0400 885 | 0/19
20 h-m-p 0.0279 0.7924 7.8847 +YC 1132.940368 1 0.2659 928 | 0/19
21 h-m-p 1.3155 6.5775 1.0270 +YYCCC 1126.792748 4 4.7642 976 | 0/19
22 h-m-p 0.2122 1.0610 1.0860 +YYYCCC 1125.043540 5 0.7658 1025 | 0/19
23 h-m-p 0.8154 4.0769 0.8200 YCCCC 1124.113236 4 0.4179 1073 | 0/19
24 h-m-p 0.8471 4.3894 0.4045 +YYCCC 1122.422173 4 2.7149 1121 | 0/19
25 h-m-p 0.9557 4.7786 0.3476 CYCYC 1120.262530 4 2.1669 1169 | 0/19
26 h-m-p 0.4218 2.1088 0.5969 CYCCC 1119.161359 4 0.7590 1217 | 0/19
27 h-m-p 0.4645 3.0766 0.9752 YCYCCC 1117.177274 5 1.2520 1266 | 0/19
28 h-m-p 0.1477 0.7383 1.9109 CYCCC 1116.316917 4 0.2855 1314 | 0/19
29 h-m-p 0.0777 0.3883 3.0073 YCCCC 1115.707419 4 0.1527 1362 | 0/19
30 h-m-p 0.1353 0.6767 2.2727 YCCCC 1115.072073 4 0.2758 1410 | 0/19
31 h-m-p 0.0932 0.4659 2.0686 YCCCC 1114.701027 4 0.1915 1458 | 0/19
32 h-m-p 0.3363 5.3238 1.1780 YCCC 1114.311467 3 0.5622 1504 | 0/19
33 h-m-p 0.2574 1.9413 2.5735 CCCCC 1113.976760 4 0.4435 1553 | 0/19
34 h-m-p 0.2186 1.0929 4.7992 CCCCC 1113.582614 4 0.3088 1602 | 0/19
35 h-m-p 0.2490 1.2450 4.7223 YYCC 1113.405861 3 0.1662 1647 | 0/19
36 h-m-p 0.2507 1.7101 3.1313 YCC 1113.244730 2 0.2002 1691 | 0/19
37 h-m-p 0.2359 1.8052 2.6574 CCCC 1113.012826 3 0.3556 1738 | 0/19
38 h-m-p 0.2357 1.7111 4.0097 CCCC 1112.828416 3 0.2435 1785 | 0/19
39 h-m-p 0.2468 1.4279 3.9563 YYC 1112.710067 2 0.2013 1828 | 0/19
40 h-m-p 0.1435 1.2726 5.5510 CCCC 1112.567534 3 0.1977 1875 | 0/19
41 h-m-p 0.2530 1.9489 4.3383 YCC 1112.489441 2 0.1507 1919 | 0/19
42 h-m-p 0.2163 1.5809 3.0218 YCCC 1112.451277 3 0.1354 1965 | 0/19
43 h-m-p 0.1757 7.1135 2.3299 +YCC 1112.341350 2 0.5328 2010 | 0/19
44 h-m-p 0.2221 1.1104 5.4192 YYYC 1112.265058 3 0.2112 2054 | 0/19
45 h-m-p 0.3492 2.7728 3.2773 CYC 1112.214950 2 0.3295 2098 | 0/19
46 h-m-p 0.3336 3.8480 3.2374 C 1112.162315 0 0.3336 2139 | 0/19
47 h-m-p 0.5166 8.0000 2.0903 YC 1112.136209 1 0.3453 2181 | 0/19
48 h-m-p 0.2211 3.9412 3.2645 CCC 1112.119505 2 0.2284 2226 | 0/19
49 h-m-p 0.4123 8.0000 1.8086 C 1112.098420 0 0.4578 2267 | 0/19
50 h-m-p 0.3717 7.8917 2.2275 CCC 1112.080808 2 0.4380 2312 | 0/19
51 h-m-p 0.5561 8.0000 1.7544 CC 1112.071216 1 0.5585 2355 | 0/19
52 h-m-p 1.2296 8.0000 0.7968 YC 1112.066672 1 0.6330 2397 | 0/19
53 h-m-p 1.0263 8.0000 0.4914 YC 1112.064558 1 0.6307 2439 | 0/19
54 h-m-p 0.5353 8.0000 0.5790 CC 1112.063064 1 0.7864 2482 | 0/19
55 h-m-p 1.6000 8.0000 0.2537 CC 1112.062154 1 1.2930 2525 | 0/19
56 h-m-p 0.9059 8.0000 0.3621 CC 1112.060627 1 1.0774 2568 | 0/19
57 h-m-p 1.0162 8.0000 0.3840 +YC 1112.048278 1 5.5825 2611 | 0/19
58 h-m-p 1.2237 8.0000 1.7515 YCCC 1112.005253 3 2.8466 2657 | 0/19
59 h-m-p 1.6000 8.0000 1.5182 YC 1111.991870 1 0.8500 2699 | 0/19
60 h-m-p 0.4750 8.0000 2.7166 YC 1111.990175 1 0.2528 2741 | 0/19
61 h-m-p 1.4944 8.0000 0.4596 YC 1111.988503 1 0.9860 2783 | 0/19
62 h-m-p 0.4274 8.0000 1.0602 +CC 1111.985709 1 2.1826 2827 | 0/19
63 h-m-p 1.1813 8.0000 1.9589 YC 1111.981422 1 1.9114 2869 | 0/19
64 h-m-p 1.6000 8.0000 1.8124 C 1111.978892 0 1.6000 2910 | 0/19
65 h-m-p 1.3666 8.0000 2.1220 C 1111.977665 0 1.4177 2951 | 0/19
66 h-m-p 1.1341 8.0000 2.6526 YC 1111.977074 1 0.8759 2993 | 0/19
67 h-m-p 1.1273 8.0000 2.0612 CY 1111.976498 1 1.3799 3036 | 0/19
68 h-m-p 0.7413 8.0000 3.8368 CC 1111.976143 1 0.9571 3079 | 0/19
69 h-m-p 1.4940 8.0000 2.4580 C 1111.975898 0 1.4940 3120 | 0/19
70 h-m-p 1.4850 8.0000 2.4730 C 1111.975766 0 1.6135 3161 | 0/19
71 h-m-p 1.6000 8.0000 2.1036 C 1111.975698 0 1.8192 3202 | 0/19
72 h-m-p 1.6000 8.0000 2.2999 C 1111.975659 0 1.9201 3243 | 0/19
73 h-m-p 1.6000 8.0000 2.4888 C 1111.975637 0 1.6000 3284 | 0/19
74 h-m-p 1.5815 8.0000 2.5180 C 1111.975627 0 2.1864 3325 | 0/19
75 h-m-p 1.6000 8.0000 2.0622 C 1111.975623 0 1.8925 3366 | 0/19
76 h-m-p 1.6000 8.0000 2.2928 C 1111.975620 0 2.4865 3407 | 0/19
77 h-m-p 1.6000 8.0000 2.3000 C 1111.975619 0 1.7409 3448 | 0/19
78 h-m-p 1.6000 8.0000 2.2316 Y 1111.975619 0 2.8189 3489 | 0/19
79 h-m-p 1.6000 8.0000 2.1821 C 1111.975619 0 1.8141 3530 | 0/19
80 h-m-p 0.9841 8.0000 4.0225 +Y 1111.975618 0 2.8540 3572 | 0/19
81 h-m-p 1.6000 8.0000 5.6773 C 1111.975618 0 1.4030 3613 | 0/19
82 h-m-p 0.1649 8.0000 48.3110 Y 1111.975618 0 0.0412 3654 | 0/19
83 h-m-p 0.1248 8.0000 15.9508 Y 1111.975618 0 0.0764 3695 | 0/19
84 h-m-p 0.9590 8.0000 1.2707 C 1111.975618 0 1.3121 3736 | 0/19
85 h-m-p 0.0521 8.0000 31.9770 --Y 1111.975618 0 0.0008 3779 | 0/19
86 h-m-p 0.7051 8.0000 0.0369 ------Y 1111.975618 0 0.0000 3826 | 0/19
87 h-m-p 0.0319 8.0000 0.0000 -------C 1111.975618 0 0.0000 3874
Out..
lnL = -1111.975618
3875 lfun, 15500 eigenQcodon, 162750 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1146.567472 S = -1117.421011 -20.994370
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 89 patterns 0:56
did 20 / 89 patterns 0:56
did 30 / 89 patterns 0:56
did 40 / 89 patterns 0:56
did 50 / 89 patterns 0:56
did 60 / 89 patterns 0:56
did 70 / 89 patterns 0:56
did 80 / 89 patterns 0:56
did 89 / 89 patterns 0:56
Time used: 0:56
Model 3: discrete
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
0.028829 0.037103 0.015513 0.037822 0.040996 0.042901 0.080160 0.051610 0.119865 0.092145 0.076089 0.010592 0.011757 0.013456 1.426172 0.818396 0.798628 0.008110 0.017229 0.027974
ntime & nrate & np: 14 4 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 27.078077
np = 20
lnL0 = -1126.919289
Iterating by ming2
Initial: fx= 1126.919289
x= 0.02883 0.03710 0.01551 0.03782 0.04100 0.04290 0.08016 0.05161 0.11986 0.09214 0.07609 0.01059 0.01176 0.01346 1.42617 0.81840 0.79863 0.00811 0.01723 0.02797
1 h-m-p 0.0000 0.0001 219.1742 ++ 1124.227226 m 0.0001 45 | 1/20
2 h-m-p 0.0000 0.0001 377.4031 +YYYCCCC 1122.050304 6 0.0001 98 | 1/20
3 h-m-p 0.0000 0.0000 998.4633 ++ 1119.590866 m 0.0000 140 | 2/20
4 h-m-p 0.0001 0.0035 152.8303 YYCCC 1118.042503 4 0.0002 188 | 2/20
5 h-m-p 0.0002 0.0012 37.2829 CC 1117.924471 1 0.0002 231 | 2/20
6 h-m-p 0.0004 0.0075 17.3512 CC 1117.854962 1 0.0006 274 | 2/20
7 h-m-p 0.0005 0.0039 18.9083 YC 1117.832747 1 0.0002 316 | 2/20
8 h-m-p 0.0004 0.0076 12.9837 CC 1117.818806 1 0.0003 359 | 2/20
9 h-m-p 0.0008 0.0117 4.8560 YC 1117.815571 1 0.0004 401 | 2/20
10 h-m-p 0.0003 0.0646 7.1070 CC 1117.812315 1 0.0003 444 | 2/20
11 h-m-p 0.0003 0.0942 6.7752 ++YCC 1117.774628 2 0.0047 490 | 2/20
12 h-m-p 0.0006 0.0301 53.3880 +YC 1117.668274 1 0.0018 533 | 2/20
13 h-m-p 0.0005 0.0248 196.2313 +YCCC 1116.649578 3 0.0043 580 | 2/20
14 h-m-p 0.0009 0.0044 439.1466 YCCC 1116.429616 3 0.0005 626 | 2/20
15 h-m-p 0.0014 0.0086 138.5857 YC 1116.319012 1 0.0007 668 | 2/20
16 h-m-p 0.0125 0.0738 7.6544 -CC 1116.309704 1 0.0012 712 | 2/20
17 h-m-p 0.0007 0.1249 12.4534 ++CCC 1116.186245 2 0.0103 759 | 2/20
18 h-m-p 0.0010 0.0206 128.1577 +YC 1115.869440 1 0.0026 802 | 2/20
19 h-m-p 0.3566 3.0731 0.9244 +YCCC 1115.125026 3 0.9166 849 | 1/20
20 h-m-p 0.0000 0.0001 24790.5012 YCCC 1114.997684 3 0.0000 895 | 1/20
21 h-m-p 0.3002 1.5009 0.3487 ++ 1114.337564 m 1.5009 937 | 2/20
22 h-m-p 1.6000 8.0000 0.1849 CYCC 1113.828646 3 1.7530 984 | 2/20
23 h-m-p 0.3557 5.7378 0.9112 CCC 1113.527933 2 0.5786 1029 | 1/20
24 h-m-p 0.0000 0.0001 64699.1951 CCC 1113.241565 2 0.0000 1074 | 1/20
25 h-m-p 1.0905 8.0000 0.5431 YCCC 1112.595136 3 2.5205 1121 | 1/20
26 h-m-p 1.6000 8.0000 0.3014 YCCC 1112.130385 3 2.5191 1168 | 0/20
27 h-m-p 0.5749 8.0000 1.3206 CC 1111.973608 1 0.6317 1212 | 0/20
28 h-m-p 1.2993 7.8325 0.6421 CCC 1111.856780 2 1.5773 1259 | 0/20
29 h-m-p 1.6000 8.0000 0.1291 YCC 1111.842554 2 1.2465 1305 | 0/20
30 h-m-p 0.5724 2.8618 0.1393 YC 1111.839401 1 1.2126 1349 | 0/20
31 h-m-p 0.4299 2.1496 0.0376 +C 1111.838033 0 1.7361 1393 | 0/20
32 h-m-p 0.3027 1.5134 0.0269 +Y 1111.837870 0 1.3415 1437 | 0/20
33 h-m-p 1.6000 8.0000 0.0087 Y 1111.837860 0 0.8858 1480 | 0/20
34 h-m-p 1.0146 5.0731 0.0010 C 1111.837858 0 1.2074 1523 | 0/20
35 h-m-p 1.6000 8.0000 0.0005 Y 1111.837858 0 1.1905 1566 | 0/20
36 h-m-p 1.6000 8.0000 0.0000 Y 1111.837858 0 0.9783 1609 | 0/20
37 h-m-p 0.5042 8.0000 0.0000 Y 1111.837858 0 0.5042 1652 | 0/20
38 h-m-p 0.4988 8.0000 0.0000 ----------------.. | 0/20
39 h-m-p 0.0020 0.9998 0.0048 -Y 1111.837858 0 0.0001 1753 | 0/20
40 h-m-p 0.0160 8.0000 0.0041 -----Y 1111.837858 0 0.0000 1801 | 0/20
41 h-m-p 0.0160 8.0000 0.0003 ------Y 1111.837858 0 0.0000 1850
Out..
lnL = -1111.837858
1851 lfun, 7404 eigenQcodon, 77742 P(t)
Time used: 1:15
Model 7: beta
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
0.028829 0.037103 0.015513 0.037822 0.040996 0.042901 0.080160 0.051610 0.119865 0.092145 0.076089 0.010592 0.011757 0.013456 1.401979 0.574037 1.335590
ntime & nrate & np: 14 1 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.372993
np = 17
lnL0 = -1188.735732
Iterating by ming2
Initial: fx= 1188.735732
x= 0.02883 0.03710 0.01551 0.03782 0.04100 0.04290 0.08016 0.05161 0.11986 0.09214 0.07609 0.01059 0.01176 0.01346 1.40198 0.57404 1.33559
1 h-m-p 0.0000 0.0002 199.2144 ++CYCCC 1185.476312 4 0.0002 48 | 0/17
2 h-m-p 0.0001 0.0032 283.9777 +CYCC 1181.000646 3 0.0005 91 | 0/17
3 h-m-p 0.0002 0.0011 295.5826 ++ 1150.192200 m 0.0011 128 | 0/17
4 h-m-p 0.0000 0.0001 3217.2620 YCYCCC 1141.935844 5 0.0000 173 | 0/17
5 h-m-p 0.0001 0.0007 76.8509 CYCC 1141.557446 3 0.0002 215 | 0/17
6 h-m-p 0.0002 0.0016 62.1476 YCCCC 1140.833491 4 0.0006 259 | 0/17
7 h-m-p 0.0003 0.0015 90.7932 CCCC 1140.293454 3 0.0004 302 | 0/17
8 h-m-p 0.0007 0.0075 54.7792 YCCC 1139.470854 3 0.0013 344 | 0/17
9 h-m-p 0.0015 0.0075 43.3192 CCCC 1138.815479 3 0.0016 387 | 0/17
10 h-m-p 0.0016 0.0082 37.9335 YCCCCC 1138.279619 5 0.0018 433 | 0/17
11 h-m-p 0.0046 0.0279 14.5010 YCY 1138.022400 2 0.0035 473 | 0/17
12 h-m-p 0.0016 0.0211 31.6713 +YCCC 1137.305956 3 0.0044 516 | 0/17
13 h-m-p 0.0014 0.0092 101.7104 YCCCCC 1135.748999 5 0.0028 562 | 0/17
14 h-m-p 0.0009 0.0044 112.4933 YYYC 1135.286197 3 0.0008 602 | 0/17
15 h-m-p 0.0028 0.0141 14.7577 CC 1135.230467 1 0.0009 641 | 0/17
16 h-m-p 0.0058 0.0557 2.2192 YCCC 1135.005822 3 0.0102 683 | 0/17
17 h-m-p 0.0007 0.0329 31.7874 +++ 1124.263696 m 0.0329 721 | 0/17
18 h-m-p 0.2165 1.0823 0.8457 YYYYC 1121.312526 4 0.0580 762 | 0/17
19 h-m-p 0.0032 0.5527 15.5175 ++CYCCC 1117.209527 4 0.0442 808 | 0/17
20 h-m-p 0.5075 2.5373 0.1563 YCCCC 1116.265903 4 0.2489 852 | 0/17
21 h-m-p 0.4330 2.9825 0.0898 CCC 1116.064604 2 0.4271 893 | 0/17
22 h-m-p 0.4186 2.0928 0.0776 CCCC 1115.927864 3 0.4842 936 | 0/17
23 h-m-p 0.4050 7.0383 0.0928 C 1115.893805 0 0.4108 973 | 0/17
24 h-m-p 1.2537 8.0000 0.0304 CYC 1115.837349 2 1.1121 1013 | 0/17
25 h-m-p 0.5663 8.0000 0.0597 +YC 1115.797211 1 1.4871 1052 | 0/17
26 h-m-p 1.1904 8.0000 0.0746 CCC 1115.737405 2 1.8122 1093 | 0/17
27 h-m-p 0.4561 7.5041 0.2965 +YYCYYCYC 1115.245850 7 3.8797 1140 | 0/17
28 h-m-p 0.1464 0.7319 1.4680 YYCCYCCC 1115.102366 7 0.2149 1188 | 0/17
29 h-m-p 0.1991 0.9957 0.5630 CYCYCC 1114.842022 5 0.3427 1233 | 0/17
30 h-m-p 0.4369 2.1843 0.2599 YYYC 1114.745065 3 0.3884 1273 | 0/17
31 h-m-p 0.8006 8.0000 0.1261 YCCC 1114.716455 3 0.4239 1315 | 0/17
32 h-m-p 0.7650 6.7254 0.0699 CCC 1114.703767 2 1.1253 1356 | 0/17
33 h-m-p 1.6000 8.0000 0.0337 CCCC 1114.690412 3 2.1549 1399 | 0/17
34 h-m-p 1.6000 8.0000 0.0128 CCCC 1114.648813 3 2.5224 1442 | 0/17
35 h-m-p 0.4541 4.4956 0.0711 CYCCC 1114.610336 4 0.6464 1486 | 0/17
36 h-m-p 0.7027 3.5135 0.0314 CC 1114.568626 1 0.7027 1525 | 0/17
37 h-m-p 0.8688 8.0000 0.0254 CC 1114.561883 1 0.8688 1564 | 0/17
38 h-m-p 1.6000 8.0000 0.0070 C 1114.561217 0 1.7504 1601 | 0/17
39 h-m-p 1.2040 8.0000 0.0101 CC 1114.560843 1 1.4952 1640 | 0/17
40 h-m-p 1.6000 8.0000 0.0017 Y 1114.560769 0 1.2262 1677 | 0/17
41 h-m-p 0.2450 8.0000 0.0087 +C 1114.560677 0 0.9800 1715 | 0/17
42 h-m-p 1.6000 8.0000 0.0028 C 1114.560600 0 1.9351 1752 | 0/17
43 h-m-p 1.6000 8.0000 0.0019 C 1114.560563 0 1.6000 1789 | 0/17
44 h-m-p 1.6000 8.0000 0.0008 C 1114.560562 0 0.4000 1826 | 0/17
45 h-m-p 1.3652 8.0000 0.0002 C 1114.560557 0 1.6162 1863 | 0/17
46 h-m-p 1.6000 8.0000 0.0002 --------------Y 1114.560557 0 0.0000 1914
Out..
lnL = -1114.560557
1915 lfun, 21065 eigenQcodon, 268100 P(t)
Time used: 2:21
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
initial w for M8:NSbetaw>1 reset.
0.028829 0.037103 0.015513 0.037822 0.040996 0.042901 0.080160 0.051610 0.119865 0.092145 0.076089 0.010592 0.011757 0.013456 1.390111 0.900000 0.549954 1.997831 2.180158
ntime & nrate & np: 14 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.379819
np = 19
lnL0 = -1193.471048
Iterating by ming2
Initial: fx= 1193.471048
x= 0.02883 0.03710 0.01551 0.03782 0.04100 0.04290 0.08016 0.05161 0.11986 0.09214 0.07609 0.01059 0.01176 0.01346 1.39011 0.90000 0.54995 1.99783 2.18016
1 h-m-p 0.0000 0.0004 355.1510 +++ 1170.759718 m 0.0004 44 | 1/19
2 h-m-p 0.0003 0.0039 302.4576 YCYCCC 1170.267208 5 0.0000 94 | 1/19
3 h-m-p 0.0001 0.0013 167.4052 +++ 1158.097475 m 0.0013 135 | 1/19
4 h-m-p 0.0000 0.0001 1118.2119 +YYCCC 1155.191599 4 0.0000 182 | 1/19
5 h-m-p 0.0000 0.0001 2817.4226 +CYCCC 1142.712902 4 0.0001 231 | 1/19
6 h-m-p 0.0000 0.0000 3448.5472 YCCCCC 1139.924168 5 0.0000 280 | 1/19
7 h-m-p 0.0003 0.0017 69.1521 CCCCC 1139.157803 4 0.0004 328 | 0/19
8 h-m-p 0.0000 0.0002 786.9119 +YCYCCC 1127.751727 5 0.0001 377 | 0/19
9 h-m-p 0.0003 0.0017 55.3827 CCCCC 1127.058332 4 0.0004 426 | 0/19
10 h-m-p 0.0020 0.0223 12.2601 CYC 1126.901316 2 0.0021 470 | 0/19
11 h-m-p 0.0018 0.0254 14.6704 CCC 1126.728748 2 0.0027 515 | 0/19
12 h-m-p 0.0016 0.0169 24.1049 YCC 1126.600468 2 0.0014 559 | 0/19
13 h-m-p 0.0031 0.0388 10.5693 YCCC 1126.376781 3 0.0062 605 | 0/19
14 h-m-p 0.0034 0.0564 19.3086 YCC 1125.988614 2 0.0065 649 | 0/19
15 h-m-p 0.0020 0.0124 62.5378 CCC 1125.543581 2 0.0023 694 | 0/19
16 h-m-p 0.0031 0.0196 47.2908 YYC 1125.157601 2 0.0027 737 | 0/19
17 h-m-p 0.0036 0.0179 11.0005 YCCC 1125.085566 3 0.0022 783 | 0/19
18 h-m-p 0.0042 0.1809 5.8736 +++ 1119.636707 m 0.1809 825 | 0/19
19 h-m-p -0.0000 -0.0000 1.7359
h-m-p: -0.00000000e+00 -0.00000000e+00 1.73591011e+00 1119.636707
.. | 0/19
20 h-m-p 0.0000 0.0007 203.3486 ++CYYC 1117.150872 3 0.0002 910 | 0/19
21 h-m-p 0.0001 0.0003 133.8286 +YYCCC 1115.658562 4 0.0002 958 | 0/19
22 h-m-p 0.0000 0.0002 284.8272 CYCCC 1114.984425 4 0.0001 1006 | 0/19
23 h-m-p 0.0002 0.0011 76.7866 CYCCC 1114.307355 4 0.0003 1054 | 0/19
24 h-m-p 0.0001 0.0004 215.1637 CCCCC 1113.663768 4 0.0001 1103 | 0/19
25 h-m-p 0.0005 0.0026 58.1383 CCCC 1113.219744 3 0.0005 1150 | 0/19
26 h-m-p 0.0004 0.0021 53.2308 YCC 1113.053524 2 0.0003 1194 | 0/19
27 h-m-p 0.0005 0.0031 28.0750 YCC 1112.974007 2 0.0004 1238 | 0/19
28 h-m-p 0.0006 0.0054 18.3606 YCC 1112.937611 2 0.0004 1282 | 0/19
29 h-m-p 0.0004 0.0043 16.7338 YC 1112.916727 1 0.0003 1324 | 0/19
30 h-m-p 0.0008 0.0047 6.6864 YC 1112.911034 1 0.0004 1366 | 0/19
31 h-m-p 0.0007 0.0043 3.7051 YC 1112.903770 1 0.0014 1408 | 0/19
32 h-m-p 0.0002 0.0009 10.0475 ++ 1112.889747 m 0.0009 1449 | 1/19
33 h-m-p 0.0005 0.0319 18.7413 +CCC 1112.824458 2 0.0029 1495 | 1/19
34 h-m-p 0.0005 0.0148 106.5217 +YYC 1112.612094 2 0.0016 1538 | 1/19
35 h-m-p 0.0032 0.0162 52.9750 YC 1112.585413 1 0.0004 1579 | 1/19
36 h-m-p 0.0016 0.0208 14.5656 CC 1112.577266 1 0.0005 1621 | 1/19
37 h-m-p 0.0443 3.5472 0.1607 +YCCC 1112.395742 3 0.2886 1667 | 1/19
38 h-m-p 0.5439 2.7193 0.0356 CCCC 1112.178542 3 0.5591 1713 | 1/19
39 h-m-p 1.3089 6.5446 0.0095 YC 1112.153065 1 0.6630 1754 | 1/19
40 h-m-p 1.6000 8.0000 0.0021 YC 1112.151162 1 0.8247 1795 | 1/19
41 h-m-p 0.4184 8.0000 0.0042 YC 1112.150958 1 0.8496 1836 | 1/19
42 h-m-p 0.6853 8.0000 0.0052 +C 1112.150906 0 2.3852 1877 | 1/19
43 h-m-p 0.8956 8.0000 0.0139 ++ 1112.150361 m 8.0000 1917 | 1/19
44 h-m-p 0.0572 8.0000 1.9402 ++CC 1112.143231 1 1.3796 1961 | 1/19
45 h-m-p 1.6000 8.0000 1.1331 ++ 1112.113230 m 8.0000 2001 | 1/19
46 h-m-p 1.6000 8.0000 4.5510 CC 1112.099245 1 1.4419 2043 | 1/19
47 h-m-p 1.6000 8.0000 3.5114 +YC 1112.089066 1 4.4329 2085 | 1/19
48 h-m-p 1.6000 8.0000 5.1018 CC 1112.082956 1 2.4222 2127 | 1/19
49 h-m-p 1.4756 7.3778 6.7480 +YC 1112.077415 1 4.8301 2169 | 1/19
50 h-m-p 0.3125 1.5623 11.0042 ++ 1112.074650 m 1.5623 2209 | 2/19
51 h-m-p 0.2255 8.0000 0.3888 ---------------.. | 2/19
52 h-m-p 0.0003 0.1348 1.2661 +YC 1112.074109 1 0.0007 2303 | 2/19
53 h-m-p 0.0002 0.0813 6.3683 +YC 1112.069961 1 0.0012 2344 | 2/19
54 h-m-p 0.0001 0.0033 129.5181 +CCC 1112.046992 2 0.0003 2388 | 2/19
55 h-m-p 0.0002 0.0021 223.3301 CCC 1112.019692 2 0.0002 2431 | 2/19
56 h-m-p 0.0009 0.0045 52.6623 CY 1112.013551 1 0.0002 2472 | 2/19
57 h-m-p 0.0007 0.0210 15.5460 CC 1112.011517 1 0.0002 2513 | 2/19
58 h-m-p 0.0006 0.0295 6.1778 YC 1112.010631 1 0.0003 2553 | 2/19
59 h-m-p 0.0006 0.0340 2.9329 YC 1112.010266 1 0.0003 2593 | 2/19
60 h-m-p 0.0009 0.0603 0.9664 C 1112.010209 0 0.0002 2632 | 2/19
61 h-m-p 0.0014 0.6916 0.3126 YC 1112.010180 1 0.0007 2672 | 2/19
62 h-m-p 0.0047 2.3650 0.1320 Y 1112.010175 0 0.0007 2711 | 2/19
63 h-m-p 0.0106 5.3167 0.1392 YC 1112.010135 1 0.0065 2751 | 2/19
64 h-m-p 0.0016 0.8094 1.7788 CC 1112.009959 1 0.0023 2792 | 2/19
65 h-m-p 0.0019 0.5401 2.1993 YC 1112.009882 1 0.0008 2832 | 2/19
66 h-m-p 0.0011 0.3238 1.6105 YC 1112.009837 1 0.0007 2872 | 2/19
67 h-m-p 0.0047 1.3867 0.2324 C 1112.009824 0 0.0015 2911 | 2/19
68 h-m-p 0.0312 8.0000 0.0109 Y 1112.009815 0 0.0134 2950 | 2/19
69 h-m-p 0.0064 3.2164 0.2412 +C 1112.009418 0 0.0230 2990 | 2/19
70 h-m-p 1.6000 8.0000 0.0003 Y 1112.009417 0 0.9345 3029 | 2/19
71 h-m-p 1.6000 8.0000 0.0000 Y 1112.009417 0 0.4000 3068 | 2/19
72 h-m-p 0.6671 8.0000 0.0000 C 1112.009417 0 0.1668 3107
Out..
lnL = -1112.009417
3108 lfun, 37296 eigenQcodon, 478632 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1155.047553 S = -1117.433966 -29.616993
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 89 patterns 4:19
did 20 / 89 patterns 4:19
did 30 / 89 patterns 4:19
did 40 / 89 patterns 4:19
did 50 / 89 patterns 4:20
did 60 / 89 patterns 4:20
did 70 / 89 patterns 4:20
did 80 / 89 patterns 4:20
did 89 / 89 patterns 4:20
Time used: 4:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=174
D_melanogaster_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_sechellia_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_simulans_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_yakuba_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_erecta_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_takahashii_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_biarmipes_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_eugracilis_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_rhopaloa_zetaCOP-PA MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH
D_elegans_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH
*******************:******************************
D_melanogaster_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_sechellia_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_simulans_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_yakuba_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_erecta_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_takahashii_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_biarmipes_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_eugracilis_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_rhopaloa_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
D_elegans_zetaCOP-PA RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL
**************************************************
D_melanogaster_zetaCOP-PA ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_sechellia_zetaCOP-PA ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_simulans_zetaCOP-PA ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_yakuba_zetaCOP-PA ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_erecta_zetaCOP-PA ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_takahashii_zetaCOP-PA ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI
D_biarmipes_zetaCOP-PA ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI
D_eugracilis_zetaCOP-PA ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
D_rhopaloa_zetaCOP-PA ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
D_elegans_zetaCOP-PA ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI
************: ***************:********:***********
D_melanogaster_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_sechellia_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_simulans_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_yakuba_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_erecta_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_takahashii_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_biarmipes_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_eugracilis_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
D_rhopaloa_zetaCOP-PA PIAEQTVAQVTooooooooooooo
D_elegans_zetaCOP-PA PIAEQTVAQVLQSAREQLKWSILK
**********
>D_melanogaster_zetaCOP-PA ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATTATGCTGGACGGACTCACCTGCGTGTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTGTCCGTGCTCAACTGCCTCTACGATTCCATTAGCCTG ATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA ACTCAAATGGTCCATTCTGAAG >D_sechellia_zetaCOP-PA ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT CATCATGCTGGCTTTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCCATTGCCGAACAAACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA ACTCAAATGGTCCATTCTGAAG >D_simulans_zetaCOP-PA ATGGACGGATTTATGATGGATATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTATTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTGTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTCCTGTCCGTGCTAAACTGCCTCTACGATTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAAAACCTGGAGAT CATCATGCTGGCATTTGACGAGATCTGCGACGGAGGCATTATTCTGGATG CGGATCCCTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA ACTCAAATGGTCCATTCTGAAG >D_yakuba_zetaCOP-PA ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGATGGACTTACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGATAACCTGGAGAT CATCATGCTGGCCTTTGACGAGATCTGCGACGGAGGCATAATTCTGGATG CCGATCCGTCGTCCGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCAATTGCCGAACAGACCGTCGCCCAGGTTCTGCAATCGGCACGTGAACA ACTCAAATGGTCCATTCTGAAG >D_erecta_zetaCOP-PA ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCTTGTCCA CGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGACTCACCTGCGTCTACAA GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGATTCTATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAATACCTGGAGAT CATCATGCTGGCCTTTGACGAGATCTGCGATGGAGGCATAATTCTGGATG CGGATCCCTCGTCGGTGGTGAAACGCGTTGATCTGCGCAACGATGACATT CCAATTGCCGAACAGACCGTTGCCCAGGTTCTGCAATCGGCACGTGAACA ACTCAAATGGTCTATTCTGAAG >D_takahashii_zetaCOP-PA ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGACGGCAACCGCATCCTGGCCAAGTACTACGACAAAAACATTCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATAATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCGGTGCTCAACTGCCTGTACGACTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT CATCATGCTGGCCTTCGATGAGATCTGCGACGGAGGCATAATCCTGGATG CCGATCCATCGTCCATTGTGAAACGTGTCGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGTGAACA GCTCAAATGGTCCATTCTGAAG >D_biarmipes_zetaCOP-PA ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGACGGGAACCGCATCCTGGCCAAGTACTACGACAAGAACATACTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG ATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATTATCCTGGACG CGGATCCCTCGTCCGTGGTGAAACGCGTCGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGCGAGCA ACTCAAATGGTCCATTCTGAAG >D_eugracilis_zetaCOP-PA ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA CGATGGAAACCGCATCCTGGCCAAATACTACGATAAAAACATCTTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATAATGCTGGACGGACTCACCTGCGTCTACAA AAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTGATCCTGCTGTCTGTGCTCAACTGCCTGTACGACTCCATCAGCCTA ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGAGAACCTGGAGAT CATCATGCTGGCCTTTGATGAAATCTGCGACGGAGGCATGATTCTGGATG CGGATCCCTCCTCCGTAGTGAAACGCGTCGATCTGCGCAACGATGACATT CCTATTGCCGAACAAACCGTTGCCCAGGTTCTGCAATCGGCGCGTGAGCA ACTCAAATGGTCCATTCTGAAG >D_rhopaloa_zetaCOP-PA ATGGACGGATTTATGATGGACATCATCAAGGGCATGTGCATCATGGACAA TGATGGAGACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAATAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTGTTCTTCTACGTGATGGGCAATGCCTACGAGAATG AGCTGATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTA ATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTGCTGGACAACCTGGAGAT CATCATGCTGGCCTTCGACGAGATCTGCGACGGAGGCATGATCCTGGATG CGGATCCCTCGTCCGTGGTGAAACGAGTCGATCTGCGCAACGATGACATT CCCATTGCCGAACAGACCGTTGCCCAGGTAACT----------------- ---------------------- >D_elegans_zetaCOP-PA ATGGACGGATTCATGATGGACATCATCAAGGGCATGTGCATCATGGACAA TGATGGCAACCGCATCCTGGCCAAGTACTACGACAAGAACATCCTGTCCA CGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATCTGTTCAACAAGACGCAC CGCTCCAACACGGAGATCATCATGCTGGACGGGCTCACCTGCGTCTACAA GAGCAACGTGGACCTCTTCTTCTACGTGATGGGCAACGCCTACGAGAACG AGCTCATCCTGCTCTCCGTGCTCAACTGCCTCTACGACTCCATCAGCCTG ATCCTCAAGAAGAACGTGGAGAAGCGACTGGTGCTGGAGAACCTGGAGAT CATCATGCTCGCCTTCGACGAGATCTGTGACGGAGGAATGATCCTGGATG CGGATCCCTCATCCGTCGTGAAACGAGTCGATCTGCGCAACGATGACATT CCCATCGCCGAACAGACCGTTGCCCAGGTTCTGCAGTCGGCGCGTGAACA ACTCAAATGGTCCATTCTGAAG
>D_melanogaster_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_sechellia_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_simulans_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_yakuba_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_erecta_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_takahashii_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_biarmipes_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_eugracilis_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK >D_rhopaloa_zetaCOP-PA MDGFMMDIIKGMCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI PIAEQTVAQVT------------- >D_elegans_zetaCOP-PA MDGFMMDIIKGMCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTH RSNTEIIMLDGLTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISL ILKKNVEKRLVLENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDI PIAEQTVAQVLQSAREQLKWSILK
#NEXUS
[ID: 4210464627]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_zetaCOP-PA
D_sechellia_zetaCOP-PA
D_simulans_zetaCOP-PA
D_yakuba_zetaCOP-PA
D_erecta_zetaCOP-PA
D_takahashii_zetaCOP-PA
D_biarmipes_zetaCOP-PA
D_eugracilis_zetaCOP-PA
D_rhopaloa_zetaCOP-PA
D_elegans_zetaCOP-PA
;
end;
begin trees;
translate
1 D_melanogaster_zetaCOP-PA,
2 D_sechellia_zetaCOP-PA,
3 D_simulans_zetaCOP-PA,
4 D_yakuba_zetaCOP-PA,
5 D_erecta_zetaCOP-PA,
6 D_takahashii_zetaCOP-PA,
7 D_biarmipes_zetaCOP-PA,
8 D_eugracilis_zetaCOP-PA,
9 D_rhopaloa_zetaCOP-PA,
10 D_elegans_zetaCOP-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02078707,((4:0.03047343,5:0.03396077)0.853:0.01289585,(6:0.06740869,7:0.04684992,8:0.1189236,9:0.08444684,10:0.05196267)0.955:0.03893503)1.000:0.03269552,(2:0.01489032,3:0.007003325)0.978:0.01229446);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02078707,((4:0.03047343,5:0.03396077):0.01289585,(6:0.06740869,7:0.04684992,8:0.1189236,9:0.08444684,10:0.05196267):0.03893503):0.03269552,(2:0.01489032,3:0.007003325):0.01229446);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1310.85 -1327.52
2 -1311.47 -1331.11
--------------------------------------
TOTAL -1311.11 -1330.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zetaCOP-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.658259 0.013762 0.453987 0.898559 0.647138 1009.56 1120.62 1.000
r(A<->C){all} 0.072016 0.000830 0.014818 0.126066 0.069147 763.90 809.22 1.000
r(A<->G){all} 0.275334 0.004928 0.148516 0.414109 0.271217 484.17 587.35 1.000
r(A<->T){all} 0.175228 0.004541 0.057077 0.309705 0.166401 534.98 691.52 1.000
r(C<->G){all} 0.092171 0.000713 0.043655 0.143711 0.089392 796.20 964.11 1.000
r(C<->T){all} 0.343812 0.004754 0.221419 0.487133 0.339345 453.04 542.59 1.000
r(G<->T){all} 0.041439 0.000786 0.001222 0.094488 0.035807 623.21 714.04 1.000
pi(A){all} 0.252968 0.000360 0.214356 0.289849 0.252619 929.25 1018.72 1.000
pi(C){all} 0.285897 0.000366 0.250181 0.324510 0.285610 1235.74 1260.97 1.000
pi(G){all} 0.257328 0.000330 0.223823 0.294368 0.257256 1126.34 1195.13 1.000
pi(T){all} 0.203808 0.000294 0.169915 0.236151 0.203150 1125.16 1125.60 1.001
alpha{1,2} 0.074650 0.000782 0.003099 0.115703 0.078576 916.90 1082.64 1.000
alpha{3} 2.516525 0.743213 1.024810 4.121764 2.394605 1443.63 1472.32 1.000
pinvar{all} 0.585627 0.002673 0.482339 0.682849 0.589107 777.25 1068.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/442/zetaCOP-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 161
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 3 3 1 | Ser TCT 0 0 0 0 1 0 | Tyr TAT 0 0 1 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 3 3 5 | TCC 4 5 5 5 3 4 | TAC 6 6 5 6 7 6 | TGC 4 4 4 4 4 4
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 2 1 | TCG 2 1 1 1 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 1 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 1
CTC 6 6 6 6 6 6 | CCC 2 2 2 0 1 1 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 4
CTA 0 1 1 0 0 0 | CCA 0 0 0 1 1 1 | Gln CAA 0 1 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 14 13 13 13 13 14 | CCG 0 0 0 1 0 0 | CAG 3 2 3 3 3 3 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 4 4 3 3 4 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 11 13 13 13 13 12 | ACC 2 2 2 2 2 2 | AAC 11 11 11 12 11 12 | AGC 2 2 2 2 2 2
ATA 0 0 0 1 1 2 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 2 | Arg AGA 0 0 0 0 0 0
Met ATG 8 8 8 8 8 8 | ACG 3 3 3 3 3 3 | AAG 11 11 11 11 11 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 3 3 2 3 2 | Ala GCT 0 1 0 0 0 0 | Asp GAT 7 8 7 8 7 5 | Gly GGT 0 0 0 0 0 0
GTC 0 0 0 2 1 2 | GCC 5 5 5 7 6 7 | GAC 8 8 8 8 8 10 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 1 0 1 0 0 0 | Glu GAA 3 2 3 2 3 2 | GGA 3 3 3 3 3 2
GTG 7 8 8 7 7 6 | GCG 1 1 1 0 1 0 | GAG 7 7 7 7 7 8 | GGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 0 | Ser TCT 0 1 0 0 | Tyr TAT 0 0 0 0 | Cys TGT 0 0 0 1
TTC 5 5 5 6 | TCC 5 5 5 5 | TAC 6 6 6 6 | TGC 4 4 4 3
Leu TTA 0 0 0 0 | TCA 0 0 0 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 1 2 1 1 | TCG 1 0 1 0 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 0 1 0 0 | His CAT 0 0 0 0 | Arg CGT 0 0 0 0
CTC 6 4 5 8 | CCC 2 1 2 2 | CAC 1 1 1 1 | CGC 5 5 4 3
CTA 0 1 1 0 | CCA 0 0 0 0 | Gln CAA 0 1 0 0 | CGA 0 0 1 2
CTG 14 14 13 12 | CCG 0 0 0 0 | CAG 3 2 3 3 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 4 3 2 1 | Thr ACT 0 0 1 0 | Asn AAT 2 1 5 2 | Ser AGT 0 0 0 0
ATC 12 12 14 15 | ACC 2 2 2 2 | AAC 11 12 7 11 | AGC 2 2 2 2
ATA 1 1 0 0 | ACA 0 0 0 0 | Lys AAA 1 4 1 1 | Arg AGA 0 0 0 0
Met ATG 8 9 9 9 | ACG 3 3 3 3 | AAG 11 8 11 11 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 2 2 1 2 | Ala GCT 0 0 0 0 | Asp GAT 3 7 5 5 | Gly GGT 0 0 0 0
GTC 2 2 2 3 | GCC 6 6 6 6 | GAC 12 8 12 10 | GGC 3 3 3 3
GTA 0 1 1 0 | GCA 0 0 0 0 | Glu GAA 2 3 2 2 | GGA 2 4 3 3
GTG 7 6 7 6 | GCG 1 1 1 1 | GAG 8 7 7 8 | GGG 2 0 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.13043 C:0.46584 A:0.04969 G:0.35404
Average T:0.22153 C:0.26087 A:0.25880 G:0.25880
#2: D_sechellia_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.12422 C:0.48447 A:0.04969 G:0.34161
Average T:0.21946 C:0.26708 A:0.25880 G:0.25466
#3: D_simulans_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.11801 C:0.47826 A:0.05590 G:0.34783
Average T:0.21739 C:0.26501 A:0.26087 G:0.25673
#4: D_yakuba_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.11180 C:0.49689 A:0.04969 G:0.34161
Average T:0.21532 C:0.27122 A:0.25880 G:0.25466
#5: D_erecta_zetaCOP-PA
position 1: T:0.15528 C:0.18634 A:0.34783 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.11180 C:0.47826 A:0.05590 G:0.35404
Average T:0.21946 C:0.26294 A:0.25880 G:0.25880
#6: D_takahashii_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.36025 G:0.30435
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.08696 C:0.50932 A:0.05590 G:0.34783
Average T:0.20704 C:0.27536 A:0.26294 G:0.25466
#7: D_biarmipes_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.07453 C:0.52174 A:0.03727 G:0.36646
Average T:0.20290 C:0.27950 A:0.25466 G:0.26294
#8: D_eugracilis_zetaCOP-PA
position 1: T:0.14907 C:0.18634 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.09938 C:0.48447 A:0.09317 G:0.32298
Average T:0.21325 C:0.26501 A:0.27329 G:0.24845
#9: D_rhopaloa_zetaCOP-PA
position 1: T:0.14286 C:0.18634 A:0.35404 G:0.31677
position 2: T:0.38509 C:0.13043 A:0.37267 G:0.11180
position 3: T:0.09317 C:0.49689 A:0.05590 G:0.35404
Average T:0.20704 C:0.27122 A:0.26087 G:0.26087
#10: D_elegans_zetaCOP-PA
position 1: T:0.14286 C:0.19255 A:0.35404 G:0.31056
position 2: T:0.39130 C:0.12422 A:0.37267 G:0.11180
position 3: T:0.06832 C:0.53416 A:0.05590 G:0.34161
Average T:0.20083 C:0.28364 A:0.26087 G:0.25466
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 16 | Ser S TCT 2 | Tyr Y TAT 1 | Cys C TGT 1
TTC 44 | TCC 46 | TAC 60 | TGC 39
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 11 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 1 | His H CAT 0 | Arg R CGT 1
CTC 59 | CCC 15 | CAC 10 | CGC 46
CTA 4 | CCA 3 | Gln Q CAA 2 | CGA 3
CTG 133 | CCG 1 | CAG 28 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 34 | Thr T ACT 1 | Asn N AAT 19 | Ser S AGT 0
ATC 128 | ACC 20 | AAC 109 | AGC 20
ATA 6 | ACA 0 | Lys K AAA 14 | Arg R AGA 0
Met M ATG 83 | ACG 30 | AAG 106 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 1 | Asp D GAT 62 | Gly G GGT 0
GTC 14 | GCC 59 | GAC 92 | GGC 36
GTA 2 | GCA 2 | Glu E GAA 24 | GGA 29
GTG 69 | GCG 8 | GAG 73 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14472 C:0.19068 A:0.35404 G:0.31056
position 2: T:0.39068 C:0.12484 A:0.37267 G:0.11180
position 3: T:0.10186 C:0.49503 A:0.05590 G:0.34720
Average T:0.21242 C:0.27019 A:0.26087 G:0.25652
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_zetaCOP-PA
D_sechellia_zetaCOP-PA 0.0339 (0.0027 0.0787)
D_simulans_zetaCOP-PA -1.0000 (0.0000 0.0684) 0.0933 (0.0027 0.0286)
D_yakuba_zetaCOP-PA 0.0149 (0.0027 0.1787)-1.0000 (0.0000 0.1671) 0.0159 (0.0027 0.1670)
D_erecta_zetaCOP-PA 0.0171 (0.0027 0.1553) 0.0319 (0.0053 0.1671) 0.0159 (0.0027 0.1670) 0.0533 (0.0053 0.1002)
D_takahashii_zetaCOP-PA 0.0139 (0.0040 0.2870) 0.0244 (0.0067 0.2736) 0.0139 (0.0040 0.2871) 0.0319 (0.0067 0.2095) 0.0256 (0.0067 0.2607)
D_biarmipes_zetaCOP-PA -1.0000 (0.0000 0.2401) 0.0124 (0.0027 0.2150)-1.0000 (0.0000 0.2275) 0.0124 (0.0027 0.2154) 0.0117 (0.0027 0.2279) 0.0248 (0.0040 0.1612)
D_eugracilis_zetaCOP-PA 0.0083 (0.0027 0.3226) 0.0190 (0.0053 0.2808) 0.0083 (0.0027 0.3227) 0.0172 (0.0053 0.3092) 0.0181 (0.0053 0.2951) 0.0210 (0.0053 0.2545) 0.0090 (0.0027 0.2946)
D_rhopaloa_zetaCOP-PA 0.0552 (0.0139 0.2513) 0.0444 (0.0112 0.2515) 0.0581 (0.0139 0.2384) 0.0421 (0.0112 0.2652) 0.0733 (0.0166 0.2262) 0.0816 (0.0179 0.2198) 0.0903 (0.0139 0.1535) 0.0364 (0.0112 0.3067)
D_elegans_zetaCOP-PA 0.0095 (0.0027 0.2804) 0.0210 (0.0053 0.2539) 0.0100 (0.0027 0.2670) 0.0221 (0.0053 0.2413) 0.0210 (0.0053 0.2543) 0.0262 (0.0053 0.2034) 0.0149 (0.0027 0.1789)-1.0000 (0.0000 0.3236) 0.0629 (0.0112 0.1772)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
lnL(ntime: 14 np: 16): -1126.154367 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..6 14..7 14..8 14..9 14..10 11..15 15..2 15..3
0.024137 0.038824 0.014214 0.038871 0.038139 0.048005 0.092557 0.054080 0.161283 0.111503 0.080115 0.012479 0.018533 0.005789 1.381418 0.016221
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.73853
(1: 0.024137, ((4: 0.038871, 5: 0.038139): 0.014214, (6: 0.092557, 7: 0.054080, 8: 0.161283, 9: 0.111503, 10: 0.080115): 0.048005): 0.038824, (2: 0.018533, 3: 0.005789): 0.012479);
(D_melanogaster_zetaCOP-PA: 0.024137, ((D_yakuba_zetaCOP-PA: 0.038871, D_erecta_zetaCOP-PA: 0.038139): 0.014214, (D_takahashii_zetaCOP-PA: 0.092557, D_biarmipes_zetaCOP-PA: 0.054080, D_eugracilis_zetaCOP-PA: 0.161283, D_rhopaloa_zetaCOP-PA: 0.111503, D_elegans_zetaCOP-PA: 0.080115): 0.048005): 0.038824, (D_sechellia_zetaCOP-PA: 0.018533, D_simulans_zetaCOP-PA: 0.005789): 0.012479);
Detailed output identifying parameters
kappa (ts/tv) = 1.38142
omega (dN/dS) = 0.01622
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.024 417.2 65.8 0.0162 0.0009 0.0536 0.4 3.5
11..12 0.039 417.2 65.8 0.0162 0.0014 0.0862 0.6 5.7
12..13 0.014 417.2 65.8 0.0162 0.0005 0.0316 0.2 2.1
13..4 0.039 417.2 65.8 0.0162 0.0014 0.0863 0.6 5.7
13..5 0.038 417.2 65.8 0.0162 0.0014 0.0847 0.6 5.6
12..14 0.048 417.2 65.8 0.0162 0.0017 0.1066 0.7 7.0
14..6 0.093 417.2 65.8 0.0162 0.0033 0.2054 1.4 13.5
14..7 0.054 417.2 65.8 0.0162 0.0019 0.1200 0.8 7.9
14..8 0.161 417.2 65.8 0.0162 0.0058 0.3580 2.4 23.5
14..9 0.112 417.2 65.8 0.0162 0.0040 0.2475 1.7 16.3
14..10 0.080 417.2 65.8 0.0162 0.0029 0.1778 1.2 11.7
11..15 0.012 417.2 65.8 0.0162 0.0004 0.0277 0.2 1.8
15..2 0.019 417.2 65.8 0.0162 0.0007 0.0411 0.3 2.7
15..3 0.006 417.2 65.8 0.0162 0.0002 0.0128 0.1 0.8
tree length for dN: 0.0266
tree length for dS: 1.6393
Time used: 0:07
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
check convergence..
lnL(ntime: 14 np: 17): -1111.975618 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..6 14..7 14..8 14..9 14..10 11..15 15..2 15..3
0.025324 0.041369 0.014837 0.040769 0.040213 0.048097 0.093480 0.055641 0.167248 0.114619 0.082394 0.013120 0.019431 0.006079 1.426171 0.976849 0.003804
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76262
(1: 0.025324, ((4: 0.040769, 5: 0.040213): 0.014837, (6: 0.093480, 7: 0.055641, 8: 0.167248, 9: 0.114619, 10: 0.082394): 0.048097): 0.041369, (2: 0.019431, 3: 0.006079): 0.013120);
(D_melanogaster_zetaCOP-PA: 0.025324, ((D_yakuba_zetaCOP-PA: 0.040769, D_erecta_zetaCOP-PA: 0.040213): 0.014837, (D_takahashii_zetaCOP-PA: 0.093480, D_biarmipes_zetaCOP-PA: 0.055641, D_eugracilis_zetaCOP-PA: 0.167248, D_rhopaloa_zetaCOP-PA: 0.114619, D_elegans_zetaCOP-PA: 0.082394): 0.048097): 0.041369, (D_sechellia_zetaCOP-PA: 0.019431, D_simulans_zetaCOP-PA: 0.006079): 0.013120);
Detailed output identifying parameters
kappa (ts/tv) = 1.42617
dN/dS (w) for site classes (K=2)
p: 0.97685 0.02315
w: 0.00380 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 416.9 66.1 0.0269 0.0014 0.0527 0.6 3.5
11..12 0.041 416.9 66.1 0.0269 0.0023 0.0861 1.0 5.7
12..13 0.015 416.9 66.1 0.0269 0.0008 0.0309 0.3 2.0
13..4 0.041 416.9 66.1 0.0269 0.0023 0.0849 1.0 5.6
13..5 0.040 416.9 66.1 0.0269 0.0022 0.0837 0.9 5.5
12..14 0.048 416.9 66.1 0.0269 0.0027 0.1001 1.1 6.6
14..6 0.093 416.9 66.1 0.0269 0.0052 0.1946 2.2 12.9
14..7 0.056 416.9 66.1 0.0269 0.0031 0.1158 1.3 7.7
14..8 0.167 416.9 66.1 0.0269 0.0094 0.3482 3.9 23.0
14..9 0.115 416.9 66.1 0.0269 0.0064 0.2386 2.7 15.8
14..10 0.082 416.9 66.1 0.0269 0.0046 0.1715 1.9 11.3
11..15 0.013 416.9 66.1 0.0269 0.0007 0.0273 0.3 1.8
15..2 0.019 416.9 66.1 0.0269 0.0011 0.0405 0.5 2.7
15..3 0.006 416.9 66.1 0.0269 0.0003 0.0127 0.1 0.8
Time used: 0:16
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
lnL(ntime: 14 np: 19): -1111.975618 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..6 14..7 14..8 14..9 14..10 11..15 15..2 15..3
0.025324 0.041368 0.014837 0.040769 0.040213 0.048097 0.093480 0.055641 0.167247 0.114619 0.082395 0.013120 0.019431 0.006079 1.426172 0.976849 0.023151 0.003805 135.201528
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76262
(1: 0.025324, ((4: 0.040769, 5: 0.040213): 0.014837, (6: 0.093480, 7: 0.055641, 8: 0.167247, 9: 0.114619, 10: 0.082395): 0.048097): 0.041368, (2: 0.019431, 3: 0.006079): 0.013120);
(D_melanogaster_zetaCOP-PA: 0.025324, ((D_yakuba_zetaCOP-PA: 0.040769, D_erecta_zetaCOP-PA: 0.040213): 0.014837, (D_takahashii_zetaCOP-PA: 0.093480, D_biarmipes_zetaCOP-PA: 0.055641, D_eugracilis_zetaCOP-PA: 0.167247, D_rhopaloa_zetaCOP-PA: 0.114619, D_elegans_zetaCOP-PA: 0.082395): 0.048097): 0.041368, (D_sechellia_zetaCOP-PA: 0.019431, D_simulans_zetaCOP-PA: 0.006079): 0.013120);
Detailed output identifying parameters
kappa (ts/tv) = 1.42617
dN/dS (w) for site classes (K=3)
p: 0.97685 0.02315 0.00000
w: 0.00380 1.00000 135.20153
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 416.9 66.1 0.0269 0.0014 0.0527 0.6 3.5
11..12 0.041 416.9 66.1 0.0269 0.0023 0.0861 1.0 5.7
12..13 0.015 416.9 66.1 0.0269 0.0008 0.0309 0.3 2.0
13..4 0.041 416.9 66.1 0.0269 0.0023 0.0849 1.0 5.6
13..5 0.040 416.9 66.1 0.0269 0.0022 0.0837 0.9 5.5
12..14 0.048 416.9 66.1 0.0269 0.0027 0.1001 1.1 6.6
14..6 0.093 416.9 66.1 0.0269 0.0052 0.1946 2.2 12.9
14..7 0.056 416.9 66.1 0.0269 0.0031 0.1158 1.3 7.7
14..8 0.167 416.9 66.1 0.0269 0.0094 0.3482 3.9 23.0
14..9 0.115 416.9 66.1 0.0269 0.0064 0.2386 2.7 15.8
14..10 0.082 416.9 66.1 0.0269 0.0046 0.1715 1.9 11.3
11..15 0.013 416.9 66.1 0.0269 0.0007 0.0273 0.3 1.8
15..2 0.019 416.9 66.1 0.0269 0.0011 0.0405 0.5 2.7
15..3 0.006 416.9 66.1 0.0269 0.0003 0.0127 0.1 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaCOP-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.347 0.135 0.083 0.068 0.063 0.062 0.061 0.061 0.060 0.060
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:56
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
lnL(ntime: 14 np: 20): -1111.837858 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..6 14..7 14..8 14..9 14..10 11..15 15..2 15..3
0.025090 0.040842 0.014774 0.040437 0.039827 0.047971 0.093211 0.055303 0.166443 0.114221 0.082076 0.012984 0.019251 0.006018 1.401979 0.000232 0.974829 0.003489 0.003493 0.785116
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.75845
(1: 0.025090, ((4: 0.040437, 5: 0.039827): 0.014774, (6: 0.093211, 7: 0.055303, 8: 0.166443, 9: 0.114221, 10: 0.082076): 0.047971): 0.040842, (2: 0.019251, 3: 0.006018): 0.012984);
(D_melanogaster_zetaCOP-PA: 0.025090, ((D_yakuba_zetaCOP-PA: 0.040437, D_erecta_zetaCOP-PA: 0.039827): 0.014774, (D_takahashii_zetaCOP-PA: 0.093211, D_biarmipes_zetaCOP-PA: 0.055303, D_eugracilis_zetaCOP-PA: 0.166443, D_rhopaloa_zetaCOP-PA: 0.114221, D_elegans_zetaCOP-PA: 0.082076): 0.047971): 0.040842, (D_sechellia_zetaCOP-PA: 0.019251, D_simulans_zetaCOP-PA: 0.006018): 0.012984);
Detailed output identifying parameters
kappa (ts/tv) = 1.40198
dN/dS (w) for site classes (K=3)
p: 0.00023 0.97483 0.02494
w: 0.00349 0.00349 0.78512
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 417.1 65.9 0.0230 0.0012 0.0535 0.5 3.5
11..12 0.041 417.1 65.9 0.0230 0.0020 0.0871 0.8 5.7
12..13 0.015 417.1 65.9 0.0230 0.0007 0.0315 0.3 2.1
13..4 0.040 417.1 65.9 0.0230 0.0020 0.0862 0.8 5.7
13..5 0.040 417.1 65.9 0.0230 0.0020 0.0849 0.8 5.6
12..14 0.048 417.1 65.9 0.0230 0.0024 0.1023 1.0 6.7
14..6 0.093 417.1 65.9 0.0230 0.0046 0.1987 1.9 13.1
14..7 0.055 417.1 65.9 0.0230 0.0027 0.1179 1.1 7.8
14..8 0.166 417.1 65.9 0.0230 0.0082 0.3548 3.4 23.4
14..9 0.114 417.1 65.9 0.0230 0.0056 0.2435 2.3 16.1
14..10 0.082 417.1 65.9 0.0230 0.0040 0.1750 1.7 11.5
11..15 0.013 417.1 65.9 0.0230 0.0006 0.0277 0.3 1.8
15..2 0.019 417.1 65.9 0.0230 0.0009 0.0410 0.4 2.7
15..3 0.006 417.1 65.9 0.0230 0.0003 0.0128 0.1 0.8
Naive Empirical Bayes (NEB) analysis
Time used: 1:15
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
lnL(ntime: 14 np: 17): -1114.560557 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..6 14..7 14..8 14..9 14..10 11..15 15..2 15..3
0.025093 0.040494 0.014857 0.040482 0.039843 0.049080 0.094966 0.055823 0.167668 0.115568 0.083008 0.012975 0.019266 0.006015 1.390111 0.010759 0.252198
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76514
(1: 0.025093, ((4: 0.040482, 5: 0.039843): 0.014857, (6: 0.094966, 7: 0.055823, 8: 0.167668, 9: 0.115568, 10: 0.083008): 0.049080): 0.040494, (2: 0.019266, 3: 0.006015): 0.012975);
(D_melanogaster_zetaCOP-PA: 0.025093, ((D_yakuba_zetaCOP-PA: 0.040482, D_erecta_zetaCOP-PA: 0.039843): 0.014857, (D_takahashii_zetaCOP-PA: 0.094966, D_biarmipes_zetaCOP-PA: 0.055823, D_eugracilis_zetaCOP-PA: 0.167668, D_rhopaloa_zetaCOP-PA: 0.115568, D_elegans_zetaCOP-PA: 0.083008): 0.049080): 0.040494, (D_sechellia_zetaCOP-PA: 0.019266, D_simulans_zetaCOP-PA: 0.006015): 0.012975);
Detailed output identifying parameters
kappa (ts/tv) = 1.39011
Parameters in M7 (beta):
p = 0.01076 q = 0.25220
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.23867
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 417.2 65.8 0.0239 0.0013 0.0533 0.5 3.5
11..12 0.040 417.2 65.8 0.0239 0.0021 0.0860 0.9 5.7
12..13 0.015 417.2 65.8 0.0239 0.0008 0.0316 0.3 2.1
13..4 0.040 417.2 65.8 0.0239 0.0021 0.0860 0.9 5.7
13..5 0.040 417.2 65.8 0.0239 0.0020 0.0846 0.8 5.6
12..14 0.049 417.2 65.8 0.0239 0.0025 0.1043 1.0 6.9
14..6 0.095 417.2 65.8 0.0239 0.0048 0.2017 2.0 13.3
14..7 0.056 417.2 65.8 0.0239 0.0028 0.1186 1.2 7.8
14..8 0.168 417.2 65.8 0.0239 0.0085 0.3562 3.5 23.4
14..9 0.116 417.2 65.8 0.0239 0.0059 0.2455 2.4 16.2
14..10 0.083 417.2 65.8 0.0239 0.0042 0.1763 1.8 11.6
11..15 0.013 417.2 65.8 0.0239 0.0007 0.0276 0.3 1.8
15..2 0.019 417.2 65.8 0.0239 0.0010 0.0409 0.4 2.7
15..3 0.006 417.2 65.8 0.0239 0.0003 0.0128 0.1 0.8
Time used: 2:21
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10)), (2, 3)); MP score: 102
lnL(ntime: 14 np: 19): -1112.009417 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..6 14..7 14..8 14..9 14..10 11..15 15..2 15..3
0.025316 0.041354 0.014833 0.040757 0.040204 0.048078 0.093441 0.055619 0.167181 0.114575 0.082367 0.013116 0.019425 0.006077 1.426258 0.976932 0.414705 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76234
(1: 0.025316, ((4: 0.040757, 5: 0.040204): 0.014833, (6: 0.093441, 7: 0.055619, 8: 0.167181, 9: 0.114575, 10: 0.082367): 0.048078): 0.041354, (2: 0.019425, 3: 0.006077): 0.013116);
(D_melanogaster_zetaCOP-PA: 0.025316, ((D_yakuba_zetaCOP-PA: 0.040757, D_erecta_zetaCOP-PA: 0.040204): 0.014833, (D_takahashii_zetaCOP-PA: 0.093441, D_biarmipes_zetaCOP-PA: 0.055619, D_eugracilis_zetaCOP-PA: 0.167181, D_rhopaloa_zetaCOP-PA: 0.114575, D_elegans_zetaCOP-PA: 0.082367): 0.048078): 0.041354, (D_sechellia_zetaCOP-PA: 0.019425, D_simulans_zetaCOP-PA: 0.006077): 0.013116);
Detailed output identifying parameters
kappa (ts/tv) = 1.42626
Parameters in M8 (beta&w>1):
p0 = 0.97693 p = 0.41471 q = 99.00000
(p1 = 0.02307) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09769 0.09769 0.09769 0.09769 0.09769 0.09769 0.09769 0.09769 0.09769 0.09769 0.02307
w: 0.00001 0.00008 0.00027 0.00063 0.00120 0.00206 0.00335 0.00534 0.00876 0.01709 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.025 416.9 66.1 0.0269 0.0014 0.0527 0.6 3.5
11..12 0.041 416.9 66.1 0.0269 0.0023 0.0861 1.0 5.7
12..13 0.015 416.9 66.1 0.0269 0.0008 0.0309 0.3 2.0
13..4 0.041 416.9 66.1 0.0269 0.0023 0.0849 1.0 5.6
13..5 0.040 416.9 66.1 0.0269 0.0022 0.0837 0.9 5.5
12..14 0.048 416.9 66.1 0.0269 0.0027 0.1001 1.1 6.6
14..6 0.093 416.9 66.1 0.0269 0.0052 0.1945 2.2 12.9
14..7 0.056 416.9 66.1 0.0269 0.0031 0.1158 1.3 7.7
14..8 0.167 416.9 66.1 0.0269 0.0093 0.3481 3.9 23.0
14..9 0.115 416.9 66.1 0.0269 0.0064 0.2385 2.7 15.8
14..10 0.082 416.9 66.1 0.0269 0.0046 0.1715 1.9 11.3
11..15 0.013 416.9 66.1 0.0269 0.0007 0.0273 0.3 1.8
15..2 0.019 416.9 66.1 0.0269 0.0011 0.0404 0.5 2.7
15..3 0.006 416.9 66.1 0.0269 0.0003 0.0127 0.1 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaCOP-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.001 0.013 0.066 0.240 0.680
ws: 0.422 0.138 0.076 0.059 0.053 0.051 0.050 0.050 0.050 0.050
Time used: 4:20
Model 1: NearlyNeutral -1111.975618 Model 2: PositiveSelection -1111.975618 Model 0: one-ratio -1126.154367 Model 3: discrete -1111.837858 Model 7: beta -1114.560557 Model 8: beta&w>1 -1112.009417 Model 0 vs 1 28.357498000000305 Model 2 vs 1 0.0 Model 8 vs 7 5.102280000000064
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
