--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Sat Dec 10 02:17:42 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/zen-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2459.69         -2468.45
2      -2459.77         -2467.99
--------------------------------------
TOTAL    -2459.73         -2468.25
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.313638    0.001429    0.237229    0.383982    0.310033    752.67   1126.84    1.000
r(A<->C){all}   0.071471    0.000441    0.034492    0.113824    0.069311    937.97   1047.05    1.000
r(A<->G){all}   0.211409    0.001457    0.140984    0.289363    0.209158    858.69    993.22    1.000
r(A<->T){all}   0.159155    0.001499    0.088378    0.231998    0.156288    902.06    926.76    1.000
r(C<->G){all}   0.082919    0.000492    0.040859    0.126207    0.080997    898.51    934.72    1.000
r(C<->T){all}   0.325772    0.002167    0.230524    0.411233    0.324081    807.67    828.82    1.000
r(G<->T){all}   0.149274    0.001302    0.080745    0.218305    0.147509   1093.29   1102.97    1.000
pi(A){all}      0.264166    0.000173    0.238794    0.289751    0.264290    858.35    980.72    1.000
pi(C){all}      0.308215    0.000181    0.280230    0.332879    0.308302   1039.11   1202.42    1.000
pi(G){all}      0.235047    0.000157    0.211636    0.259319    0.234989    972.91   1102.00    1.000
pi(T){all}      0.192572    0.000129    0.171655    0.214959    0.192303    779.81    966.60    1.000
alpha{1,2}      0.065019    0.002081    0.000123    0.149395    0.058973   1213.64   1217.02    1.000
alpha{3}        2.047519    0.617053    0.722404    3.497887    1.921081   1227.81   1352.92    1.001
pinvar{all}     0.364157    0.006804    0.197773    0.519547    0.369231   1092.94   1112.79    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2329.092454
Model 2: PositiveSelection	-2327.229819
Model 0: one-ratio	-2348.315465
Model 3: discrete	-2326.630916
Model 7: beta	-2329.236611
Model 8: beta&w>1	-2326.790482


Model 0 vs 1	38.446022000000085

Model 2 vs 1	3.7252699999999095

Model 8 vs 7	4.892257999999856
>C1
MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAV
APVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVSTA
TSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPIL
ATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTSYN
YPNoo
>C2
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKVNTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNPQPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQISTA
TPGTPANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILAT
QSWHPSSQSQMPTCVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTTYNYP
Noooo
>C3
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNPQPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQISTA
TPVTSANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILAT
QSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTTYNYP
Noooo
>C4
MSSVMHYYPVHQAKVGPYTAEPSEVKYSELIYGHHHDVNPISLPPNYNQM
NSNPTTLNDHCSPQQLHHQHVSSDENLPSQHSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGTAAAEKRPMMAV
APVNPISQSDYQDSQNIKSEVSTNNSMCSSADLSEILEHLAQTTTAPQIS
TSTSGISANSSSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSANHMNPCVTP
YNYPN
>C5
MSSVMHYYPVHQAKVGPYPAEPSEVKYSDLIYGHHHDVNPLSLPPSYNQL
NSNPTTLNDHCSPQQLHQQQVSSDENLPCQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGSAAAEKRPMMAV
APVNPQSDYQASQKIKSEVSTNNSMCSSADLSEILEHLAQSTTAPQSSTS
TPETTANSSSSSSSASGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPIL
ATQSWHPSSQNQIPTSVHAAPSMNLSWGEPAAKSRKLSANHRNPCVTAYN
YPNoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=359 

C1              MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
C2              MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
C3              MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
C4              MSSVMHYYPVHQAKVGPYTAEPSEVKYSELIYGHHHDVNPISLPPNYNQM
C5              MSSVMHYYPVHQAKVGPYPAEPSEVKYSDLIYGHHHDVNPLSLPPSYNQL
                ****************.*.*:*******:***********:.***.***:

C1              NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
C2              NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPSHDSQRVKLKRSRTAFTSV
C3              NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
C4              NSNPTTLNDHCSPQQLHHQHVSSDENLPSQHSHDSQRVKLKRSRTAFTSV
C5              NSNPTTLNDHCSPQQLHQQQVSSDENLPCQPSHDSQRVKLKRSRTAFTSV
                **************::*:*:********.* .******************

C1              QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
C2              QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
C3              QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
C4              QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
C5              QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
                **************************************************

C1              GHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAV
C2              GHREPKVNTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
C3              GHREPKANTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
C4              GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGTAAAEKRPMMAV
C5              GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGSAAAEKRPMMAV
                ****** *:****************:************:********:**

C1              APVNP--KPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVS
C2              APVNP--QPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
C3              APVNP--QPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
C4              APVNPISQSDYQDSQNIKSEVSTNNSMCSSADLSEILEHLAQTTTAPQIS
C5              APVNP--QSDYQASQKIKSEVSTNNSMCSSADLSEILEHLAQSTTAPQSS
                *****  :.*** **::*:*.****.****************:*:*** *

C1              TATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
C2              TATP--GTPANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
C3              TATP--VTSANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
C4              TSTSGISANSSSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
C5              TSTPETTANSSSSSSSASGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
                *:*.   : :.*:***:*********************************

C1              ILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTS
C2              ILATQSWHPSSQSQMPTCVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
C3              ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
C4              ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSANHMNPCVTP
C5              ILATQSWHPSSQNQIPTSVHAAPSMNLSWGEPAAKSRKLSANHRNPCVTA
                ************.*:**.**********************.** *****.

C1              YNYPNoo--
C2              YNYPNoooo
C3              YNYPNoooo
C4              YNYPN----
C5              YNYPNoo--
                *****    




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  355 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  355 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7438]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [7438]--->[7344]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/zen-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.297 Mb, Max= 30.647 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAV
APVNP--KPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVS
TATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTS
YNYPNoo--
>C2
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKVNTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNP--QPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
TATP--GTPANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQMPTCVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
YNYPNoooo
>C3
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNP--QPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
TATP--VTSANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
YNYPNoooo
>C4
MSSVMHYYPVHQAKVGPYTAEPSEVKYSELIYGHHHDVNPISLPPNYNQM
NSNPTTLNDHCSPQQLHHQHVSSDENLPSQHSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGTAAAEKRPMMAV
APVNPISQSDYQDSQNIKSEVSTNNSMCSSADLSEILEHLAQTTTAPQIS
TSTSGISANSSSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSANHMNPCVTP
YNYPN----
>C5
MSSVMHYYPVHQAKVGPYPAEPSEVKYSDLIYGHHHDVNPLSLPPSYNQL
NSNPTTLNDHCSPQQLHQQQVSSDENLPCQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGSAAAEKRPMMAV
APVNP--QSDYQASQKIKSEVSTNNSMCSSADLSEILEHLAQSTTAPQSS
TSTPETTANSSSSSSSASGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQNQIPTSVHAAPSMNLSWGEPAAKSRKLSANHRNPCVTA
YNYPNoo--

FORMAT of file /tmp/tmp4935346303602795595aln Not Supported[FATAL:T-COFFEE]
>C1
MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAV
APVNP--KPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVS
TATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTS
YNYPNoo--
>C2
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKVNTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNP--QPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
TATP--GTPANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQMPTCVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
YNYPNoooo
>C3
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNP--QPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
TATP--VTSANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
YNYPNoooo
>C4
MSSVMHYYPVHQAKVGPYTAEPSEVKYSELIYGHHHDVNPISLPPNYNQM
NSNPTTLNDHCSPQQLHHQHVSSDENLPSQHSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGTAAAEKRPMMAV
APVNPISQSDYQDSQNIKSEVSTNNSMCSSADLSEILEHLAQTTTAPQIS
TSTSGISANSSSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSANHMNPCVTP
YNYPN----
>C5
MSSVMHYYPVHQAKVGPYPAEPSEVKYSDLIYGHHHDVNPLSLPPSYNQL
NSNPTTLNDHCSPQQLHQQQVSSDENLPCQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGSAAAEKRPMMAV
APVNP--QSDYQASQKIKSEVSTNNSMCSSADLSEILEHLAQSTTAPQSS
TSTPETTANSSSSSSSASGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQNQIPTSVHAAPSMNLSWGEPAAKSRKLSANHRNPCVTA
YNYPNoo--
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:359 S:98 BS:359
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 94.05 C1	 C2	 94.05
TOP	    1    0	 94.05 C2	 C1	 94.05
BOT	    0    2	 94.62 C1	 C3	 94.62
TOP	    2    0	 94.62 C3	 C1	 94.62
BOT	    0    3	 90.37 C1	 C4	 90.37
TOP	    3    0	 90.37 C4	 C1	 90.37
BOT	    0    4	 89.01 C1	 C5	 89.01
TOP	    4    0	 89.01 C5	 C1	 89.01
BOT	    1    2	 98.31 C2	 C3	 98.31
TOP	    2    1	 98.31 C3	 C2	 98.31
BOT	    1    3	 92.02 C2	 C4	 92.02
TOP	    3    1	 92.02 C4	 C2	 92.02
BOT	    1    4	 91.22 C2	 C5	 91.22
TOP	    4    1	 91.22 C5	 C2	 91.22
BOT	    2    3	 92.59 C3	 C4	 92.59
TOP	    3    2	 92.59 C4	 C3	 92.59
BOT	    2    4	 91.78 C3	 C5	 91.78
TOP	    4    2	 91.78 C5	 C3	 91.78
BOT	    3    4	 93.77 C4	 C5	 93.77
TOP	    4    3	 93.77 C5	 C4	 93.77
AVG	 0	 C1	  *	 92.01
AVG	 1	 C2	  *	 93.90
AVG	 2	 C3	  *	 94.33
AVG	 3	 C4	  *	 92.19
AVG	 4	 C5	  *	 91.45
TOT	 TOT	  *	 92.77
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCATCCGTCATGCACTACTATCCAGTTCACCAGGCTAAAGTCGGCTC
C2              ATGTCATCCGTCATGCACTACTATCCAGTTCACCAGGCTAAAGTCGGCCC
C3              ATGTCATCCGTCATGCACTACTATCCAGTTCACCAGGCTAAAGTCGGCCC
C4              ATGTCATCCGTCATGCATTACTATCCAGTGCACCAGGCTAAAGTTGGCCC
C5              ATGTCATCCGTCATGCATTACTATCCAGTTCACCAGGCTAAAGTGGGCCC
                ***************** *********** ************** *** *

C1              CTATTCAGCAGATCCTTCCGAGGTTAAATACAGTGATTTGATCTATGGTC
C2              CTATCCAGCAGATCCTTCCGAGGTTAAATACAGTGATTTGATCTATGGTC
C3              CTATCCAGCAGATCCTTCCGAGGTTAAATACAGTGATTTGATCTATGGTC
C4              TTATACAGCAGAGCCTTCCGAGGTGAAATACAGTGAATTGATATATGGTC
C5              TTATCCAGCAGAGCCTTCCGAGGTGAAATACAGTGATTTGATCTATGGTC
                 *** ******* *********** ***********:*****.*******

C1              ATCATCACGATGTTAACCCCATCGGTCTGCCTCCCAACTACAATCAGATG
C2              ATCATCACGACGTGAACCCCATCGGTCTGCCTCCCAACTACAACCAGATG
C3              ATCATCACGACGTGAACCCCATCGGTCTGCCTCCCAACTACAACCAGATG
C4              ATCATCACGATGTGAACCCCATCAGTCTGCCACCCAACTACAACCAGATG
C5              ATCATCACGATGTGAACCCCCTCAGTCTGCCTCCCAGCTACAACCAGCTG
                ********** ** ******.**.*******:****.****** ***.**

C1              AACTCCAACCCCACCACCCTCAACGATCACTGCTCCCCGCAGCATGTGCA
C2              AACTCCAACCCCACCACCCTCAACGATCACTGCTCCCCGCAGCAGTTGCA
C3              AACTCCAACCCCACCACCCTCAACGATCACTGCTCTCCGCAGCAGTTGCA
C4              AACTCCAACCCCACCACCCTCAACGATCACTGCTCCCCGCAGCAGTTACA
C5              AACTCGAACCCCACCACCCTCAACGATCACTGCTCCCCACAGCAGTTACA
                ***** ***************************** **.*****  *.**

C1              TCAGCAGCATGTGTCATCGGACGAGAATCTGCCATCTCAGCCCAACCACG
C2              TCAGCAGCAGGTGTCCTCGGACGAGAATCTGCCATCACAGCCCAGCCACG
C3              TCAGCAGCAGGTGTCCTCCGACGAGAATCTGCCATCCCAGCCCAACCACG
C4              CCATCAGCACGTATCCTCGGACGAGAATTTGCCATCGCAGCATAGCCACG
C5              CCAGCAGCAAGTATCCTCGGACGAGAATCTGCCATGTCAGCCCAGCCACG
                 ** ***** **.**.** ********* ******  ****. *.*****

C1              ACTCGCAGAGGGTGAAGCTTAAGCGATCACGGACTGCCTTCACCAGTGTC
C2              ACTCGCAGAGGGTGAAGCTGAAGCGATCCCGAACTGCCTTCACCAGTGTC
C3              ACTCGCAGAGGGTGAAGCTGAAGCGATCCCGGACTGCCTTCACCAGTGTC
C4              ACTCGCAAAGGGTGAAGCTGAAGCGATCACGAACCGCCTTTACCAGTGTC
C5              ACTCGCAAAGGGTGAAGCTCAAGCGATCCCGAACTGCCTTTACCAGTGTC
                *******.*********** ********.**.** ***** *********

C1              CAACTGGTGGAACTTGAGAACGAGTTCAAGAGCAACATGTACTTGTACAG
C2              CAACTGGTGGAACTTGAGAACGAGTTCAAGAGCAACATGTATTTGTACAG
C3              CAACTGGTGGAACTTGAGAACGAGTTCAAGAGCAACATGTATTTGTACAG
C4              CAACTGGTGGAGCTTGAGAACGAGTTCAAGAGCAACATGTATTTGTACAG
C5              CAACTGGTGGAACTTGAGAATGAGTTCAAAAGCAACATGTATTTGTACAG
                ***********.******** ********.*********** ********

C1              GACGCGCAGGATTGAGATTGCTCAGCGCTTGTCCCTGTGCGAACGCCAGG
C2              GACGCGCAGGATTGAGATTGCTCAGCGCTTGTCCCTGTGCGAACGCCAGG
C3              GACGCGTAGGATTGAGATTGCTCAGCGCTTATCCCTGTGCGAACGCCAGG
C4              GACGCGCAGGATTGAGATAGCACAGCGGCTGTCTCTGTGCGAACGCCAGG
C5              GACGCGCAGGATCGAGATAGCACAGCGGTTGTCTCTGTGCGAACGCCAGG
                ****** ***** *****:**:*****  *.** ****************

C1              TGAAGATCTGGTTCCAGAACCGACGAATGAAGTTCAAGAAGGACATACAA
C2              TGAAGATCTGGTTCCAGAACCGCCGAATGAAGTTCAAGAAGGATATACAA
C3              TGAAGATCTGGTTCCAGAACCGCCGAATGAAGTTCAAGAAGGACATACAA
C4              TGAAGATCTGGTTCCAGAACCGCCGAATGAAGTTCAAGAAGGACATACAA
C5              TGAAGATCTGGTTCCAGAACCGCCGCATGAAGTTCAAGAAAGACATACAG
                **********************.**.**************.** *****.

C1              GGTCACCGCGAGCCCAAGTCCAACGCCAAGTTGGCTCAACCCCAGGCTGA
C2              GGTCACCGCGAGCCCAAGGTCAACACCAAATTGGCTCAACCCCAGGCAGA
C3              GGTCACCGCGAGCCCAAGGCCAACACCAAATTGGCTCAACCGCAGGCAGA
C4              GGTCACCGCGAGCCCAAGGCTAATGCCAAATTGGCTCAACCACAGGCAGA
C5              GGTCACCGTGAGCCCAAGGCCAATGCCAAGTTGGCTCAGCCCCAGGCAGA
                ******** *********   ** .****.********.** *****:**

C1              GCAGAGTGCCCACCGAGGCATAGTGAAGCGCCTCATGTCCTACTCCCAGG
C2              GCAGAGTGCCCACCGAGGCATAGTGAAGCGCCTCATGTCCTACTCCCAGG
C3              GCAGAGTGCCCACCGAGGCATAGTAAAGCGCCTCATGTCCTACTCCCAGG
C4              GCAAAGTGCGCACCGCGGCATAGTGCAGCGCCTCATGTCCTACTCCCAGG
C5              GCAAAGTGCCCACCGCGGCATAGTGCAGCGCCTCATGTCCTACTCCCAGG
                ***.***** *****.********..************************

C1              ATCCCAGGGAGGGCACAGCGGCAGCAGAAAAGCGTCCTATGATGGCAGTG
C2              ATCCCAGGGAGGGCACCGCGGCAGCAGAAAAGCGTCCTATGTTGGCAGTG
C3              ATCCCAGGGAGGGCACCGCGGCAGCAGAAAAGCGTCCTATGTTGGCGGTG
C4              ATCCCAGGGAAGGCACTGCAGCAGCAGAAAAGCGGCCCATGATGGCAGTG
C5              ATCCCAGGGAGGGCAGCGCGGCTGCAGAAAAGCGTCCAATGATGGCAGTG
                **********.****  **.**:*********** ** ***:****.***

C1              GCTCCTGTGAATCCA------AAGCCAGACTATCAAGCCAGCCAGAAAAT
C2              GCTCCTGTGAATCCC------CAGCCAGACTATCAACCCAGCCAGAAAAT
C3              GCTCCTGTGAATCCC------CAGCCAGACTATCAACCCAGCCAGAAAAT
C4              GCACCTGTGAATCCCATATCCCAGTCAGACTATCAGGACAGCCAGAATAT
C5              GCTCCTGTGAATCCC------CAGTCAGACTATCAAGCCAGCCAGAAAAT
                **:***********.      .** **********. .*********:**

C1              GAAGACCGAAGCATCAACCAACAACGGCATGTGCTCCAGCGCCGACCTCA
C2              TAAGACCGAAGCATCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
C3              TAAGACCGAAGCATCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
C4              AAAGAGCGAAGTATCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
C5              AAAGAGCGAAGTGTCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
                 **** ***** .************.******************* ****

C1              GCGAGATCTTGGAGCATCTGGCTCAAACTACAGCTGCACCACAGGTCAGC
C2              GCGAGATCTTGGAGCATCTGGCTCAAACTACAGCTGCACCACAGATCAGC
C3              GCGAGATCTTGGAGCATCTGGCTCAAACTACAGCTGCACCACAGATCAGC
C4              GCGAGATCTTGGAGCACCTGGCTCAAACTACAACTGCTCCACAGATCAGC
C5              GCGAGATCTTGGAGCACCTGGCTCAATCTACAACTGCCCCACAGAGCAGC
                **************** *********:*****.**** ******. ****

C1              ACTGCCACATCTAGCACAGGAACATCTACCAACTCGGCTTCTAGCTCCTC
C2              ACTGCCACTCCA------GGAACACCTGCCAACTCCAGTTCTAGTTCCTC
C3              ACTGCCACTCCA------GTAACATCTGCCAACTCCAGTTCTAGTTCCTC
C4              ACTTCCACTTCAGGAATATCTGCCAATTCGAGTTCGAGTTCCAGCTCCTC
C5              ACTTCCACTCCAGAAACAACTGCCAACTCGAGTTCTAGCTCCTCTTCCGC
                *** ****: *:        :.*. .  * *. ** .  ** :  *** *

C1              TTCGGGCCACTATTCCTACAACGTGGATTTGGTTCTGCAGAGCATCAAGC
C2              TTCCGGGCACTATTCCTACAACGTGGATTTGGTTCTGCAAAGCATCAAGC
C3              TTCCGGGCACTATTCCTACAACGTGGATTTGGTTCTCCAAAGCATCAAGC
C4              TTCCGGGCACTATTCCTACAACGTGGACTTGGTGCTGCAGAGCATAAAGC
C5              TTCCGGGCACTATTCCTACAACGTGGATCTGGTCCTGCAGAGCATCAAGC
                *** ** ********************  **** ** **.*****.****

C1              AGGATTTGGAGGCAGCGGCCCAGGCTTGGTCCAAGTCTAAATCCGCGCCT
C2              AGGATTTGGAGGCAGCGGCCCAGGCGTGGTCCAAGTCGAAATCCGCGCCT
C3              AGGATTTGGAGGCAGCGGCCCAGGCGTGGTCTAAGTCGAAATCCGCGCCT
C4              AGGATTTGGAGGCTGCGGCCCAGGCTTGGTCCAAGTCCAAATCCGCGCCC
C5              AGGATTTGGAGGCAGCGGCCCAGGCTTGGTCCAAGTCCAAATCCGCGCCC
                *************:*********** ***** ***** *********** 

C1              ATCCTGGCCACTCAATCCTGGCATCCCAGTTCCCAAAGTCAGGTCCCCAC
C2              ATCCTGGCCACTCAATCCTGGCATCCCAGCTCCCAAAGTCAGATGCCCAC
C3              ATCCTGGCCACTCAATCCTGGCATCCCAGCTCCCAAAGTCAGATCCCCAC
C4              ATCCTGGCTACTCAATCCTGGCATCCCAGTTCCCAAAGCCAGATTCCCAC
C5              ATCCTGGCTACTCAATCCTGGCATCCCAGTTCCCAAAATCAGATCCCCAC
                ******** ******************** *******. ***.* *****

C1              GAGCGTGCATGCGGCTCCCTCGATGAATCTGTCGTGGGGCGAGCCTGCTG
C2              GTGCGTGCATGCGGCTCCCTCAATGAATCTGTCGTGGGGCGAGCCTGCTG
C3              GAGCGTGCATGCGGCTCCCTCAATGAATCTGTCGTGGGGCGAGCCTGCTG
C4              GAGCGTCCATGCGGCTCCCTCAATGAATCTGTCCTGGGGCGAGCCTGCTG
C5              GAGCGTGCATGCGGCACCCTCTATGAATCTGTCCTGGGGCGAGCCTGCTG
                *:**** ********:***** *********** ****************

C1              CCAAGTCGAGAAAGCTGAGCGTTAATCACATGAACCCGTGCGTAACCTCC
C2              CCAAGTCGAGAAAGCTGAGTGTTAATCACATGAACCCGTGCGTAACCACC
C3              CCAAGTCGAGAAAGCTGAGCGTTAATCACATGAACCCGTGCGTAACCACC
C4              CCAAGTCGAGAAAGCTAAGCGCTAATCACATGAACCCGTGCGTAACCCCC
C5              CCAAGTCGAGAAAGCTGAGCGCTAATCACAGGAACCCGTGCGTAACCGCC
                ****************.** * ******** **************** **

C1              TACAATTATCCCAAC------------
C2              TACAATTATCCCAAC------------
C3              TACAATTATCCCAAC------------
C4              TACAATTATCCCAAC------------
C5              TATAATTATCCCAAC------------
                ** ************            



>C1
ATGTCATCCGTCATGCACTACTATCCAGTTCACCAGGCTAAAGTCGGCTC
CTATTCAGCAGATCCTTCCGAGGTTAAATACAGTGATTTGATCTATGGTC
ATCATCACGATGTTAACCCCATCGGTCTGCCTCCCAACTACAATCAGATG
AACTCCAACCCCACCACCCTCAACGATCACTGCTCCCCGCAGCATGTGCA
TCAGCAGCATGTGTCATCGGACGAGAATCTGCCATCTCAGCCCAACCACG
ACTCGCAGAGGGTGAAGCTTAAGCGATCACGGACTGCCTTCACCAGTGTC
CAACTGGTGGAACTTGAGAACGAGTTCAAGAGCAACATGTACTTGTACAG
GACGCGCAGGATTGAGATTGCTCAGCGCTTGTCCCTGTGCGAACGCCAGG
TGAAGATCTGGTTCCAGAACCGACGAATGAAGTTCAAGAAGGACATACAA
GGTCACCGCGAGCCCAAGTCCAACGCCAAGTTGGCTCAACCCCAGGCTGA
GCAGAGTGCCCACCGAGGCATAGTGAAGCGCCTCATGTCCTACTCCCAGG
ATCCCAGGGAGGGCACAGCGGCAGCAGAAAAGCGTCCTATGATGGCAGTG
GCTCCTGTGAATCCA------AAGCCAGACTATCAAGCCAGCCAGAAAAT
GAAGACCGAAGCATCAACCAACAACGGCATGTGCTCCAGCGCCGACCTCA
GCGAGATCTTGGAGCATCTGGCTCAAACTACAGCTGCACCACAGGTCAGC
ACTGCCACATCTAGCACAGGAACATCTACCAACTCGGCTTCTAGCTCCTC
TTCGGGCCACTATTCCTACAACGTGGATTTGGTTCTGCAGAGCATCAAGC
AGGATTTGGAGGCAGCGGCCCAGGCTTGGTCCAAGTCTAAATCCGCGCCT
ATCCTGGCCACTCAATCCTGGCATCCCAGTTCCCAAAGTCAGGTCCCCAC
GAGCGTGCATGCGGCTCCCTCGATGAATCTGTCGTGGGGCGAGCCTGCTG
CCAAGTCGAGAAAGCTGAGCGTTAATCACATGAACCCGTGCGTAACCTCC
TACAATTATCCCAAC------------
>C2
ATGTCATCCGTCATGCACTACTATCCAGTTCACCAGGCTAAAGTCGGCCC
CTATCCAGCAGATCCTTCCGAGGTTAAATACAGTGATTTGATCTATGGTC
ATCATCACGACGTGAACCCCATCGGTCTGCCTCCCAACTACAACCAGATG
AACTCCAACCCCACCACCCTCAACGATCACTGCTCCCCGCAGCAGTTGCA
TCAGCAGCAGGTGTCCTCGGACGAGAATCTGCCATCACAGCCCAGCCACG
ACTCGCAGAGGGTGAAGCTGAAGCGATCCCGAACTGCCTTCACCAGTGTC
CAACTGGTGGAACTTGAGAACGAGTTCAAGAGCAACATGTATTTGTACAG
GACGCGCAGGATTGAGATTGCTCAGCGCTTGTCCCTGTGCGAACGCCAGG
TGAAGATCTGGTTCCAGAACCGCCGAATGAAGTTCAAGAAGGATATACAA
GGTCACCGCGAGCCCAAGGTCAACACCAAATTGGCTCAACCCCAGGCAGA
GCAGAGTGCCCACCGAGGCATAGTGAAGCGCCTCATGTCCTACTCCCAGG
ATCCCAGGGAGGGCACCGCGGCAGCAGAAAAGCGTCCTATGTTGGCAGTG
GCTCCTGTGAATCCC------CAGCCAGACTATCAACCCAGCCAGAAAAT
TAAGACCGAAGCATCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
GCGAGATCTTGGAGCATCTGGCTCAAACTACAGCTGCACCACAGATCAGC
ACTGCCACTCCA------GGAACACCTGCCAACTCCAGTTCTAGTTCCTC
TTCCGGGCACTATTCCTACAACGTGGATTTGGTTCTGCAAAGCATCAAGC
AGGATTTGGAGGCAGCGGCCCAGGCGTGGTCCAAGTCGAAATCCGCGCCT
ATCCTGGCCACTCAATCCTGGCATCCCAGCTCCCAAAGTCAGATGCCCAC
GTGCGTGCATGCGGCTCCCTCAATGAATCTGTCGTGGGGCGAGCCTGCTG
CCAAGTCGAGAAAGCTGAGTGTTAATCACATGAACCCGTGCGTAACCACC
TACAATTATCCCAAC------------
>C3
ATGTCATCCGTCATGCACTACTATCCAGTTCACCAGGCTAAAGTCGGCCC
CTATCCAGCAGATCCTTCCGAGGTTAAATACAGTGATTTGATCTATGGTC
ATCATCACGACGTGAACCCCATCGGTCTGCCTCCCAACTACAACCAGATG
AACTCCAACCCCACCACCCTCAACGATCACTGCTCTCCGCAGCAGTTGCA
TCAGCAGCAGGTGTCCTCCGACGAGAATCTGCCATCCCAGCCCAACCACG
ACTCGCAGAGGGTGAAGCTGAAGCGATCCCGGACTGCCTTCACCAGTGTC
CAACTGGTGGAACTTGAGAACGAGTTCAAGAGCAACATGTATTTGTACAG
GACGCGTAGGATTGAGATTGCTCAGCGCTTATCCCTGTGCGAACGCCAGG
TGAAGATCTGGTTCCAGAACCGCCGAATGAAGTTCAAGAAGGACATACAA
GGTCACCGCGAGCCCAAGGCCAACACCAAATTGGCTCAACCGCAGGCAGA
GCAGAGTGCCCACCGAGGCATAGTAAAGCGCCTCATGTCCTACTCCCAGG
ATCCCAGGGAGGGCACCGCGGCAGCAGAAAAGCGTCCTATGTTGGCGGTG
GCTCCTGTGAATCCC------CAGCCAGACTATCAACCCAGCCAGAAAAT
TAAGACCGAAGCATCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
GCGAGATCTTGGAGCATCTGGCTCAAACTACAGCTGCACCACAGATCAGC
ACTGCCACTCCA------GTAACATCTGCCAACTCCAGTTCTAGTTCCTC
TTCCGGGCACTATTCCTACAACGTGGATTTGGTTCTCCAAAGCATCAAGC
AGGATTTGGAGGCAGCGGCCCAGGCGTGGTCTAAGTCGAAATCCGCGCCT
ATCCTGGCCACTCAATCCTGGCATCCCAGCTCCCAAAGTCAGATCCCCAC
GAGCGTGCATGCGGCTCCCTCAATGAATCTGTCGTGGGGCGAGCCTGCTG
CCAAGTCGAGAAAGCTGAGCGTTAATCACATGAACCCGTGCGTAACCACC
TACAATTATCCCAAC------------
>C4
ATGTCATCCGTCATGCATTACTATCCAGTGCACCAGGCTAAAGTTGGCCC
TTATACAGCAGAGCCTTCCGAGGTGAAATACAGTGAATTGATATATGGTC
ATCATCACGATGTGAACCCCATCAGTCTGCCACCCAACTACAACCAGATG
AACTCCAACCCCACCACCCTCAACGATCACTGCTCCCCGCAGCAGTTACA
CCATCAGCACGTATCCTCGGACGAGAATTTGCCATCGCAGCATAGCCACG
ACTCGCAAAGGGTGAAGCTGAAGCGATCACGAACCGCCTTTACCAGTGTC
CAACTGGTGGAGCTTGAGAACGAGTTCAAGAGCAACATGTATTTGTACAG
GACGCGCAGGATTGAGATAGCACAGCGGCTGTCTCTGTGCGAACGCCAGG
TGAAGATCTGGTTCCAGAACCGCCGAATGAAGTTCAAGAAGGACATACAA
GGTCACCGCGAGCCCAAGGCTAATGCCAAATTGGCTCAACCACAGGCAGA
GCAAAGTGCGCACCGCGGCATAGTGCAGCGCCTCATGTCCTACTCCCAGG
ATCCCAGGGAAGGCACTGCAGCAGCAGAAAAGCGGCCCATGATGGCAGTG
GCACCTGTGAATCCCATATCCCAGTCAGACTATCAGGACAGCCAGAATAT
AAAGAGCGAAGTATCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
GCGAGATCTTGGAGCACCTGGCTCAAACTACAACTGCTCCACAGATCAGC
ACTTCCACTTCAGGAATATCTGCCAATTCGAGTTCGAGTTCCAGCTCCTC
TTCCGGGCACTATTCCTACAACGTGGACTTGGTGCTGCAGAGCATAAAGC
AGGATTTGGAGGCTGCGGCCCAGGCTTGGTCCAAGTCCAAATCCGCGCCC
ATCCTGGCTACTCAATCCTGGCATCCCAGTTCCCAAAGCCAGATTCCCAC
GAGCGTCCATGCGGCTCCCTCAATGAATCTGTCCTGGGGCGAGCCTGCTG
CCAAGTCGAGAAAGCTAAGCGCTAATCACATGAACCCGTGCGTAACCCCC
TACAATTATCCCAAC------------
>C5
ATGTCATCCGTCATGCATTACTATCCAGTTCACCAGGCTAAAGTGGGCCC
TTATCCAGCAGAGCCTTCCGAGGTGAAATACAGTGATTTGATCTATGGTC
ATCATCACGATGTGAACCCCCTCAGTCTGCCTCCCAGCTACAACCAGCTG
AACTCGAACCCCACCACCCTCAACGATCACTGCTCCCCACAGCAGTTACA
CCAGCAGCAAGTATCCTCGGACGAGAATCTGCCATGTCAGCCCAGCCACG
ACTCGCAAAGGGTGAAGCTCAAGCGATCCCGAACTGCCTTTACCAGTGTC
CAACTGGTGGAACTTGAGAATGAGTTCAAAAGCAACATGTATTTGTACAG
GACGCGCAGGATCGAGATAGCACAGCGGTTGTCTCTGTGCGAACGCCAGG
TGAAGATCTGGTTCCAGAACCGCCGCATGAAGTTCAAGAAAGACATACAG
GGTCACCGTGAGCCCAAGGCCAATGCCAAGTTGGCTCAGCCCCAGGCAGA
GCAAAGTGCCCACCGCGGCATAGTGCAGCGCCTCATGTCCTACTCCCAGG
ATCCCAGGGAGGGCAGCGCGGCTGCAGAAAAGCGTCCAATGATGGCAGTG
GCTCCTGTGAATCCC------CAGTCAGACTATCAAGCCAGCCAGAAAAT
AAAGAGCGAAGTGTCAACCAACAACAGCATGTGCTCCAGCGCCGATCTCA
GCGAGATCTTGGAGCACCTGGCTCAATCTACAACTGCCCCACAGAGCAGC
ACTTCCACTCCAGAAACAACTGCCAACTCGAGTTCTAGCTCCTCTTCCGC
TTCCGGGCACTATTCCTACAACGTGGATCTGGTCCTGCAGAGCATCAAGC
AGGATTTGGAGGCAGCGGCCCAGGCTTGGTCCAAGTCCAAATCCGCGCCC
ATCCTGGCTACTCAATCCTGGCATCCCAGTTCCCAAAATCAGATCCCCAC
GAGCGTGCATGCGGCACCCTCTATGAATCTGTCCTGGGGCGAGCCTGCTG
CCAAGTCGAGAAAGCTGAGCGCTAATCACAGGAACCCGTGCGTAACCGCC
TATAATTATCCCAAC------------
>C1
MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAV
APVNPooKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVS
TATSSTGTSTNSASSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQVPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTS
YNYPN
>C2
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKVNTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNPooQPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
TATPooGTPANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQMPTCVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
YNYPN
>C3
MSSVMHYYPVHQAKVGPYPADPSEVKYSDLIYGHHHDVNPIGLPPNYNQM
NSNPTTLNDHCSPQQLHQQQVSSDENLPSQPNHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANTKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMLAV
APVNPooQPDYQPSQKIKTEASTNNSMCSSADLSEILEHLAQTTAAPQIS
TATPooVTSANSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSVNHMNPCVTT
YNYPN
>C4
MSSVMHYYPVHQAKVGPYTAEPSEVKYSELIYGHHHDVNPISLPPNYNQM
NSNPTTLNDHCSPQQLHHQHVSSDENLPSQHSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGTAAAEKRPMMAV
APVNPISQSDYQDSQNIKSEVSTNNSMCSSADLSEILEHLAQTTTAPQIS
TSTSGISANSSSSSSSSSGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQSQIPTSVHAAPSMNLSWGEPAAKSRKLSANHMNPCVTP
YNYPN
>C5
MSSVMHYYPVHQAKVGPYPAEPSEVKYSDLIYGHHHDVNPLSLPPSYNQL
NSNPTTLNDHCSPQQLHQQQVSSDENLPCQPSHDSQRVKLKRSRTAFTSV
QLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ
GHREPKANAKLAQPQAEQSAHRGIVQRLMSYSQDPREGSAAAEKRPMMAV
APVNPooQSDYQASQKIKSEVSTNNSMCSSADLSEILEHLAQSTTAPQSS
TSTPETTANSSSSSSSASGHYSYNVDLVLQSIKQDLEAAAQAWSKSKSAP
ILATQSWHPSSQNQIPTSVHAAPSMNLSWGEPAAKSRKLSANHRNPCVTA
YNYPN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1077 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481335955
      Setting output file names to "/opt/ADOPS/442/zen-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1627422538
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4051434606
      Seed = 1230231918
      Swapseed = 1481335955
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 35 unique site patterns
      Division 2 has 24 unique site patterns
      Division 3 has 71 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2969.288112 -- -25.624409
         Chain 2 -- -2954.561182 -- -25.624409
         Chain 3 -- -2907.037585 -- -25.624409
         Chain 4 -- -2959.224538 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2825.768321 -- -25.624409
         Chain 2 -- -2945.505783 -- -25.624409
         Chain 3 -- -2969.288112 -- -25.624409
         Chain 4 -- -2825.768321 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2969.288] (-2954.561) (-2907.038) (-2959.225) * [-2825.768] (-2945.506) (-2969.288) (-2825.768) 
        500 -- [-2494.495] (-2503.834) (-2497.537) (-2496.943) * [-2495.671] (-2501.011) (-2497.267) (-2498.570) -- 0:00:00
       1000 -- (-2491.273) (-2488.040) (-2495.376) [-2483.686] * [-2481.571] (-2480.472) (-2482.649) (-2489.167) -- 0:00:00
       1500 -- (-2490.591) (-2479.549) (-2485.701) [-2461.191] * (-2471.271) (-2477.492) [-2463.089] (-2491.138) -- 0:00:00
       2000 -- [-2473.462] (-2477.928) (-2489.211) (-2462.075) * (-2479.695) (-2464.960) [-2467.974] (-2493.594) -- 0:00:00
       2500 -- (-2462.662) (-2469.021) (-2483.575) [-2461.543] * (-2463.108) (-2465.651) (-2466.513) [-2472.614] -- 0:00:00
       3000 -- (-2458.586) (-2470.760) (-2471.593) [-2473.525] * (-2461.777) [-2458.067] (-2468.907) (-2465.036) -- 0:00:00
       3500 -- (-2464.496) (-2469.838) [-2467.051] (-2465.893) * (-2470.170) (-2463.808) (-2465.096) [-2462.534] -- 0:04:44
       4000 -- (-2462.478) (-2473.334) (-2468.795) [-2463.119] * [-2462.834] (-2466.136) (-2465.805) (-2460.211) -- 0:04:09
       4500 -- (-2461.257) (-2467.785) [-2463.256] (-2466.656) * (-2465.202) (-2473.745) [-2464.776] (-2465.702) -- 0:03:41
       5000 -- (-2457.646) (-2470.683) [-2463.025] (-2466.709) * (-2461.479) (-2475.447) (-2463.401) [-2468.037] -- 0:03:19

      Average standard deviation of split frequencies: 0.052378

       5500 -- [-2459.066] (-2460.234) (-2469.764) (-2461.553) * (-2461.750) (-2462.592) (-2465.118) [-2465.070] -- 0:03:00
       6000 -- (-2465.117) (-2461.149) [-2459.813] (-2461.385) * (-2466.254) [-2464.107] (-2462.258) (-2466.408) -- 0:02:45
       6500 -- (-2460.363) [-2469.751] (-2463.272) (-2465.462) * [-2464.052] (-2463.371) (-2465.730) (-2468.265) -- 0:02:32
       7000 -- (-2462.613) (-2467.797) [-2464.448] (-2462.158) * (-2465.488) (-2466.212) (-2469.347) [-2464.412] -- 0:02:21
       7500 -- (-2463.057) (-2463.942) (-2467.295) [-2461.574] * (-2469.935) (-2463.651) [-2464.603] (-2462.635) -- 0:02:12
       8000 -- (-2465.424) (-2466.595) [-2465.835] (-2467.939) * (-2466.972) (-2460.386) [-2457.428] (-2462.681) -- 0:04:08
       8500 -- (-2459.912) (-2465.541) (-2471.698) [-2459.602] * (-2462.780) [-2457.933] (-2462.968) (-2467.904) -- 0:03:53
       9000 -- [-2462.722] (-2468.751) (-2471.593) (-2462.581) * [-2464.235] (-2458.102) (-2461.257) (-2463.571) -- 0:03:40
       9500 -- (-2460.859) (-2467.733) [-2462.647] (-2458.006) * (-2459.397) (-2469.131) (-2465.374) [-2463.109] -- 0:03:28
      10000 -- (-2464.386) (-2474.984) [-2466.674] (-2462.799) * (-2465.505) (-2463.388) (-2465.048) [-2465.067] -- 0:03:18

      Average standard deviation of split frequencies: 0.022097

      10500 -- (-2468.608) [-2465.489] (-2461.175) (-2464.300) * (-2456.854) (-2466.019) [-2462.129] (-2465.704) -- 0:03:08
      11000 -- (-2468.671) (-2458.403) (-2459.076) [-2462.708] * (-2465.646) (-2465.566) [-2460.938] (-2465.683) -- 0:02:59
      11500 -- (-2470.063) (-2465.822) (-2460.653) [-2460.545] * (-2462.400) [-2461.504] (-2459.887) (-2466.884) -- 0:04:17
      12000 -- (-2464.727) (-2471.950) (-2462.755) [-2466.960] * (-2467.883) [-2465.672] (-2462.028) (-2464.655) -- 0:04:07
      12500 -- [-2462.123] (-2466.322) (-2464.933) (-2470.433) * (-2465.633) (-2461.226) (-2463.856) [-2463.628] -- 0:03:57
      13000 -- [-2461.920] (-2465.194) (-2467.109) (-2462.463) * (-2466.614) (-2461.919) [-2462.527] (-2457.993) -- 0:03:47
      13500 -- [-2458.199] (-2462.523) (-2468.020) (-2461.330) * (-2466.516) (-2460.501) [-2463.714] (-2465.398) -- 0:03:39
      14000 -- [-2458.325] (-2463.370) (-2459.622) (-2465.165) * [-2462.606] (-2460.064) (-2465.280) (-2468.877) -- 0:03:31
      14500 -- (-2462.321) (-2461.892) [-2459.858] (-2469.320) * (-2464.778) (-2461.638) (-2460.048) [-2457.382] -- 0:03:23
      15000 -- (-2457.833) [-2460.136] (-2463.562) (-2465.209) * (-2462.775) [-2459.951] (-2459.350) (-2457.730) -- 0:04:22

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-2461.824) [-2460.092] (-2461.474) (-2468.513) * (-2466.309) (-2463.239) (-2466.656) [-2465.326] -- 0:04:14
      16000 -- [-2460.553] (-2462.576) (-2462.230) (-2465.066) * (-2466.886) [-2460.219] (-2465.355) (-2458.716) -- 0:04:06
      16500 -- (-2460.350) (-2462.296) (-2468.893) [-2467.220] * (-2469.960) [-2459.443] (-2461.305) (-2459.205) -- 0:03:58
      17000 -- [-2464.038] (-2470.183) (-2465.217) (-2468.266) * (-2463.962) [-2461.226] (-2461.386) (-2462.051) -- 0:03:51
      17500 -- [-2462.409] (-2461.844) (-2463.146) (-2462.359) * (-2467.287) (-2465.445) (-2460.761) [-2460.789] -- 0:03:44
      18000 -- [-2460.964] (-2468.763) (-2466.776) (-2463.401) * (-2466.921) [-2462.898] (-2462.481) (-2464.479) -- 0:03:38
      18500 -- (-2464.108) (-2463.105) [-2464.045] (-2462.934) * (-2462.880) (-2462.167) [-2464.021] (-2464.944) -- 0:03:32
      19000 -- [-2463.625] (-2471.597) (-2463.170) (-2463.304) * (-2461.256) [-2461.189] (-2469.842) (-2460.471) -- 0:04:18
      19500 -- (-2457.746) (-2466.770) (-2464.981) [-2462.607] * [-2458.170] (-2460.449) (-2464.985) (-2459.926) -- 0:04:11
      20000 -- [-2460.893] (-2467.352) (-2470.277) (-2459.011) * (-2460.896) (-2463.443) (-2466.641) [-2461.112] -- 0:04:05

      Average standard deviation of split frequencies: 0.011405

      20500 -- (-2468.963) (-2464.380) [-2464.503] (-2461.837) * (-2460.675) [-2469.578] (-2465.345) (-2470.766) -- 0:03:58
      21000 -- [-2461.616] (-2464.634) (-2464.567) (-2457.493) * (-2463.002) (-2461.742) (-2470.179) [-2463.580] -- 0:03:53
      21500 -- (-2464.310) (-2462.611) (-2485.629) [-2459.660] * (-2464.850) (-2468.596) (-2463.928) [-2464.412] -- 0:03:47
      22000 -- (-2467.393) [-2459.599] (-2463.936) (-2455.393) * (-2462.104) (-2466.261) (-2468.904) [-2467.187] -- 0:03:42
      22500 -- (-2462.771) (-2459.220) [-2458.768] (-2461.810) * [-2460.288] (-2467.287) (-2462.087) (-2459.820) -- 0:03:37
      23000 -- (-2463.669) [-2466.860] (-2467.722) (-2461.958) * [-2468.786] (-2458.904) (-2467.247) (-2463.006) -- 0:03:32
      23500 -- (-2463.821) (-2461.476) (-2467.963) [-2457.820] * (-2463.279) (-2463.689) (-2458.398) [-2464.431] -- 0:03:27
      24000 -- (-2466.848) (-2469.659) [-2462.834] (-2467.859) * (-2463.211) [-2459.319] (-2459.744) (-2460.595) -- 0:04:04
      24500 -- (-2463.685) (-2468.388) (-2461.747) [-2465.050] * (-2461.404) (-2460.671) [-2465.878] (-2458.963) -- 0:03:58
      25000 -- [-2463.084] (-2464.337) (-2467.821) (-2461.666) * (-2468.145) (-2465.649) (-2459.683) [-2457.225] -- 0:03:54

      Average standard deviation of split frequencies: 0.009065

      25500 -- (-2459.647) (-2461.104) [-2461.410] (-2461.045) * [-2465.372] (-2460.655) (-2459.617) (-2466.129) -- 0:03:49
      26000 -- (-2460.862) (-2459.335) [-2464.493] (-2459.706) * [-2473.276] (-2467.206) (-2458.425) (-2466.048) -- 0:03:44
      26500 -- (-2461.072) (-2459.288) (-2458.832) [-2460.815] * (-2468.110) (-2460.018) (-2469.033) [-2455.989] -- 0:03:40
      27000 -- [-2464.139] (-2458.941) (-2464.191) (-2467.748) * (-2467.570) (-2462.461) (-2464.689) [-2470.438] -- 0:03:36
      27500 -- (-2466.469) (-2461.848) [-2461.817] (-2461.289) * [-2461.739] (-2459.194) (-2472.462) (-2474.667) -- 0:03:32
      28000 -- (-2457.746) (-2460.695) (-2463.405) [-2464.245] * (-2466.234) [-2458.698] (-2465.510) (-2466.996) -- 0:03:28
      28500 -- (-2462.121) (-2460.920) (-2456.401) [-2461.463] * [-2464.154] (-2464.133) (-2461.179) (-2464.204) -- 0:03:58
      29000 -- (-2465.472) (-2465.557) [-2458.551] (-2465.563) * (-2458.308) (-2465.069) (-2468.456) [-2463.595] -- 0:03:54
      29500 -- (-2465.537) (-2465.459) [-2457.632] (-2461.814) * (-2462.289) [-2459.877] (-2464.448) (-2468.912) -- 0:03:50
      30000 -- (-2464.020) [-2465.591] (-2462.196) (-2463.677) * (-2464.376) (-2460.405) [-2465.967] (-2466.773) -- 0:03:46

      Average standard deviation of split frequencies: 0.000000

      30500 -- [-2458.624] (-2465.615) (-2466.960) (-2466.027) * (-2470.298) [-2466.780] (-2469.525) (-2465.673) -- 0:03:42
      31000 -- (-2460.106) (-2464.220) [-2467.411] (-2465.722) * (-2466.830) (-2464.726) [-2476.326] (-2461.677) -- 0:03:38
      31500 -- (-2465.802) (-2466.703) [-2462.994] (-2465.414) * (-2464.734) (-2466.663) (-2467.282) [-2462.711] -- 0:03:35
      32000 -- (-2465.687) [-2462.706] (-2470.379) (-2459.298) * (-2462.128) (-2456.818) (-2465.417) [-2467.392] -- 0:03:31
      32500 -- [-2461.919] (-2464.503) (-2470.153) (-2461.040) * (-2462.866) (-2461.068) (-2463.019) [-2464.286] -- 0:03:58
      33000 -- (-2467.049) [-2463.949] (-2467.503) (-2467.101) * (-2462.122) [-2461.728] (-2466.434) (-2469.171) -- 0:03:54
      33500 -- (-2462.909) (-2461.582) (-2465.514) [-2462.670] * (-2461.849) (-2460.356) (-2460.534) [-2461.270] -- 0:03:50
      34000 -- (-2463.554) [-2459.287] (-2462.599) (-2458.204) * (-2467.747) [-2461.307] (-2462.205) (-2468.069) -- 0:03:47
      34500 -- (-2460.901) [-2462.076] (-2463.282) (-2461.464) * (-2463.951) (-2464.539) (-2460.084) [-2460.731] -- 0:03:43
      35000 -- (-2463.370) (-2462.165) [-2465.125] (-2457.643) * [-2461.183] (-2463.330) (-2461.477) (-2461.194) -- 0:03:40

      Average standard deviation of split frequencies: 0.006547

      35500 -- (-2462.208) (-2463.818) (-2466.789) [-2464.924] * [-2466.120] (-2468.956) (-2462.199) (-2458.919) -- 0:03:37
      36000 -- [-2459.777] (-2464.852) (-2457.465) (-2468.179) * (-2472.366) (-2464.395) [-2464.684] (-2465.900) -- 0:03:34
      36500 -- (-2458.157) (-2465.192) [-2465.166] (-2464.816) * (-2463.272) [-2461.912] (-2460.384) (-2459.157) -- 0:03:57
      37000 -- (-2463.192) (-2463.441) (-2461.288) [-2462.362] * [-2464.220] (-2457.851) (-2467.058) (-2462.615) -- 0:03:54
      37500 -- (-2465.880) (-2466.330) (-2461.482) [-2458.451] * (-2460.215) [-2460.184] (-2462.157) (-2464.754) -- 0:03:51
      38000 -- (-2463.193) (-2463.783) (-2460.402) [-2459.576] * (-2462.426) [-2458.280] (-2461.746) (-2468.053) -- 0:03:47
      38500 -- [-2462.393] (-2466.083) (-2463.446) (-2460.745) * [-2466.445] (-2459.705) (-2462.465) (-2468.341) -- 0:03:44
      39000 -- [-2463.811] (-2460.232) (-2462.990) (-2463.561) * (-2463.457) (-2469.529) [-2462.637] (-2465.383) -- 0:03:41
      39500 -- (-2479.212) (-2470.071) [-2463.553] (-2467.901) * (-2460.117) [-2464.426] (-2465.855) (-2464.213) -- 0:03:38
      40000 -- [-2465.524] (-2461.459) (-2468.021) (-2461.442) * (-2459.148) (-2466.755) (-2464.129) [-2463.197] -- 0:03:36

      Average standard deviation of split frequencies: 0.005796

      40500 -- (-2463.685) (-2461.890) [-2461.817] (-2473.744) * (-2460.091) (-2465.424) (-2461.084) [-2461.022] -- 0:03:33
      41000 -- (-2462.229) [-2459.973] (-2460.871) (-2465.151) * (-2461.554) (-2463.158) (-2469.002) [-2465.423] -- 0:03:53
      41500 -- (-2461.043) [-2464.957] (-2466.674) (-2466.132) * (-2461.156) (-2463.682) (-2461.761) [-2465.295] -- 0:03:50
      42000 -- (-2463.870) (-2460.279) (-2468.403) [-2472.512] * (-2468.101) [-2458.364] (-2461.868) (-2463.230) -- 0:03:48
      42500 -- [-2471.375] (-2460.230) (-2464.924) (-2478.156) * (-2465.701) (-2461.849) [-2459.247] (-2463.638) -- 0:03:45
      43000 -- [-2468.236] (-2464.095) (-2464.649) (-2465.735) * (-2467.576) (-2466.295) (-2462.117) [-2461.498] -- 0:03:42
      43500 -- (-2469.295) [-2470.468] (-2462.234) (-2463.425) * (-2469.126) (-2472.207) [-2461.642] (-2464.956) -- 0:03:39
      44000 -- [-2462.812] (-2464.322) (-2470.567) (-2474.807) * (-2464.745) (-2460.828) (-2459.609) [-2461.284] -- 0:03:37
      44500 -- (-2466.209) (-2468.265) [-2459.726] (-2470.949) * (-2464.040) (-2461.271) [-2469.219] (-2463.679) -- 0:03:34
      45000 -- (-2461.730) (-2465.056) [-2463.877] (-2463.134) * (-2458.789) (-2464.347) (-2464.966) [-2462.000] -- 0:03:53

      Average standard deviation of split frequencies: 0.005124

      45500 -- (-2474.869) [-2463.574] (-2462.327) (-2467.123) * [-2465.698] (-2462.505) (-2470.658) (-2476.242) -- 0:03:50
      46000 -- (-2463.559) (-2457.872) [-2460.139] (-2467.431) * [-2467.021] (-2459.363) (-2477.810) (-2463.232) -- 0:03:48
      46500 -- (-2470.779) (-2464.361) (-2464.032) [-2460.700] * (-2467.973) (-2465.944) (-2470.621) [-2461.110] -- 0:03:45
      47000 -- (-2468.112) [-2473.721] (-2460.871) (-2470.277) * [-2466.995] (-2475.719) (-2468.502) (-2464.954) -- 0:03:43
      47500 -- [-2466.144] (-2463.491) (-2465.612) (-2462.539) * (-2465.002) (-2476.881) [-2464.749] (-2462.566) -- 0:03:40
      48000 -- [-2466.919] (-2461.260) (-2466.366) (-2472.992) * (-2464.987) (-2468.819) [-2462.478] (-2464.538) -- 0:03:38
      48500 -- (-2467.376) (-2463.759) [-2464.785] (-2465.170) * (-2457.289) (-2462.907) [-2462.254] (-2459.647) -- 0:03:35
      49000 -- (-2465.521) (-2468.954) [-2460.499] (-2468.487) * (-2462.052) [-2460.477] (-2466.470) (-2465.788) -- 0:03:33
      49500 -- (-2463.284) (-2458.082) (-2463.981) [-2462.985] * (-2458.107) [-2466.546] (-2464.188) (-2464.004) -- 0:03:50
      50000 -- (-2462.892) [-2460.459] (-2456.809) (-2460.992) * (-2468.338) (-2463.203) [-2458.058] (-2467.244) -- 0:03:48

      Average standard deviation of split frequencies: 0.013956

      50500 -- [-2460.554] (-2468.507) (-2467.383) (-2463.762) * [-2458.763] (-2468.389) (-2461.647) (-2465.928) -- 0:03:45
      51000 -- (-2462.894) (-2471.848) [-2460.279] (-2460.064) * [-2459.324] (-2461.791) (-2461.859) (-2468.020) -- 0:03:43
      51500 -- (-2469.313) [-2461.015] (-2463.078) (-2462.843) * (-2462.797) [-2462.553] (-2457.058) (-2466.004) -- 0:03:41
      52000 -- (-2468.792) (-2466.826) [-2462.058] (-2460.387) * (-2467.051) (-2461.294) (-2461.526) [-2470.575] -- 0:03:38
      52500 -- (-2460.516) (-2466.590) [-2464.855] (-2459.573) * (-2468.094) [-2463.395] (-2460.604) (-2465.178) -- 0:03:36
      53000 -- (-2467.160) (-2479.463) [-2462.377] (-2462.729) * (-2473.276) [-2462.762] (-2460.431) (-2473.093) -- 0:03:34
      53500 -- [-2461.784] (-2472.799) (-2462.364) (-2467.242) * (-2473.057) [-2459.010] (-2465.452) (-2463.149) -- 0:03:32
      54000 -- (-2461.090) [-2465.383] (-2462.872) (-2460.291) * (-2462.983) [-2461.578] (-2458.469) (-2462.522) -- 0:03:47
      54500 -- (-2461.619) (-2462.206) (-2460.755) [-2463.606] * [-2469.040] (-2464.126) (-2459.354) (-2462.029) -- 0:03:45
      55000 -- (-2462.387) [-2464.359] (-2462.666) (-2463.374) * (-2461.197) [-2462.723] (-2464.795) (-2471.042) -- 0:03:43

      Average standard deviation of split frequencies: 0.016836

      55500 -- [-2461.793] (-2467.273) (-2467.728) (-2465.612) * [-2462.507] (-2467.094) (-2462.736) (-2458.813) -- 0:03:41
      56000 -- [-2461.636] (-2461.755) (-2458.750) (-2472.012) * (-2462.394) (-2461.233) [-2461.822] (-2462.852) -- 0:03:39
      56500 -- (-2465.739) [-2464.472] (-2462.701) (-2471.440) * (-2466.296) (-2458.158) (-2468.274) [-2460.434] -- 0:03:37
      57000 -- (-2465.443) (-2462.737) [-2461.190] (-2464.859) * (-2463.145) [-2467.622] (-2468.479) (-2465.996) -- 0:03:35
      57500 -- (-2474.495) (-2462.937) (-2460.349) [-2461.557] * (-2460.911) [-2461.553] (-2465.725) (-2467.610) -- 0:03:33
      58000 -- (-2469.071) (-2466.025) [-2463.236] (-2460.312) * (-2463.013) [-2460.769] (-2465.558) (-2465.050) -- 0:03:31
      58500 -- (-2470.233) [-2459.674] (-2463.366) (-2462.596) * (-2463.991) (-2460.459) (-2461.445) [-2466.906] -- 0:03:29
      59000 -- [-2473.726] (-2459.780) (-2466.731) (-2465.225) * [-2460.945] (-2466.850) (-2461.001) (-2468.324) -- 0:03:43
      59500 -- [-2468.801] (-2459.650) (-2466.003) (-2465.148) * (-2461.750) (-2461.969) [-2462.946] (-2465.735) -- 0:03:41
      60000 -- (-2466.360) [-2463.658] (-2464.108) (-2469.021) * (-2458.785) (-2459.904) [-2459.932] (-2461.235) -- 0:03:39

      Average standard deviation of split frequencies: 0.019426

      60500 -- (-2467.806) (-2464.926) [-2459.445] (-2465.744) * (-2461.718) (-2463.192) (-2466.502) [-2461.061] -- 0:03:37
      61000 -- [-2459.472] (-2468.595) (-2466.607) (-2464.596) * [-2463.293] (-2462.123) (-2465.427) (-2467.079) -- 0:03:35
      61500 -- [-2461.007] (-2462.216) (-2459.433) (-2465.569) * (-2460.849) [-2460.506] (-2467.561) (-2466.210) -- 0:03:33
      62000 -- (-2461.160) (-2462.158) (-2464.132) [-2468.805] * [-2458.288] (-2462.148) (-2467.594) (-2465.593) -- 0:03:31
      62500 -- (-2456.430) [-2460.214] (-2459.452) (-2469.289) * [-2459.858] (-2464.211) (-2465.594) (-2463.350) -- 0:03:30
      63000 -- (-2462.619) (-2466.960) [-2459.913] (-2470.685) * (-2466.558) [-2462.270] (-2460.720) (-2462.638) -- 0:03:28
      63500 -- (-2465.301) [-2463.160] (-2461.074) (-2458.384) * [-2465.994] (-2463.724) (-2464.753) (-2458.623) -- 0:03:41
      64000 -- [-2458.411] (-2465.445) (-2465.514) (-2460.385) * (-2462.488) (-2467.819) (-2464.665) [-2461.717] -- 0:03:39
      64500 -- [-2460.542] (-2460.339) (-2470.947) (-2469.154) * [-2461.341] (-2469.582) (-2461.963) (-2464.443) -- 0:03:37
      65000 -- (-2457.623) [-2463.601] (-2472.454) (-2459.792) * (-2459.458) (-2474.213) (-2462.033) [-2461.018] -- 0:03:35

      Average standard deviation of split frequencies: 0.017856

      65500 -- (-2468.431) (-2463.543) (-2472.317) [-2460.498] * (-2462.613) [-2462.395] (-2464.104) (-2468.146) -- 0:03:34
      66000 -- [-2460.032] (-2466.269) (-2472.379) (-2465.978) * (-2465.776) (-2462.321) [-2465.804] (-2466.677) -- 0:03:32
      66500 -- (-2469.015) (-2459.621) [-2466.204] (-2462.983) * (-2463.639) (-2466.354) (-2469.382) [-2460.153] -- 0:03:30
      67000 -- [-2466.405] (-2465.567) (-2467.430) (-2464.543) * [-2459.077] (-2462.489) (-2468.414) (-2460.067) -- 0:03:28
      67500 -- (-2463.345) [-2464.785] (-2465.674) (-2460.530) * (-2463.301) (-2461.663) (-2462.700) [-2463.830] -- 0:03:27
      68000 -- (-2464.477) (-2464.496) [-2460.632] (-2461.800) * (-2461.999) (-2468.523) [-2457.882] (-2461.758) -- 0:03:39
      68500 -- (-2464.693) (-2473.930) (-2463.521) [-2458.750] * (-2465.802) (-2462.582) (-2465.992) [-2460.591] -- 0:03:37
      69000 -- (-2461.552) (-2464.826) [-2460.612] (-2460.703) * (-2466.484) (-2465.378) (-2468.952) [-2458.960] -- 0:03:35
      69500 -- (-2460.951) (-2464.519) (-2466.620) [-2460.666] * (-2466.571) [-2460.309] (-2463.980) (-2460.563) -- 0:03:34
      70000 -- (-2473.682) [-2464.760] (-2462.334) (-2469.555) * (-2468.745) [-2467.278] (-2462.790) (-2458.108) -- 0:03:32

      Average standard deviation of split frequencies: 0.020012

      70500 -- [-2468.056] (-2470.230) (-2459.236) (-2459.065) * (-2463.354) (-2463.101) (-2463.156) [-2462.173] -- 0:03:30
      71000 -- [-2461.923] (-2464.900) (-2463.827) (-2460.230) * (-2464.624) (-2459.470) (-2464.456) [-2463.800] -- 0:03:29
      71500 -- [-2463.630] (-2462.251) (-2462.869) (-2460.365) * [-2468.055] (-2467.966) (-2458.899) (-2463.593) -- 0:03:27
      72000 -- (-2466.922) (-2464.846) [-2458.241] (-2460.370) * (-2465.135) (-2464.319) [-2467.088] (-2463.578) -- 0:03:26
      72500 -- [-2461.380] (-2460.342) (-2460.293) (-2462.183) * (-2462.970) [-2460.466] (-2464.819) (-2466.939) -- 0:03:37
      73000 -- (-2463.672) (-2461.726) [-2463.546] (-2466.605) * (-2458.804) (-2460.090) [-2456.786] (-2462.480) -- 0:03:35
      73500 -- (-2458.682) (-2462.800) [-2467.423] (-2464.039) * [-2462.665] (-2463.595) (-2459.392) (-2468.089) -- 0:03:34
      74000 -- (-2462.953) (-2462.420) (-2461.352) [-2462.533] * (-2461.159) (-2467.041) [-2458.079] (-2460.261) -- 0:03:32
      74500 -- (-2462.193) (-2464.587) [-2463.415] (-2463.017) * (-2466.079) (-2462.866) [-2459.022] (-2461.241) -- 0:03:31
      75000 -- [-2462.169] (-2470.322) (-2466.834) (-2466.000) * [-2463.898] (-2457.253) (-2464.270) (-2460.362) -- 0:03:29

      Average standard deviation of split frequencies: 0.015507

      75500 -- (-2465.372) (-2465.031) [-2461.189] (-2467.419) * (-2462.852) (-2465.870) [-2457.479] (-2465.477) -- 0:03:28
      76000 -- [-2459.416] (-2464.190) (-2460.603) (-2465.230) * (-2469.925) (-2466.229) [-2464.429] (-2464.157) -- 0:03:26
      76500 -- [-2462.058] (-2464.688) (-2460.776) (-2467.256) * (-2460.813) (-2462.738) [-2465.077] (-2460.138) -- 0:03:25
      77000 -- (-2466.332) (-2464.028) [-2472.541] (-2473.385) * (-2463.016) [-2462.089] (-2464.558) (-2464.689) -- 0:03:23
      77500 -- (-2467.976) (-2473.753) [-2462.907] (-2470.757) * (-2462.622) (-2457.864) (-2460.602) [-2462.958] -- 0:03:34
      78000 -- (-2470.942) [-2463.627] (-2460.979) (-2462.477) * (-2463.175) (-2461.664) (-2460.970) [-2464.032] -- 0:03:32
      78500 -- (-2461.130) [-2464.490] (-2459.690) (-2463.031) * (-2468.226) (-2468.957) (-2458.459) [-2463.830] -- 0:03:31
      79000 -- (-2467.672) [-2465.191] (-2460.377) (-2466.515) * (-2468.769) (-2471.206) [-2459.248] (-2465.689) -- 0:03:29
      79500 -- (-2462.071) [-2461.396] (-2463.642) (-2469.985) * [-2466.221] (-2470.309) (-2466.881) (-2462.495) -- 0:03:28
      80000 -- (-2459.607) (-2459.592) [-2462.034] (-2464.021) * (-2465.935) (-2468.012) (-2461.321) [-2460.877] -- 0:03:27

      Average standard deviation of split frequencies: 0.014610

      80500 -- [-2462.843] (-2457.938) (-2461.659) (-2463.913) * [-2464.874] (-2470.423) (-2465.194) (-2463.939) -- 0:03:25
      81000 -- (-2461.226) (-2462.206) (-2462.476) [-2469.490] * (-2461.099) (-2468.455) [-2459.414] (-2463.203) -- 0:03:24
      81500 -- (-2460.388) [-2464.023] (-2470.222) (-2467.032) * (-2461.675) (-2467.401) [-2457.611] (-2464.664) -- 0:03:22
      82000 -- [-2461.477] (-2465.202) (-2464.496) (-2467.146) * (-2467.194) (-2463.191) [-2459.554] (-2460.572) -- 0:03:32
      82500 -- (-2458.722) (-2471.247) (-2466.968) [-2462.423] * [-2458.757] (-2461.486) (-2462.662) (-2470.674) -- 0:03:31
      83000 -- (-2466.069) (-2466.680) (-2465.314) [-2463.584] * (-2462.131) [-2459.546] (-2461.620) (-2464.405) -- 0:03:29
      83500 -- [-2459.235] (-2460.670) (-2465.328) (-2470.938) * (-2461.647) [-2458.097] (-2459.388) (-2458.373) -- 0:03:28
      84000 -- (-2461.735) [-2462.212] (-2472.061) (-2464.016) * [-2459.978] (-2465.764) (-2458.050) (-2463.166) -- 0:03:27
      84500 -- (-2458.906) (-2463.686) (-2469.184) [-2465.251] * (-2462.225) (-2462.535) [-2461.169] (-2458.968) -- 0:03:25
      85000 -- [-2464.513] (-2466.061) (-2457.684) (-2459.173) * (-2466.056) [-2463.373] (-2462.548) (-2458.909) -- 0:03:24

      Average standard deviation of split frequencies: 0.013704

      85500 -- (-2464.116) (-2470.718) [-2460.238] (-2462.115) * (-2473.558) (-2466.364) [-2461.409] (-2465.322) -- 0:03:23
      86000 -- [-2470.483] (-2464.781) (-2461.684) (-2460.969) * (-2465.778) [-2462.114] (-2464.294) (-2460.472) -- 0:03:21
      86500 -- (-2470.688) (-2468.662) [-2461.550] (-2458.832) * (-2463.685) (-2461.498) (-2463.838) [-2468.820] -- 0:03:31
      87000 -- (-2463.073) (-2473.935) (-2462.917) [-2458.994] * [-2467.791] (-2461.066) (-2460.077) (-2462.484) -- 0:03:29
      87500 -- (-2461.109) (-2462.918) [-2466.265] (-2460.410) * (-2463.581) (-2462.048) [-2462.360] (-2464.993) -- 0:03:28
      88000 -- (-2468.773) (-2465.237) [-2465.699] (-2476.757) * (-2474.860) (-2465.121) (-2462.747) [-2463.380] -- 0:03:27
      88500 -- (-2464.533) (-2460.488) (-2464.140) [-2461.796] * [-2460.358] (-2465.006) (-2469.656) (-2459.467) -- 0:03:25
      89000 -- (-2460.203) (-2459.048) [-2466.581] (-2460.920) * [-2458.051] (-2467.564) (-2468.758) (-2467.308) -- 0:03:24
      89500 -- [-2463.305] (-2465.566) (-2462.485) (-2462.803) * (-2462.055) [-2459.977] (-2464.496) (-2467.090) -- 0:03:23
      90000 -- (-2463.024) [-2461.601] (-2466.662) (-2461.668) * [-2463.021] (-2462.565) (-2461.402) (-2465.384) -- 0:03:22

      Average standard deviation of split frequencies: 0.015598

      90500 -- [-2464.734] (-2460.388) (-2463.243) (-2462.228) * [-2461.763] (-2471.940) (-2458.881) (-2468.853) -- 0:03:20
      91000 -- (-2470.328) (-2465.005) [-2457.772] (-2460.368) * (-2467.418) (-2466.107) (-2461.862) [-2467.094] -- 0:03:19
      91500 -- (-2466.078) (-2467.463) [-2459.235] (-2464.766) * (-2469.196) (-2463.999) [-2460.884] (-2471.392) -- 0:03:28
      92000 -- [-2468.925] (-2466.380) (-2463.979) (-2460.113) * [-2463.258] (-2468.175) (-2461.481) (-2470.013) -- 0:03:27
      92500 -- (-2461.321) (-2467.749) [-2462.545] (-2469.754) * (-2469.704) (-2468.102) [-2462.152] (-2467.203) -- 0:03:26
      93000 -- (-2464.083) [-2462.427] (-2465.372) (-2464.074) * (-2469.286) (-2464.918) [-2461.348] (-2464.307) -- 0:03:24
      93500 -- (-2457.874) [-2459.384] (-2460.333) (-2464.256) * (-2466.115) (-2458.942) (-2460.574) [-2462.344] -- 0:03:23
      94000 -- (-2462.432) [-2463.984] (-2459.335) (-2459.591) * (-2467.004) (-2465.237) (-2459.870) [-2462.501] -- 0:03:22
      94500 -- (-2461.996) (-2460.351) [-2465.882] (-2463.715) * (-2460.868) [-2461.093] (-2472.150) (-2460.768) -- 0:03:21
      95000 -- (-2465.525) (-2466.479) (-2462.620) [-2466.459] * (-2464.319) (-2467.665) [-2460.415] (-2461.242) -- 0:03:20

      Average standard deviation of split frequencies: 0.014731

      95500 -- [-2460.878] (-2470.019) (-2462.595) (-2465.059) * (-2462.202) [-2461.863] (-2462.264) (-2466.475) -- 0:03:18
      96000 -- (-2459.070) [-2468.079] (-2461.661) (-2463.071) * [-2470.001] (-2465.852) (-2461.254) (-2461.344) -- 0:03:27
      96500 -- (-2466.089) (-2465.732) (-2464.788) [-2462.147] * (-2465.508) (-2461.433) (-2466.253) [-2459.783] -- 0:03:25
      97000 -- (-2462.801) (-2469.993) (-2467.512) [-2459.829] * (-2472.516) (-2464.872) (-2464.572) [-2463.749] -- 0:03:24
      97500 -- (-2464.912) (-2464.570) [-2460.664] (-2461.257) * (-2465.210) [-2460.793] (-2464.048) (-2462.958) -- 0:03:23
      98000 -- [-2462.998] (-2462.358) (-2459.085) (-2457.831) * [-2458.968] (-2459.811) (-2463.499) (-2472.345) -- 0:03:22
      98500 -- (-2473.092) (-2460.998) [-2462.569] (-2462.058) * (-2458.232) (-2465.887) (-2462.086) [-2460.437] -- 0:03:21
      99000 -- (-2462.753) (-2461.414) (-2460.935) [-2462.985] * (-2459.476) (-2465.550) (-2459.350) [-2464.648] -- 0:03:20
      99500 -- (-2470.835) (-2468.689) [-2459.711] (-2464.429) * (-2469.993) [-2461.452] (-2459.406) (-2472.354) -- 0:03:19
      100000 -- [-2462.910] (-2462.397) (-2461.429) (-2464.687) * (-2463.640) (-2463.749) (-2469.084) [-2458.694] -- 0:03:18

      Average standard deviation of split frequencies: 0.014048

      100500 -- (-2465.054) (-2461.641) (-2462.318) [-2460.094] * (-2461.153) [-2464.798] (-2466.972) (-2464.094) -- 0:03:16
      101000 -- (-2469.741) (-2458.843) [-2464.775] (-2465.146) * [-2459.925] (-2462.259) (-2465.053) (-2461.929) -- 0:03:24
      101500 -- (-2474.733) (-2460.464) (-2458.246) [-2463.248] * [-2459.017] (-2468.085) (-2465.887) (-2468.149) -- 0:03:23
      102000 -- (-2464.673) (-2464.154) [-2458.286] (-2469.523) * (-2464.806) [-2464.577] (-2463.452) (-2463.354) -- 0:03:22
      102500 -- (-2459.056) (-2461.425) (-2468.596) [-2462.896] * [-2461.086] (-2471.510) (-2465.015) (-2464.969) -- 0:03:21
      103000 -- (-2461.732) (-2461.635) [-2466.129] (-2470.314) * (-2469.497) [-2463.066] (-2463.457) (-2467.677) -- 0:03:20
      103500 -- [-2460.787] (-2465.318) (-2465.170) (-2468.346) * [-2465.479] (-2463.561) (-2468.209) (-2478.433) -- 0:03:19
      104000 -- (-2463.152) (-2461.682) [-2464.325] (-2462.596) * (-2463.581) (-2467.633) [-2463.819] (-2466.677) -- 0:03:18
      104500 -- (-2463.656) [-2470.936] (-2467.415) (-2465.369) * [-2460.573] (-2465.760) (-2461.564) (-2471.671) -- 0:03:17
      105000 -- (-2465.955) [-2460.696] (-2463.226) (-2462.011) * [-2457.577] (-2461.978) (-2461.569) (-2467.937) -- 0:03:16

      Average standard deviation of split frequencies: 0.013342

      105500 -- (-2463.159) (-2460.752) (-2467.673) [-2457.404] * (-2465.115) (-2460.622) [-2460.029] (-2462.253) -- 0:03:23
      106000 -- (-2462.171) (-2466.949) (-2465.215) [-2458.988] * (-2472.115) [-2458.513] (-2463.182) (-2459.813) -- 0:03:22
      106500 -- (-2474.050) (-2464.642) [-2461.219] (-2464.873) * (-2462.281) (-2457.547) [-2457.984] (-2457.370) -- 0:03:21
      107000 -- [-2466.582] (-2464.853) (-2463.591) (-2466.439) * [-2464.228] (-2458.166) (-2462.770) (-2463.097) -- 0:03:20
      107500 -- (-2467.045) (-2460.269) [-2458.069] (-2472.122) * (-2464.548) (-2463.389) (-2465.063) [-2465.396] -- 0:03:19
      108000 -- (-2477.922) [-2465.193] (-2465.128) (-2466.337) * (-2459.664) (-2459.634) (-2467.247) [-2466.639] -- 0:03:18
      108500 -- (-2464.872) (-2467.181) [-2467.059] (-2469.262) * (-2462.707) [-2465.503] (-2477.278) (-2460.044) -- 0:03:17
      109000 -- (-2461.127) (-2460.375) [-2464.384] (-2467.957) * (-2463.171) [-2462.102] (-2462.578) (-2458.531) -- 0:03:16
      109500 -- (-2457.576) (-2464.967) [-2461.086] (-2465.890) * [-2466.968] (-2462.135) (-2465.977) (-2467.488) -- 0:03:15
      110000 -- (-2460.337) (-2467.209) [-2462.290] (-2466.928) * [-2466.036] (-2458.066) (-2469.322) (-2460.989) -- 0:03:14

      Average standard deviation of split frequencies: 0.012779

      110500 -- (-2461.688) (-2470.142) [-2461.515] (-2462.268) * (-2462.816) (-2458.746) [-2461.703] (-2463.740) -- 0:03:21
      111000 -- (-2466.579) (-2461.223) (-2459.016) [-2468.659] * (-2459.911) (-2468.242) [-2467.958] (-2470.959) -- 0:03:20
      111500 -- (-2459.259) [-2462.254] (-2462.697) (-2460.661) * [-2460.372] (-2463.872) (-2467.222) (-2466.692) -- 0:03:19
      112000 -- (-2462.463) [-2462.862] (-2468.253) (-2462.857) * (-2463.737) [-2460.613] (-2461.128) (-2465.565) -- 0:03:18
      112500 -- (-2470.975) [-2459.766] (-2460.567) (-2461.012) * (-2468.787) (-2461.629) [-2462.303] (-2461.621) -- 0:03:17
      113000 -- (-2467.840) (-2461.245) [-2467.814] (-2459.533) * [-2461.914] (-2466.238) (-2461.973) (-2467.309) -- 0:03:16
      113500 -- [-2463.932] (-2461.495) (-2461.255) (-2463.907) * (-2464.602) (-2463.409) (-2465.753) [-2462.819] -- 0:03:15
      114000 -- [-2460.391] (-2467.353) (-2472.897) (-2462.262) * (-2461.505) (-2459.864) [-2459.743] (-2462.057) -- 0:03:14
      114500 -- (-2465.237) [-2462.246] (-2467.453) (-2459.071) * [-2461.070] (-2464.301) (-2463.740) (-2465.023) -- 0:03:13
      115000 -- [-2459.110] (-2461.669) (-2462.826) (-2458.907) * (-2461.162) [-2463.174] (-2464.691) (-2468.708) -- 0:03:20

      Average standard deviation of split frequencies: 0.012191

      115500 -- (-2465.256) (-2462.649) (-2462.039) [-2463.168] * (-2464.499) (-2464.243) (-2463.667) [-2469.670] -- 0:03:19
      116000 -- [-2461.336] (-2461.310) (-2463.481) (-2471.695) * (-2466.954) (-2462.124) [-2458.826] (-2464.408) -- 0:03:18
      116500 -- (-2461.888) (-2460.823) (-2466.290) [-2463.806] * (-2459.477) (-2464.380) [-2459.361] (-2463.156) -- 0:03:17
      117000 -- [-2459.811] (-2463.308) (-2471.113) (-2464.449) * [-2463.037] (-2467.291) (-2459.386) (-2465.199) -- 0:03:16
      117500 -- [-2458.271] (-2468.310) (-2461.381) (-2460.362) * (-2463.821) (-2460.929) [-2465.587] (-2463.262) -- 0:03:15
      118000 -- (-2463.060) (-2464.914) [-2456.301] (-2465.429) * (-2461.410) (-2463.458) [-2465.330] (-2458.036) -- 0:03:14
      118500 -- (-2459.801) (-2468.434) [-2461.988] (-2459.432) * (-2466.224) (-2465.404) (-2467.752) [-2463.222] -- 0:03:13
      119000 -- (-2462.296) (-2470.020) [-2463.524] (-2473.340) * [-2464.282] (-2469.958) (-2467.100) (-2465.801) -- 0:03:12
      119500 -- (-2465.613) (-2469.888) [-2460.678] (-2463.322) * (-2458.297) (-2459.962) [-2461.688] (-2469.783) -- 0:03:11
      120000 -- (-2464.838) [-2462.776] (-2462.164) (-2463.463) * (-2464.838) (-2468.162) [-2460.556] (-2465.849) -- 0:03:18

      Average standard deviation of split frequencies: 0.011720

      120500 -- [-2467.300] (-2464.292) (-2461.296) (-2468.122) * (-2461.358) [-2464.866] (-2462.049) (-2460.364) -- 0:03:17
      121000 -- (-2470.449) [-2463.317] (-2462.495) (-2458.131) * (-2464.749) (-2464.073) [-2460.177] (-2465.688) -- 0:03:16
      121500 -- (-2460.713) [-2460.913] (-2473.125) (-2460.057) * (-2462.380) [-2461.530] (-2464.782) (-2465.702) -- 0:03:15
      122000 -- (-2471.504) (-2459.958) [-2460.508] (-2465.233) * (-2460.334) (-2464.980) (-2462.938) [-2465.472] -- 0:03:14
      122500 -- (-2461.351) (-2460.231) [-2459.463] (-2463.135) * (-2466.767) [-2460.825] (-2457.629) (-2468.129) -- 0:03:13
      123000 -- (-2463.289) [-2458.184] (-2465.700) (-2470.343) * (-2469.010) [-2461.468] (-2459.670) (-2464.963) -- 0:03:12
      123500 -- (-2464.757) (-2457.016) (-2464.260) [-2468.243] * (-2461.364) (-2464.229) [-2458.410] (-2468.912) -- 0:03:11
      124000 -- [-2465.978] (-2462.788) (-2462.195) (-2463.658) * (-2458.731) (-2459.613) (-2466.194) [-2466.754] -- 0:03:10
      124500 -- (-2459.121) (-2464.521) (-2465.039) [-2458.893] * (-2466.304) [-2462.343] (-2463.936) (-2466.163) -- 0:03:16
      125000 -- (-2469.789) (-2464.011) [-2465.345] (-2461.054) * (-2461.985) (-2472.688) [-2463.068] (-2468.499) -- 0:03:16

      Average standard deviation of split frequencies: 0.013095

      125500 -- [-2465.838] (-2470.753) (-2460.421) (-2459.948) * (-2468.422) [-2461.876] (-2465.613) (-2462.488) -- 0:03:15
      126000 -- (-2465.280) (-2459.745) [-2465.865] (-2467.331) * [-2462.703] (-2465.114) (-2463.790) (-2476.478) -- 0:03:14
      126500 -- [-2461.748] (-2464.640) (-2462.475) (-2461.403) * [-2460.008] (-2466.431) (-2468.208) (-2472.746) -- 0:03:13
      127000 -- [-2463.533] (-2460.547) (-2467.770) (-2460.148) * (-2461.754) [-2463.576] (-2465.782) (-2463.726) -- 0:03:12
      127500 -- (-2465.871) (-2463.238) [-2459.716] (-2459.496) * (-2462.995) (-2469.517) (-2470.454) [-2463.606] -- 0:03:11
      128000 -- (-2467.961) (-2463.693) [-2466.967] (-2458.997) * (-2470.524) (-2462.954) (-2466.648) [-2461.739] -- 0:03:10
      128500 -- (-2460.278) (-2462.578) (-2470.368) [-2463.622] * (-2465.745) (-2467.536) (-2467.517) [-2465.689] -- 0:03:09
      129000 -- [-2459.487] (-2465.883) (-2475.643) (-2458.032) * (-2464.139) [-2465.497] (-2470.141) (-2465.004) -- 0:03:09
      129500 -- [-2469.214] (-2462.256) (-2465.609) (-2463.312) * (-2466.440) [-2461.074] (-2469.813) (-2459.074) -- 0:03:14
      130000 -- (-2465.922) (-2468.175) [-2462.294] (-2459.885) * [-2457.399] (-2468.229) (-2475.034) (-2466.399) -- 0:03:14

      Average standard deviation of split frequencies: 0.010823

      130500 -- (-2472.460) (-2468.474) [-2467.676] (-2461.966) * (-2462.342) (-2464.434) (-2467.666) [-2460.082] -- 0:03:13
      131000 -- (-2465.394) (-2465.118) [-2460.140] (-2461.806) * (-2474.932) (-2461.268) (-2464.558) [-2462.404] -- 0:03:12
      131500 -- (-2460.385) [-2459.749] (-2463.879) (-2461.126) * (-2459.883) (-2465.739) (-2467.963) [-2461.103] -- 0:03:11
      132000 -- [-2459.359] (-2461.227) (-2463.161) (-2461.706) * [-2455.954] (-2464.990) (-2462.058) (-2461.773) -- 0:03:10
      132500 -- (-2464.706) (-2458.412) [-2460.708] (-2459.883) * (-2461.738) (-2464.211) [-2462.554] (-2472.484) -- 0:03:09
      133000 -- (-2463.088) [-2462.803] (-2465.145) (-2462.896) * [-2464.262] (-2464.244) (-2460.062) (-2468.281) -- 0:03:09
      133500 -- (-2463.245) [-2463.131] (-2465.752) (-2464.819) * (-2466.478) (-2465.150) (-2463.574) [-2465.424] -- 0:03:08
      134000 -- (-2471.678) (-2467.251) [-2466.469] (-2462.132) * (-2464.116) (-2470.636) [-2463.120] (-2480.243) -- 0:03:13
      134500 -- (-2460.491) (-2470.726) (-2467.105) [-2461.803] * (-2464.469) (-2463.285) [-2462.600] (-2472.342) -- 0:03:13
      135000 -- (-2465.344) (-2465.034) [-2461.036] (-2464.169) * (-2463.871) (-2462.057) [-2466.693] (-2469.077) -- 0:03:12

      Average standard deviation of split frequencies: 0.008666

      135500 -- [-2466.902] (-2469.467) (-2461.961) (-2468.479) * (-2465.356) (-2463.993) (-2463.192) [-2463.239] -- 0:03:11
      136000 -- (-2460.452) (-2463.503) [-2463.692] (-2468.357) * [-2464.070] (-2464.649) (-2459.256) (-2461.724) -- 0:03:10
      136500 -- (-2464.244) (-2460.077) [-2464.825] (-2467.592) * (-2464.583) [-2466.184] (-2461.463) (-2466.026) -- 0:03:09
      137000 -- (-2464.627) (-2466.535) [-2462.156] (-2470.843) * (-2462.258) [-2466.341] (-2461.442) (-2460.453) -- 0:03:08
      137500 -- (-2461.681) (-2464.656) (-2458.923) [-2462.045] * (-2465.022) (-2466.670) [-2457.745] (-2467.890) -- 0:03:08
      138000 -- (-2469.550) [-2463.241] (-2463.612) (-2461.919) * (-2462.834) (-2465.551) [-2464.020] (-2461.017) -- 0:03:07
      138500 -- (-2465.244) [-2463.813] (-2467.306) (-2459.625) * (-2464.854) (-2466.283) (-2463.248) [-2465.016] -- 0:03:12
      139000 -- (-2464.223) (-2461.027) (-2465.874) [-2458.371] * (-2462.535) (-2464.256) (-2470.973) [-2462.273] -- 0:03:12
      139500 -- (-2463.299) (-2464.629) [-2460.516] (-2462.763) * (-2463.976) [-2460.579] (-2464.721) (-2463.010) -- 0:03:11
      140000 -- (-2464.933) (-2462.326) (-2466.556) [-2463.879] * (-2461.732) [-2458.948] (-2471.726) (-2465.041) -- 0:03:10

      Average standard deviation of split frequencies: 0.008378

      140500 -- [-2466.607] (-2462.980) (-2467.359) (-2462.554) * [-2459.074] (-2466.535) (-2467.466) (-2463.278) -- 0:03:09
      141000 -- (-2466.532) (-2462.870) [-2464.951] (-2465.071) * [-2462.913] (-2467.304) (-2465.261) (-2461.624) -- 0:03:08
      141500 -- (-2461.721) [-2461.688] (-2459.561) (-2462.223) * (-2468.074) [-2460.608] (-2468.603) (-2458.318) -- 0:03:08
      142000 -- [-2462.331] (-2464.411) (-2463.747) (-2469.825) * (-2462.754) (-2467.029) (-2468.309) [-2462.540] -- 0:03:07
      142500 -- [-2459.972] (-2462.100) (-2469.896) (-2461.835) * (-2461.630) (-2466.422) (-2468.982) [-2459.153] -- 0:03:06
      143000 -- (-2460.424) (-2464.132) [-2471.473] (-2465.144) * (-2457.794) [-2464.680] (-2468.679) (-2460.832) -- 0:03:05
      143500 -- (-2462.685) [-2472.602] (-2465.693) (-2465.616) * (-2465.041) (-2465.259) (-2465.761) [-2461.451] -- 0:03:10
      144000 -- [-2462.653] (-2468.694) (-2458.906) (-2461.420) * [-2466.039] (-2462.079) (-2460.184) (-2459.064) -- 0:03:10
      144500 -- (-2466.640) (-2466.099) [-2459.939] (-2463.606) * (-2468.492) (-2465.571) (-2465.084) [-2466.136] -- 0:03:09
      145000 -- (-2466.193) [-2457.605] (-2463.957) (-2460.449) * (-2461.396) (-2462.927) [-2465.447] (-2465.044) -- 0:03:08

      Average standard deviation of split frequencies: 0.009686

      145500 -- (-2469.993) (-2466.080) [-2458.536] (-2462.924) * (-2460.412) [-2466.305] (-2466.419) (-2464.004) -- 0:03:07
      146000 -- (-2469.114) [-2463.617] (-2460.932) (-2460.577) * [-2461.479] (-2467.480) (-2468.136) (-2463.689) -- 0:03:07
      146500 -- (-2468.214) (-2466.946) [-2463.222] (-2466.175) * (-2462.722) (-2464.364) [-2464.026] (-2465.907) -- 0:03:06
      147000 -- (-2459.426) [-2465.587] (-2459.907) (-2463.428) * (-2465.313) (-2464.745) [-2461.339] (-2463.612) -- 0:03:05
      147500 -- [-2462.791] (-2466.006) (-2468.969) (-2460.050) * (-2467.682) (-2459.961) [-2459.008] (-2476.159) -- 0:03:04
      148000 -- (-2461.286) [-2456.569] (-2464.235) (-2466.252) * (-2466.942) (-2465.956) (-2464.160) [-2459.803] -- 0:03:09
      148500 -- (-2463.910) [-2460.283] (-2461.155) (-2463.019) * (-2463.253) (-2472.069) (-2465.473) [-2459.798] -- 0:03:09
      149000 -- [-2463.338] (-2460.581) (-2458.856) (-2460.705) * (-2464.044) [-2467.252] (-2463.317) (-2463.183) -- 0:03:08
      149500 -- (-2463.324) (-2459.839) [-2467.341] (-2462.173) * [-2463.898] (-2467.471) (-2468.591) (-2461.577) -- 0:03:07
      150000 -- (-2460.316) [-2463.487] (-2461.144) (-2460.093) * (-2467.579) (-2476.878) (-2461.217) [-2462.969] -- 0:03:07

      Average standard deviation of split frequencies: 0.010951

      150500 -- [-2467.329] (-2466.041) (-2465.968) (-2466.806) * (-2464.974) (-2472.827) [-2460.845] (-2462.926) -- 0:03:06
      151000 -- [-2462.637] (-2466.519) (-2462.601) (-2463.565) * (-2470.019) (-2466.349) (-2462.760) [-2469.149] -- 0:03:05
      151500 -- (-2464.742) (-2465.136) (-2465.458) [-2462.965] * (-2468.368) (-2468.713) [-2467.118] (-2469.504) -- 0:03:04
      152000 -- (-2466.409) (-2462.336) [-2464.695] (-2459.496) * (-2467.344) (-2462.563) [-2458.991] (-2468.220) -- 0:03:04
      152500 -- (-2467.455) [-2461.550] (-2466.416) (-2466.229) * (-2462.947) [-2462.764] (-2468.526) (-2468.658) -- 0:03:03
      153000 -- (-2469.940) [-2460.563] (-2464.922) (-2462.068) * (-2465.340) (-2463.574) [-2463.572] (-2463.725) -- 0:03:08
      153500 -- (-2471.022) [-2461.301] (-2472.494) (-2465.096) * [-2464.472] (-2462.024) (-2470.252) (-2462.671) -- 0:03:07
      154000 -- (-2464.828) (-2463.479) (-2469.815) [-2464.005] * [-2460.765] (-2460.698) (-2468.154) (-2467.005) -- 0:03:06
      154500 -- (-2468.368) [-2466.331] (-2462.965) (-2465.597) * (-2459.521) (-2459.888) [-2460.547] (-2461.960) -- 0:03:06
      155000 -- (-2461.067) (-2463.945) [-2463.504] (-2462.156) * (-2467.381) [-2463.167] (-2463.911) (-2461.792) -- 0:03:05

      Average standard deviation of split frequencies: 0.010576

      155500 -- (-2461.591) (-2463.579) [-2463.023] (-2462.018) * (-2464.073) (-2464.921) (-2464.696) [-2463.003] -- 0:03:04
      156000 -- (-2467.814) (-2467.538) [-2459.895] (-2458.781) * (-2468.252) (-2463.256) [-2467.501] (-2468.782) -- 0:03:03
      156500 -- (-2464.739) (-2464.612) [-2460.992] (-2459.526) * [-2470.402] (-2463.060) (-2463.987) (-2463.675) -- 0:03:03
      157000 -- [-2466.048] (-2468.148) (-2464.995) (-2470.869) * (-2463.225) (-2465.260) [-2464.591] (-2462.794) -- 0:03:02
      157500 -- (-2461.230) (-2469.140) (-2463.793) [-2458.050] * [-2466.367] (-2461.751) (-2465.205) (-2475.216) -- 0:03:07
      158000 -- (-2462.224) (-2464.542) [-2460.572] (-2461.927) * (-2472.724) (-2469.554) [-2468.728] (-2471.611) -- 0:03:06
      158500 -- [-2466.793] (-2463.962) (-2472.551) (-2464.977) * [-2461.941] (-2456.718) (-2471.527) (-2469.438) -- 0:03:05
      159000 -- (-2464.949) (-2462.219) [-2462.061] (-2463.498) * [-2463.225] (-2464.489) (-2472.406) (-2461.487) -- 0:03:05
      159500 -- (-2462.339) (-2466.724) [-2463.053] (-2464.490) * (-2471.486) (-2466.012) (-2466.007) [-2457.719] -- 0:03:04
      160000 -- (-2467.994) (-2459.664) [-2455.516] (-2469.413) * (-2463.539) [-2463.191] (-2466.233) (-2462.358) -- 0:03:03

      Average standard deviation of split frequencies: 0.010269

      160500 -- [-2461.005] (-2464.442) (-2462.901) (-2460.379) * (-2468.431) (-2469.005) (-2469.751) [-2457.051] -- 0:03:03
      161000 -- (-2465.906) (-2470.352) (-2466.180) [-2460.850] * (-2466.266) (-2465.693) (-2471.914) [-2470.061] -- 0:03:02
      161500 -- (-2465.005) (-2464.382) (-2463.336) [-2457.603] * (-2464.447) [-2460.069] (-2471.057) (-2462.822) -- 0:03:01
      162000 -- [-2464.800] (-2464.955) (-2464.164) (-2464.362) * (-2468.319) [-2465.080] (-2466.260) (-2464.410) -- 0:03:06
      162500 -- (-2461.951) [-2467.374] (-2462.821) (-2463.168) * [-2465.775] (-2469.579) (-2467.635) (-2467.165) -- 0:03:05
      163000 -- (-2463.445) [-2461.422] (-2467.603) (-2463.043) * (-2471.546) (-2461.890) [-2464.423] (-2463.449) -- 0:03:04
      163500 -- [-2462.507] (-2464.022) (-2465.662) (-2464.163) * (-2462.512) (-2471.159) [-2463.943] (-2465.766) -- 0:03:04
      164000 -- (-2468.532) [-2458.794] (-2462.754) (-2471.876) * (-2465.812) (-2468.798) (-2468.041) [-2463.876] -- 0:03:03
      164500 -- (-2461.963) [-2461.231] (-2463.090) (-2469.140) * (-2471.960) (-2463.225) [-2461.182] (-2461.917) -- 0:03:02
      165000 -- (-2461.127) [-2462.905] (-2467.339) (-2460.441) * (-2464.339) [-2468.266] (-2461.348) (-2467.315) -- 0:03:02

      Average standard deviation of split frequencies: 0.009939

      165500 -- [-2459.607] (-2466.560) (-2466.154) (-2465.474) * [-2467.046] (-2472.505) (-2464.985) (-2462.897) -- 0:03:01
      166000 -- [-2457.474] (-2467.135) (-2459.304) (-2463.820) * (-2464.491) (-2469.800) (-2465.417) [-2467.197] -- 0:03:05
      166500 -- [-2461.715] (-2466.270) (-2460.391) (-2457.691) * (-2469.222) (-2466.775) (-2460.781) [-2470.155] -- 0:03:05
      167000 -- [-2463.883] (-2463.218) (-2462.024) (-2455.861) * (-2464.752) (-2465.279) [-2460.753] (-2467.674) -- 0:03:04
      167500 -- (-2462.479) (-2466.370) [-2463.932] (-2459.597) * (-2468.701) [-2459.528] (-2460.828) (-2464.108) -- 0:03:03
      168000 -- (-2469.583) [-2460.886] (-2463.611) (-2470.547) * (-2464.785) (-2470.530) [-2461.948] (-2460.775) -- 0:03:03
      168500 -- [-2461.568] (-2460.442) (-2467.361) (-2458.915) * (-2463.547) [-2465.636] (-2466.244) (-2458.920) -- 0:03:02
      169000 -- (-2469.110) (-2464.549) (-2460.618) [-2466.171] * (-2467.981) [-2460.658] (-2474.028) (-2468.148) -- 0:03:01
      169500 -- (-2467.551) (-2461.584) (-2465.682) [-2459.848] * [-2464.496] (-2462.272) (-2468.847) (-2464.940) -- 0:03:01
      170000 -- [-2466.083] (-2464.683) (-2469.669) (-2461.632) * (-2468.187) (-2463.680) [-2469.348] (-2464.571) -- 0:03:00

      Average standard deviation of split frequencies: 0.008286

      170500 -- (-2468.984) [-2464.242] (-2465.334) (-2463.857) * (-2463.597) (-2457.850) (-2470.857) [-2470.231] -- 0:03:04
      171000 -- (-2461.088) (-2467.557) [-2460.823] (-2468.605) * (-2462.244) (-2464.839) [-2465.176] (-2476.019) -- 0:03:04
      171500 -- (-2467.366) [-2461.473] (-2464.280) (-2461.434) * [-2467.289] (-2460.437) (-2468.833) (-2469.708) -- 0:03:03
      172000 -- (-2472.111) [-2458.826] (-2465.844) (-2476.094) * [-2463.442] (-2464.665) (-2462.613) (-2465.094) -- 0:03:02
      172500 -- (-2468.048) [-2458.810] (-2462.609) (-2465.088) * (-2463.853) (-2466.788) [-2461.475] (-2462.295) -- 0:03:02
      173000 -- (-2463.185) [-2460.589] (-2460.596) (-2461.285) * (-2466.143) (-2468.252) (-2461.971) [-2463.145] -- 0:03:01
      173500 -- (-2471.798) (-2459.730) [-2465.863] (-2461.335) * (-2461.422) (-2467.441) (-2467.708) [-2460.310] -- 0:03:01
      174000 -- (-2460.311) [-2460.336] (-2466.151) (-2466.630) * (-2462.774) (-2480.465) [-2463.153] (-2466.595) -- 0:03:00
      174500 -- [-2459.420] (-2461.124) (-2470.709) (-2464.592) * (-2463.969) [-2472.773] (-2462.601) (-2464.943) -- 0:02:59
      175000 -- [-2461.283] (-2467.962) (-2466.713) (-2467.581) * (-2464.104) (-2464.328) [-2462.261] (-2458.441) -- 0:03:03

      Average standard deviation of split frequencies: 0.008035

      175500 -- [-2462.796] (-2465.516) (-2462.375) (-2463.042) * (-2468.214) (-2462.073) [-2459.554] (-2459.211) -- 0:03:03
      176000 -- (-2462.147) [-2466.165] (-2468.065) (-2464.738) * (-2464.024) (-2464.774) (-2470.590) [-2459.570] -- 0:03:02
      176500 -- (-2457.619) (-2465.631) (-2464.833) [-2460.712] * (-2465.510) [-2463.891] (-2463.300) (-2460.758) -- 0:03:01
      177000 -- (-2462.108) (-2468.989) [-2466.899] (-2462.389) * [-2459.408] (-2461.923) (-2461.956) (-2460.186) -- 0:03:01
      177500 -- (-2462.604) (-2462.820) [-2460.930] (-2461.567) * (-2465.923) (-2463.617) [-2465.606] (-2469.651) -- 0:03:00
      178000 -- (-2463.835) (-2462.805) [-2461.671] (-2469.103) * (-2460.224) (-2460.950) (-2469.358) [-2460.081] -- 0:03:00
      178500 -- [-2464.514] (-2467.597) (-2462.863) (-2470.097) * (-2464.529) (-2464.731) [-2467.988] (-2462.025) -- 0:02:59
      179000 -- (-2459.418) [-2459.988] (-2460.506) (-2460.847) * (-2463.907) (-2465.956) [-2465.010] (-2462.834) -- 0:02:58
      179500 -- (-2460.714) (-2462.404) (-2469.671) [-2463.375] * [-2461.342] (-2463.171) (-2467.445) (-2460.597) -- 0:03:02
      180000 -- (-2472.028) [-2460.809] (-2465.713) (-2471.629) * (-2461.048) (-2462.762) (-2461.606) [-2461.612] -- 0:03:02

      Average standard deviation of split frequencies: 0.007828

      180500 -- (-2462.307) [-2467.959] (-2467.186) (-2464.728) * (-2459.771) (-2458.762) (-2460.647) [-2460.229] -- 0:03:01
      181000 -- (-2461.185) [-2462.937] (-2464.432) (-2468.773) * (-2460.484) (-2460.735) (-2463.004) [-2464.912] -- 0:03:00
      181500 -- (-2467.314) (-2458.952) [-2457.326] (-2465.905) * [-2461.359] (-2463.753) (-2459.387) (-2464.852) -- 0:03:00
      182000 -- (-2468.491) [-2463.954] (-2457.866) (-2469.769) * (-2459.705) [-2461.149] (-2464.969) (-2464.522) -- 0:02:59
      182500 -- (-2472.388) (-2465.853) [-2463.102] (-2467.859) * (-2463.708) (-2461.144) (-2464.852) [-2464.478] -- 0:02:59
      183000 -- (-2463.978) (-2475.314) [-2464.991] (-2468.951) * (-2465.841) [-2457.752] (-2461.292) (-2465.100) -- 0:02:58
      183500 -- (-2465.525) (-2461.767) (-2470.842) [-2469.680] * (-2461.923) [-2465.211] (-2465.605) (-2471.123) -- 0:02:57
      184000 -- [-2461.109] (-2463.203) (-2466.815) (-2458.529) * (-2460.419) (-2466.087) (-2462.042) [-2458.174] -- 0:03:01
      184500 -- [-2467.882] (-2466.681) (-2474.309) (-2467.483) * (-2459.010) (-2468.427) [-2466.558] (-2464.933) -- 0:03:01
      185000 -- [-2461.827] (-2458.790) (-2473.110) (-2463.213) * (-2467.841) (-2466.429) (-2467.937) [-2461.080] -- 0:03:00

      Average standard deviation of split frequencies: 0.007603

      185500 -- [-2460.489] (-2460.351) (-2473.522) (-2459.485) * (-2464.719) [-2466.567] (-2463.616) (-2467.420) -- 0:03:00
      186000 -- (-2461.869) (-2464.377) (-2469.198) [-2458.665] * (-2463.032) (-2460.039) [-2464.215] (-2464.414) -- 0:02:59
      186500 -- [-2463.801] (-2457.518) (-2472.780) (-2466.459) * (-2465.921) (-2461.808) [-2463.556] (-2463.810) -- 0:02:58
      187000 -- [-2463.552] (-2465.044) (-2463.950) (-2461.868) * (-2467.700) (-2468.566) [-2468.107] (-2463.631) -- 0:02:58
      187500 -- (-2467.836) [-2466.230] (-2461.363) (-2465.498) * (-2469.219) (-2457.807) (-2463.729) [-2464.833] -- 0:02:57
      188000 -- (-2469.638) (-2460.458) (-2462.482) [-2461.919] * (-2468.095) (-2466.730) (-2461.995) [-2463.159] -- 0:02:57
      188500 -- (-2466.400) (-2463.096) (-2464.345) [-2459.842] * (-2462.235) (-2459.580) (-2461.020) [-2464.119] -- 0:03:00
      189000 -- (-2462.517) (-2469.442) [-2462.277] (-2462.640) * (-2460.153) (-2467.498) (-2465.268) [-2465.832] -- 0:03:00
      189500 -- (-2465.666) [-2466.443] (-2464.279) (-2465.057) * (-2464.596) (-2457.785) (-2456.765) [-2461.059] -- 0:02:59
      190000 -- (-2464.193) (-2467.903) [-2464.908] (-2462.584) * [-2464.764] (-2465.483) (-2460.455) (-2461.199) -- 0:02:59

      Average standard deviation of split frequencies: 0.011126

      190500 -- (-2458.214) (-2460.731) [-2458.258] (-2459.857) * (-2466.278) (-2462.928) (-2460.499) [-2469.065] -- 0:02:58
      191000 -- (-2459.382) (-2462.782) (-2462.949) [-2460.844] * (-2465.220) (-2462.837) (-2462.531) [-2465.399] -- 0:02:57
      191500 -- (-2462.034) (-2458.455) (-2466.468) [-2462.489] * [-2464.270] (-2469.457) (-2473.274) (-2457.188) -- 0:02:57
      192000 -- [-2461.723] (-2464.312) (-2463.626) (-2463.012) * [-2462.313] (-2469.164) (-2466.581) (-2461.388) -- 0:02:56
      192500 -- (-2461.322) (-2462.853) (-2459.093) [-2457.671] * (-2457.045) [-2458.504] (-2461.719) (-2469.445) -- 0:02:56
      193000 -- (-2465.814) (-2461.811) (-2463.199) [-2460.278] * [-2459.413] (-2462.848) (-2461.961) (-2461.934) -- 0:02:59
      193500 -- [-2464.043] (-2464.134) (-2461.971) (-2467.070) * [-2461.056] (-2465.200) (-2463.843) (-2464.402) -- 0:02:59
      194000 -- (-2463.860) (-2463.298) [-2462.954] (-2458.388) * (-2461.752) (-2461.217) [-2461.455] (-2468.849) -- 0:02:58
      194500 -- (-2466.637) [-2463.285] (-2467.469) (-2456.794) * (-2460.214) (-2465.760) (-2462.041) [-2464.122] -- 0:02:58
      195000 -- (-2469.254) (-2460.678) (-2464.101) [-2461.056] * (-2469.890) (-2471.143) (-2462.564) [-2464.955] -- 0:02:57

      Average standard deviation of split frequencies: 0.010823

      195500 -- (-2459.370) (-2465.635) (-2457.973) [-2462.579] * (-2469.839) (-2471.830) [-2460.981] (-2459.168) -- 0:02:56
      196000 -- (-2458.424) [-2458.733] (-2465.278) (-2460.721) * (-2467.583) [-2469.155] (-2469.658) (-2464.069) -- 0:02:56
      196500 -- [-2463.957] (-2464.146) (-2459.914) (-2468.495) * (-2474.821) (-2466.093) (-2467.562) [-2464.414] -- 0:02:55
      197000 -- (-2463.419) (-2469.923) (-2462.477) [-2465.390] * (-2470.168) (-2466.312) [-2461.538] (-2460.388) -- 0:02:55
      197500 -- (-2469.763) (-2469.634) [-2467.778] (-2472.496) * (-2466.282) (-2463.424) [-2462.164] (-2461.493) -- 0:02:58
      198000 -- (-2461.172) [-2461.612] (-2464.533) (-2464.639) * (-2459.834) (-2465.958) (-2467.729) [-2460.877] -- 0:02:58
      198500 -- (-2464.789) [-2459.971] (-2464.871) (-2461.782) * [-2460.973] (-2467.084) (-2461.480) (-2464.222) -- 0:02:57
      199000 -- [-2458.643] (-2460.575) (-2465.285) (-2469.736) * [-2463.700] (-2470.403) (-2471.563) (-2459.297) -- 0:02:57
      199500 -- (-2462.828) (-2458.060) (-2462.544) [-2461.036] * (-2462.882) (-2466.931) [-2463.575] (-2460.865) -- 0:02:56
      200000 -- (-2466.126) [-2459.065] (-2464.586) (-2464.556) * [-2459.909] (-2472.733) (-2476.499) (-2460.259) -- 0:02:56

      Average standard deviation of split frequencies: 0.010571

      200500 -- (-2461.482) (-2458.608) (-2462.001) [-2464.874] * (-2459.896) (-2460.282) (-2464.135) [-2460.603] -- 0:02:55
      201000 -- (-2467.052) (-2462.254) [-2462.970] (-2466.636) * (-2461.682) (-2471.382) (-2464.295) [-2462.618] -- 0:02:54
      201500 -- (-2463.474) (-2469.326) [-2472.755] (-2465.427) * (-2461.563) (-2458.761) (-2466.482) [-2457.351] -- 0:02:54
      202000 -- (-2466.009) (-2465.087) (-2469.494) [-2462.698] * (-2464.380) (-2465.100) (-2461.961) [-2463.598] -- 0:02:57
      202500 -- (-2465.278) (-2465.162) [-2465.885] (-2460.390) * [-2460.538] (-2466.159) (-2468.441) (-2465.187) -- 0:02:57
      203000 -- (-2458.500) (-2464.272) (-2467.013) [-2463.405] * (-2465.750) (-2460.201) (-2462.989) [-2469.051] -- 0:02:56
      203500 -- (-2464.916) (-2465.486) [-2464.463] (-2466.800) * [-2467.255] (-2461.013) (-2473.033) (-2461.771) -- 0:02:56
      204000 -- (-2464.594) (-2465.635) (-2459.261) [-2462.239] * (-2458.889) (-2457.873) (-2464.992) [-2458.688] -- 0:02:55
      204500 -- (-2471.349) (-2466.975) (-2459.341) [-2464.345] * (-2460.558) (-2459.400) [-2463.378] (-2468.494) -- 0:02:55
      205000 -- (-2459.748) (-2468.259) (-2463.502) [-2463.896] * [-2460.614] (-2464.846) (-2469.509) (-2460.850) -- 0:02:54

      Average standard deviation of split frequencies: 0.010298

      205500 -- (-2463.868) (-2473.061) [-2464.704] (-2458.635) * (-2462.415) [-2458.216] (-2462.815) (-2462.224) -- 0:02:53
      206000 -- [-2460.951] (-2473.683) (-2464.855) (-2460.437) * (-2462.845) (-2464.697) [-2461.499] (-2465.636) -- 0:02:57
      206500 -- (-2465.486) (-2472.222) (-2465.223) [-2462.358] * (-2477.165) (-2464.885) (-2461.383) [-2461.343] -- 0:02:56
      207000 -- [-2464.036] (-2470.364) (-2463.588) (-2460.107) * (-2466.512) (-2465.537) (-2468.049) [-2460.502] -- 0:02:56
      207500 -- [-2462.751] (-2469.905) (-2471.369) (-2468.731) * [-2477.250] (-2462.101) (-2476.653) (-2468.267) -- 0:02:55
      208000 -- (-2463.229) (-2468.437) [-2458.274] (-2459.417) * (-2469.342) (-2464.040) [-2459.833] (-2461.034) -- 0:02:55
      208500 -- [-2465.033] (-2465.221) (-2462.131) (-2465.884) * (-2467.009) (-2464.030) (-2465.702) [-2460.002] -- 0:02:54
      209000 -- [-2463.388] (-2468.632) (-2462.988) (-2461.043) * (-2467.549) (-2469.541) (-2461.598) [-2464.759] -- 0:02:54
      209500 -- (-2468.304) (-2465.640) [-2464.718] (-2466.399) * (-2471.005) (-2472.054) (-2463.950) [-2467.864] -- 0:02:53
      210000 -- [-2460.013] (-2461.392) (-2469.594) (-2468.597) * (-2469.347) (-2465.469) (-2459.829) [-2463.757] -- 0:02:53

      Average standard deviation of split frequencies: 0.010070

      210500 -- (-2461.184) (-2464.935) (-2463.830) [-2465.399] * (-2465.228) (-2465.320) [-2463.676] (-2461.655) -- 0:02:52
      211000 -- (-2473.569) (-2462.930) (-2463.979) [-2459.713] * (-2465.531) (-2467.877) (-2458.682) [-2462.979] -- 0:02:55
      211500 -- (-2461.668) (-2461.233) (-2467.201) [-2462.799] * (-2462.137) (-2460.519) [-2466.457] (-2461.908) -- 0:02:55
      212000 -- (-2464.000) (-2462.773) [-2468.026] (-2462.954) * (-2467.177) (-2462.531) (-2461.524) [-2461.317] -- 0:02:54
      212500 -- (-2471.061) (-2464.529) (-2465.674) [-2464.264] * (-2458.652) (-2467.646) (-2463.338) [-2459.263] -- 0:02:54
      213000 -- (-2473.413) [-2460.892] (-2468.796) (-2461.844) * (-2460.405) [-2463.400] (-2467.413) (-2463.005) -- 0:02:53
      213500 -- (-2464.702) (-2469.549) (-2466.814) [-2462.758] * (-2461.391) [-2462.101] (-2461.476) (-2467.010) -- 0:02:53
      214000 -- (-2465.287) (-2465.248) (-2466.076) [-2467.887] * (-2464.770) (-2460.596) (-2465.005) [-2464.471] -- 0:02:52
      214500 -- (-2463.613) (-2466.054) (-2462.654) [-2462.391] * (-2461.280) (-2460.005) (-2461.702) [-2459.755] -- 0:02:52
      215000 -- [-2464.831] (-2461.870) (-2457.921) (-2463.649) * (-2461.846) [-2458.470] (-2466.552) (-2466.400) -- 0:02:51

      Average standard deviation of split frequencies: 0.008730

      215500 -- (-2457.826) [-2461.585] (-2464.225) (-2461.444) * (-2468.314) (-2459.153) (-2478.310) [-2460.859] -- 0:02:54
      216000 -- [-2471.683] (-2465.358) (-2461.978) (-2461.251) * (-2460.658) (-2469.463) [-2464.904] (-2467.628) -- 0:02:54
      216500 -- (-2467.574) (-2461.388) [-2458.428] (-2462.599) * [-2464.758] (-2465.886) (-2466.569) (-2463.156) -- 0:02:53
      217000 -- [-2462.043] (-2463.777) (-2460.266) (-2466.741) * (-2457.130) (-2466.931) (-2462.280) [-2459.131] -- 0:02:53
      217500 -- [-2461.738] (-2466.339) (-2462.074) (-2460.309) * (-2470.331) [-2463.422] (-2462.036) (-2458.597) -- 0:02:52
      218000 -- (-2459.344) (-2457.245) (-2461.282) [-2463.285] * (-2469.578) [-2462.752] (-2463.739) (-2459.620) -- 0:02:52
      218500 -- (-2461.153) (-2457.807) [-2458.861] (-2463.486) * (-2463.822) (-2475.514) (-2463.136) [-2462.644] -- 0:02:51
      219000 -- (-2463.818) [-2461.857] (-2462.675) (-2460.207) * (-2464.708) (-2459.260) [-2463.629] (-2471.303) -- 0:02:51
      219500 -- (-2461.612) (-2458.178) [-2462.913] (-2466.885) * (-2461.500) [-2464.784] (-2465.606) (-2467.007) -- 0:02:50
      220000 -- (-2464.557) [-2456.569] (-2471.010) (-2468.753) * [-2459.670] (-2465.352) (-2467.317) (-2461.822) -- 0:02:50

      Average standard deviation of split frequencies: 0.008545

      220500 -- (-2461.299) [-2461.487] (-2464.649) (-2464.839) * (-2463.956) [-2460.602] (-2461.177) (-2462.780) -- 0:02:53
      221000 -- (-2457.687) (-2460.971) [-2467.284] (-2459.727) * (-2466.220) (-2465.029) [-2467.119] (-2473.582) -- 0:02:52
      221500 -- [-2459.634] (-2461.532) (-2459.679) (-2460.284) * (-2460.947) (-2459.597) (-2462.081) [-2468.700] -- 0:02:52
      222000 -- (-2463.313) [-2462.907] (-2458.690) (-2462.941) * (-2468.111) (-2461.948) (-2463.442) [-2466.234] -- 0:02:51
      222500 -- [-2463.180] (-2471.603) (-2461.423) (-2464.628) * (-2464.218) (-2463.003) [-2462.830] (-2470.729) -- 0:02:51
      223000 -- (-2466.692) (-2465.417) (-2464.061) [-2463.193] * (-2466.244) [-2461.916] (-2470.010) (-2461.088) -- 0:02:50
      223500 -- (-2462.845) [-2462.780] (-2465.699) (-2462.992) * (-2466.624) [-2460.481] (-2469.159) (-2468.528) -- 0:02:50
      224000 -- (-2473.044) [-2461.765] (-2466.402) (-2461.778) * (-2466.046) (-2466.628) [-2466.536] (-2468.152) -- 0:02:49
      224500 -- [-2463.767] (-2462.517) (-2470.119) (-2462.536) * [-2457.858] (-2458.984) (-2467.926) (-2462.213) -- 0:02:49
      225000 -- (-2465.364) (-2462.788) (-2464.119) [-2458.303] * (-2460.618) (-2459.361) (-2466.495) [-2462.937] -- 0:02:52

      Average standard deviation of split frequencies: 0.007301

      225500 -- (-2463.463) [-2462.910] (-2461.683) (-2461.128) * (-2462.672) [-2466.459] (-2465.919) (-2460.289) -- 0:02:51
      226000 -- [-2465.273] (-2469.297) (-2458.183) (-2463.660) * (-2467.398) (-2464.790) (-2462.262) [-2458.258] -- 0:02:51
      226500 -- (-2470.787) (-2465.902) (-2463.413) [-2465.981] * (-2461.693) (-2464.102) [-2460.543] (-2466.826) -- 0:02:50
      227000 -- (-2472.527) [-2466.207] (-2459.572) (-2467.405) * (-2462.390) (-2459.715) (-2460.398) [-2459.500] -- 0:02:50
      227500 -- [-2463.390] (-2465.869) (-2459.565) (-2462.996) * (-2464.181) (-2460.501) (-2460.911) [-2458.479] -- 0:02:49
      228000 -- [-2460.656] (-2469.160) (-2458.066) (-2463.829) * (-2463.028) (-2468.543) (-2462.166) [-2461.828] -- 0:02:49
      228500 -- [-2463.927] (-2472.608) (-2459.335) (-2468.746) * [-2462.270] (-2464.966) (-2468.607) (-2464.294) -- 0:02:48
      229000 -- (-2461.991) (-2460.360) [-2467.510] (-2463.976) * (-2466.067) (-2462.703) [-2459.265] (-2460.280) -- 0:02:48
      229500 -- [-2458.860] (-2461.772) (-2472.311) (-2465.056) * (-2463.585) (-2466.823) (-2462.259) [-2464.045] -- 0:02:47
      230000 -- (-2464.380) [-2459.214] (-2467.245) (-2464.761) * (-2463.367) (-2461.618) (-2462.702) [-2459.719] -- 0:02:50

      Average standard deviation of split frequencies: 0.008175

      230500 -- (-2470.738) (-2461.728) (-2478.827) [-2464.576] * (-2464.174) [-2463.654] (-2470.001) (-2468.739) -- 0:02:50
      231000 -- (-2466.932) [-2463.524] (-2465.939) (-2458.837) * (-2463.687) (-2459.780) [-2457.755] (-2462.851) -- 0:02:49
      231500 -- (-2467.781) (-2465.290) (-2469.674) [-2455.625] * [-2457.459] (-2463.107) (-2468.047) (-2460.678) -- 0:02:49
      232000 -- (-2467.207) (-2462.010) [-2461.554] (-2463.392) * (-2458.527) [-2464.875] (-2462.484) (-2460.640) -- 0:02:48
      232500 -- [-2459.814] (-2461.416) (-2467.469) (-2459.261) * (-2461.026) (-2460.898) (-2465.217) [-2458.763] -- 0:02:48
      233000 -- (-2468.150) [-2458.750] (-2468.184) (-2462.601) * (-2467.692) (-2467.246) (-2468.042) [-2460.273] -- 0:02:47
      233500 -- [-2459.043] (-2464.636) (-2468.674) (-2464.793) * (-2465.699) (-2465.644) [-2461.786] (-2466.851) -- 0:02:47
      234000 -- (-2462.059) [-2459.247] (-2464.681) (-2462.176) * (-2462.253) (-2466.589) [-2465.221] (-2465.345) -- 0:02:46
      234500 -- (-2461.986) (-2472.650) (-2463.096) [-2467.940] * (-2464.029) (-2461.757) (-2461.779) [-2460.359] -- 0:02:49
      235000 -- (-2461.890) [-2463.657] (-2465.555) (-2461.646) * (-2460.885) (-2466.586) [-2467.402] (-2458.930) -- 0:02:49

      Average standard deviation of split frequencies: 0.007990

      235500 -- [-2464.058] (-2465.011) (-2462.496) (-2463.517) * (-2461.848) (-2471.940) (-2472.010) [-2465.139] -- 0:02:48
      236000 -- [-2459.001] (-2462.962) (-2466.116) (-2469.301) * (-2462.536) [-2461.451] (-2465.992) (-2463.620) -- 0:02:48
      236500 -- (-2463.590) (-2462.077) [-2463.192] (-2461.909) * (-2464.272) (-2463.051) (-2465.629) [-2461.172] -- 0:02:47
      237000 -- [-2460.799] (-2460.644) (-2467.492) (-2469.417) * (-2461.082) [-2461.365] (-2462.003) (-2467.445) -- 0:02:47
      237500 -- (-2462.187) (-2471.556) [-2465.569] (-2466.863) * [-2459.775] (-2471.358) (-2470.885) (-2468.457) -- 0:02:46
      238000 -- (-2463.222) (-2466.058) [-2461.179] (-2464.043) * (-2461.345) (-2465.901) (-2470.272) [-2460.080] -- 0:02:46
      238500 -- (-2467.587) (-2461.549) (-2465.761) [-2464.084] * (-2460.786) (-2465.310) (-2463.449) [-2462.796] -- 0:02:46
      239000 -- (-2466.727) (-2477.657) [-2460.312] (-2461.292) * [-2462.826] (-2468.172) (-2464.161) (-2465.076) -- 0:02:48
      239500 -- [-2463.503] (-2475.768) (-2463.285) (-2464.449) * (-2474.655) [-2462.579] (-2460.928) (-2466.542) -- 0:02:48
      240000 -- (-2463.541) (-2463.962) [-2471.670] (-2461.712) * [-2462.786] (-2467.189) (-2462.576) (-2461.312) -- 0:02:47

      Average standard deviation of split frequencies: 0.006856

      240500 -- (-2464.380) [-2464.595] (-2465.959) (-2462.081) * (-2469.697) [-2462.656] (-2464.567) (-2461.318) -- 0:02:47
      241000 -- (-2458.475) [-2465.526] (-2468.090) (-2467.496) * [-2460.142] (-2467.490) (-2465.349) (-2463.909) -- 0:02:46
      241500 -- (-2463.596) [-2465.787] (-2466.054) (-2468.510) * (-2464.556) (-2458.801) [-2469.694] (-2463.094) -- 0:02:46
      242000 -- [-2468.089] (-2465.447) (-2462.981) (-2471.919) * (-2459.755) (-2461.561) [-2461.873] (-2462.540) -- 0:02:46
      242500 -- [-2461.534] (-2467.176) (-2459.306) (-2468.404) * (-2460.732) [-2462.075] (-2461.055) (-2464.475) -- 0:02:45
      243000 -- [-2465.127] (-2464.276) (-2462.203) (-2460.865) * [-2463.161] (-2466.679) (-2472.688) (-2465.804) -- 0:02:45
      243500 -- (-2467.942) (-2464.551) [-2467.206] (-2465.507) * (-2463.196) (-2463.013) [-2468.167] (-2467.860) -- 0:02:44
      244000 -- (-2466.132) [-2457.366] (-2465.217) (-2463.710) * [-2462.723] (-2463.900) (-2466.191) (-2461.121) -- 0:02:47
      244500 -- (-2475.446) (-2462.922) [-2459.862] (-2458.609) * [-2466.431] (-2464.684) (-2463.909) (-2464.075) -- 0:02:46
      245000 -- [-2464.680] (-2461.407) (-2464.976) (-2457.838) * (-2460.721) [-2461.811] (-2459.485) (-2462.252) -- 0:02:46

      Average standard deviation of split frequencies: 0.006707

      245500 -- (-2468.740) (-2467.856) [-2461.983] (-2458.172) * (-2461.985) (-2463.214) (-2459.794) [-2464.734] -- 0:02:45
      246000 -- (-2461.057) (-2467.061) (-2464.955) [-2460.750] * [-2462.400] (-2465.800) (-2458.623) (-2467.117) -- 0:02:45
      246500 -- (-2459.986) [-2460.118] (-2463.277) (-2462.530) * (-2460.047) (-2465.933) [-2462.866] (-2471.515) -- 0:02:45
      247000 -- (-2461.028) (-2471.535) [-2460.957] (-2459.956) * (-2460.201) (-2464.620) (-2465.859) [-2462.479] -- 0:02:44
      247500 -- (-2462.329) (-2474.481) (-2465.187) [-2464.944] * [-2459.821] (-2465.034) (-2461.491) (-2460.819) -- 0:02:44
      248000 -- [-2458.926] (-2469.067) (-2467.948) (-2462.322) * [-2462.132] (-2471.562) (-2461.789) (-2468.206) -- 0:02:43
      248500 -- [-2462.041] (-2471.384) (-2461.136) (-2461.263) * (-2461.495) (-2465.332) (-2461.503) [-2461.989] -- 0:02:46
      249000 -- (-2462.761) [-2462.491] (-2464.908) (-2459.256) * [-2463.387] (-2469.829) (-2459.725) (-2461.456) -- 0:02:45
      249500 -- [-2458.832] (-2465.833) (-2465.292) (-2459.011) * (-2465.578) [-2465.290] (-2458.408) (-2462.888) -- 0:02:45
      250000 -- [-2458.793] (-2460.842) (-2461.950) (-2460.680) * (-2469.972) (-2468.727) [-2463.389] (-2465.103) -- 0:02:45

      Average standard deviation of split frequencies: 0.006582

      250500 -- (-2459.809) [-2461.529] (-2470.104) (-2460.932) * [-2464.548] (-2467.502) (-2462.932) (-2470.278) -- 0:02:44
      251000 -- (-2461.757) (-2458.914) [-2459.296] (-2464.753) * (-2467.296) (-2463.139) [-2458.778] (-2464.025) -- 0:02:44
      251500 -- [-2461.051] (-2463.832) (-2463.596) (-2462.251) * (-2466.519) (-2460.919) (-2467.682) [-2463.101] -- 0:02:43
      252000 -- (-2467.798) (-2460.751) [-2458.897] (-2462.962) * [-2464.107] (-2460.527) (-2462.634) (-2457.358) -- 0:02:43
      252500 -- (-2468.272) (-2470.236) [-2459.263] (-2464.769) * (-2460.634) (-2462.410) (-2464.861) [-2462.542] -- 0:02:42
      253000 -- (-2459.821) [-2462.298] (-2463.394) (-2470.591) * (-2463.814) (-2462.679) [-2461.972] (-2461.774) -- 0:02:42
      253500 -- (-2461.320) [-2465.313] (-2470.057) (-2463.068) * (-2465.078) [-2461.448] (-2465.709) (-2460.302) -- 0:02:44
      254000 -- (-2463.671) (-2465.612) (-2468.426) [-2463.692] * (-2464.171) (-2460.013) [-2462.310] (-2462.366) -- 0:02:44
      254500 -- (-2470.374) (-2459.055) [-2469.967] (-2463.044) * (-2463.849) (-2463.465) [-2462.075] (-2462.198) -- 0:02:44
      255000 -- (-2468.953) [-2462.406] (-2460.808) (-2463.143) * [-2462.173] (-2466.359) (-2461.960) (-2471.294) -- 0:02:43

      Average standard deviation of split frequencies: 0.006445

      255500 -- (-2462.563) [-2460.313] (-2466.211) (-2470.684) * [-2463.205] (-2466.122) (-2459.799) (-2468.639) -- 0:02:43
      256000 -- (-2468.595) (-2462.190) (-2466.694) [-2469.314] * (-2458.914) (-2472.272) [-2461.254] (-2463.760) -- 0:02:42
      256500 -- (-2465.383) [-2459.334] (-2471.558) (-2474.761) * (-2462.608) [-2467.982] (-2459.634) (-2461.192) -- 0:02:42
      257000 -- [-2459.209] (-2468.653) (-2459.568) (-2468.367) * (-2464.810) (-2470.281) [-2462.468] (-2459.783) -- 0:02:41
      257500 -- (-2459.696) [-2462.208] (-2476.942) (-2469.379) * (-2466.351) (-2468.274) (-2460.571) [-2461.848] -- 0:02:41
      258000 -- [-2458.988] (-2462.527) (-2467.557) (-2468.096) * (-2465.137) [-2461.046] (-2463.473) (-2457.802) -- 0:02:43
      258500 -- [-2461.013] (-2461.746) (-2458.911) (-2464.579) * (-2461.367) [-2462.369] (-2462.303) (-2458.596) -- 0:02:43
      259000 -- (-2468.443) [-2459.534] (-2463.712) (-2463.766) * (-2465.806) (-2475.684) [-2463.363] (-2463.726) -- 0:02:43
      259500 -- (-2466.614) (-2461.699) [-2460.697] (-2464.607) * [-2463.359] (-2466.554) (-2461.264) (-2460.269) -- 0:02:42
      260000 -- (-2460.874) [-2464.460] (-2463.676) (-2466.705) * [-2459.690] (-2463.430) (-2465.040) (-2464.661) -- 0:02:42

      Average standard deviation of split frequencies: 0.006330

      260500 -- (-2463.103) (-2461.813) [-2460.872] (-2461.026) * (-2464.423) (-2469.416) [-2460.722] (-2479.289) -- 0:02:41
      261000 -- (-2465.787) [-2463.096] (-2464.338) (-2462.165) * (-2471.451) [-2458.605] (-2468.628) (-2469.499) -- 0:02:41
      261500 -- (-2462.797) [-2465.057] (-2463.934) (-2474.981) * [-2463.084] (-2463.119) (-2462.805) (-2473.053) -- 0:02:40
      262000 -- [-2459.579] (-2462.464) (-2464.106) (-2468.147) * (-2465.281) (-2463.393) (-2457.417) [-2468.743] -- 0:02:40
      262500 -- [-2457.285] (-2460.455) (-2470.820) (-2460.941) * [-2458.342] (-2461.703) (-2468.237) (-2465.160) -- 0:02:42
      263000 -- (-2468.636) (-2465.513) (-2468.282) [-2460.013] * (-2461.955) (-2468.975) [-2463.620] (-2467.254) -- 0:02:42
      263500 -- (-2463.105) (-2459.548) (-2469.343) [-2462.641] * [-2465.582] (-2462.101) (-2466.845) (-2464.183) -- 0:02:42
      264000 -- (-2463.008) (-2464.291) (-2465.964) [-2460.990] * (-2463.880) (-2460.232) [-2458.605] (-2459.074) -- 0:02:41
      264500 -- (-2463.670) (-2460.305) (-2462.164) [-2463.427] * [-2462.642] (-2465.516) (-2459.721) (-2461.325) -- 0:02:41
      265000 -- (-2459.935) [-2465.732] (-2460.844) (-2463.028) * (-2465.146) [-2466.301] (-2458.259) (-2465.803) -- 0:02:40

      Average standard deviation of split frequencies: 0.006203

      265500 -- (-2470.843) (-2461.424) (-2462.161) [-2461.500] * (-2463.542) [-2463.689] (-2461.511) (-2467.336) -- 0:02:40
      266000 -- (-2469.552) [-2463.989] (-2460.705) (-2463.269) * (-2459.409) [-2464.469] (-2464.220) (-2478.090) -- 0:02:40
      266500 -- (-2466.624) [-2466.648] (-2465.734) (-2466.736) * [-2463.564] (-2458.046) (-2468.095) (-2466.959) -- 0:02:39
      267000 -- (-2461.925) [-2462.112] (-2462.402) (-2461.404) * (-2472.216) (-2460.024) [-2463.029] (-2461.041) -- 0:02:39
      267500 -- (-2462.103) (-2461.690) (-2463.443) [-2465.584] * [-2463.576] (-2462.907) (-2463.060) (-2460.629) -- 0:02:41
      268000 -- [-2460.964] (-2468.455) (-2462.494) (-2460.558) * [-2461.180] (-2467.301) (-2463.212) (-2464.685) -- 0:02:41
      268500 -- [-2460.388] (-2464.041) (-2470.590) (-2459.729) * (-2473.619) (-2459.587) (-2466.740) [-2462.396] -- 0:02:40
      269000 -- (-2463.733) (-2480.722) (-2466.041) [-2459.283] * (-2466.186) (-2462.705) [-2460.887] (-2457.266) -- 0:02:40
      269500 -- [-2461.267] (-2462.585) (-2472.012) (-2463.314) * (-2467.787) (-2458.790) [-2463.970] (-2469.596) -- 0:02:39
      270000 -- [-2459.383] (-2461.192) (-2470.540) (-2466.467) * (-2466.946) [-2461.136] (-2463.449) (-2464.488) -- 0:02:39

      Average standard deviation of split frequencies: 0.005225

      270500 -- [-2468.095] (-2468.226) (-2460.773) (-2465.410) * (-2464.074) (-2464.417) [-2465.205] (-2457.955) -- 0:02:39
      271000 -- [-2461.670] (-2462.229) (-2459.910) (-2460.763) * [-2463.190] (-2468.601) (-2466.921) (-2466.225) -- 0:02:38
      271500 -- [-2459.021] (-2462.742) (-2460.837) (-2466.131) * [-2458.609] (-2463.846) (-2468.320) (-2462.471) -- 0:02:38
      272000 -- [-2463.944] (-2462.895) (-2464.820) (-2464.952) * [-2464.444] (-2464.324) (-2463.996) (-2460.033) -- 0:02:40
      272500 -- [-2457.221] (-2462.043) (-2462.538) (-2460.674) * (-2474.799) [-2461.733] (-2470.501) (-2463.852) -- 0:02:40
      273000 -- [-2460.434] (-2461.883) (-2465.861) (-2464.475) * (-2470.466) (-2457.232) (-2466.079) [-2460.592] -- 0:02:39
      273500 -- (-2460.202) [-2461.160] (-2463.513) (-2463.999) * (-2457.056) [-2466.043] (-2468.446) (-2462.125) -- 0:02:39
      274000 -- (-2464.877) (-2467.538) (-2465.891) [-2462.000] * (-2462.745) (-2463.910) (-2462.283) [-2459.289] -- 0:02:38
      274500 -- [-2460.891] (-2466.026) (-2462.746) (-2463.888) * (-2463.617) (-2474.389) (-2463.859) [-2469.150] -- 0:02:38
      275000 -- [-2463.360] (-2467.119) (-2464.211) (-2460.758) * (-2463.393) (-2470.953) [-2462.497] (-2463.263) -- 0:02:38

      Average standard deviation of split frequencies: 0.004270

      275500 -- [-2464.670] (-2464.177) (-2458.584) (-2460.734) * (-2464.111) (-2466.191) (-2462.172) [-2465.065] -- 0:02:37
      276000 -- [-2464.513] (-2466.398) (-2463.989) (-2463.055) * (-2460.748) [-2463.090] (-2460.022) (-2471.319) -- 0:02:37
      276500 -- (-2465.591) (-2465.983) [-2459.265] (-2465.939) * (-2469.153) [-2462.291] (-2464.922) (-2463.912) -- 0:02:36
      277000 -- (-2465.521) [-2469.484] (-2465.886) (-2466.241) * (-2465.288) [-2461.083] (-2458.646) (-2466.781) -- 0:02:39
      277500 -- (-2460.954) (-2466.683) [-2464.540] (-2465.501) * (-2463.626) (-2459.350) (-2460.917) [-2464.663] -- 0:02:38
      278000 -- (-2463.487) (-2465.402) (-2467.565) [-2462.851] * [-2462.857] (-2459.142) (-2464.009) (-2468.227) -- 0:02:38
      278500 -- (-2469.806) (-2463.018) (-2464.506) [-2464.439] * (-2465.123) (-2465.088) [-2463.143] (-2466.127) -- 0:02:38
      279000 -- (-2466.142) (-2464.260) (-2460.791) [-2462.000] * (-2462.807) (-2461.867) (-2471.397) [-2462.382] -- 0:02:37
      279500 -- (-2468.251) (-2459.867) [-2468.653] (-2459.605) * (-2464.938) (-2464.619) (-2467.745) [-2463.579] -- 0:02:37
      280000 -- (-2467.763) (-2462.018) [-2466.085] (-2460.975) * [-2460.689] (-2462.020) (-2459.414) (-2462.322) -- 0:02:36

      Average standard deviation of split frequencies: 0.004199

      280500 -- (-2463.984) (-2462.544) (-2461.388) [-2462.520] * [-2465.249] (-2462.909) (-2462.759) (-2465.211) -- 0:02:36
      281000 -- (-2467.559) (-2461.864) [-2468.091] (-2459.796) * (-2462.835) (-2459.359) (-2466.353) [-2464.253] -- 0:02:36
      281500 -- (-2465.961) (-2466.321) [-2466.806] (-2467.659) * (-2461.315) (-2462.854) [-2463.206] (-2463.732) -- 0:02:38
      282000 -- (-2470.044) [-2462.680] (-2461.370) (-2458.398) * [-2462.472] (-2463.097) (-2463.639) (-2472.005) -- 0:02:37
      282500 -- (-2471.275) (-2463.429) (-2457.555) [-2460.586] * (-2462.839) [-2468.347] (-2465.786) (-2464.274) -- 0:02:37
      283000 -- (-2470.029) [-2457.412] (-2463.436) (-2467.435) * [-2460.437] (-2463.433) (-2461.715) (-2463.662) -- 0:02:37
      283500 -- (-2464.397) (-2462.773) (-2462.183) [-2462.391] * (-2463.307) (-2462.819) (-2462.986) [-2463.296] -- 0:02:36
      284000 -- [-2464.219] (-2462.698) (-2460.037) (-2462.237) * (-2464.403) (-2471.279) [-2466.792] (-2458.014) -- 0:02:36
      284500 -- (-2466.354) (-2462.738) (-2459.110) [-2468.334] * [-2461.876] (-2462.569) (-2465.681) (-2469.352) -- 0:02:35
      285000 -- (-2469.381) [-2463.033] (-2462.215) (-2460.370) * (-2470.295) (-2466.186) (-2463.726) [-2461.221] -- 0:02:35

      Average standard deviation of split frequencies: 0.004121

      285500 -- (-2461.677) [-2461.033] (-2464.597) (-2459.646) * [-2460.382] (-2473.678) (-2471.213) (-2464.387) -- 0:02:35
      286000 -- (-2464.199) (-2462.172) [-2464.289] (-2464.478) * (-2461.815) (-2461.918) [-2462.080] (-2461.892) -- 0:02:34
      286500 -- [-2462.437] (-2457.500) (-2467.819) (-2459.720) * (-2459.431) (-2463.081) (-2468.677) [-2460.620] -- 0:02:36
      287000 -- (-2462.723) [-2457.818] (-2464.031) (-2464.809) * (-2458.281) (-2466.759) (-2463.760) [-2464.630] -- 0:02:36
      287500 -- (-2465.684) [-2458.967] (-2463.022) (-2461.323) * (-2464.068) (-2468.264) (-2461.471) [-2462.553] -- 0:02:36
      288000 -- (-2464.327) (-2459.843) (-2473.494) [-2459.492] * (-2459.663) (-2464.818) (-2470.324) [-2463.349] -- 0:02:35
      288500 -- (-2464.379) (-2463.786) [-2469.369] (-2467.184) * [-2465.728] (-2465.609) (-2461.542) (-2467.192) -- 0:02:35
      289000 -- (-2461.692) [-2461.433] (-2464.476) (-2466.109) * (-2467.795) (-2465.337) [-2457.077] (-2463.455) -- 0:02:34
      289500 -- (-2461.214) [-2460.494] (-2471.525) (-2459.816) * (-2470.735) (-2465.809) (-2460.072) [-2466.019] -- 0:02:34
      290000 -- [-2462.172] (-2462.507) (-2464.850) (-2464.223) * (-2465.614) (-2460.469) [-2459.308] (-2464.194) -- 0:02:34

      Average standard deviation of split frequencies: 0.004055

      290500 -- (-2459.413) [-2462.791] (-2471.688) (-2461.219) * (-2475.384) (-2464.185) (-2466.504) [-2465.512] -- 0:02:33
      291000 -- [-2457.809] (-2470.877) (-2462.022) (-2461.178) * (-2474.651) [-2460.875] (-2459.126) (-2460.505) -- 0:02:35
      291500 -- (-2462.683) [-2463.233] (-2461.577) (-2462.706) * [-2469.471] (-2471.682) (-2475.601) (-2464.897) -- 0:02:35
      292000 -- (-2461.529) (-2464.191) (-2465.635) [-2459.448] * (-2465.372) (-2464.246) [-2465.828] (-2466.989) -- 0:02:35
      292500 -- (-2463.157) (-2459.736) (-2463.129) [-2462.704] * (-2466.169) [-2465.622] (-2460.778) (-2463.192) -- 0:02:34
      293000 -- (-2461.379) (-2465.335) [-2458.726] (-2461.622) * (-2457.720) [-2463.550] (-2463.214) (-2466.323) -- 0:02:34
      293500 -- (-2467.763) (-2465.972) (-2461.710) [-2458.972] * (-2465.968) [-2463.120] (-2466.942) (-2464.818) -- 0:02:34
      294000 -- (-2462.968) (-2465.299) [-2460.818] (-2465.428) * (-2460.253) (-2459.131) [-2462.465] (-2463.833) -- 0:02:33
      294500 -- (-2464.887) (-2459.553) (-2462.511) [-2464.390] * (-2458.370) (-2462.545) [-2461.003] (-2465.739) -- 0:02:33
      295000 -- [-2458.490] (-2461.900) (-2466.115) (-2464.566) * [-2456.356] (-2464.280) (-2460.812) (-2470.170) -- 0:02:32

      Average standard deviation of split frequencies: 0.003981

      295500 -- (-2464.196) (-2461.078) [-2459.965] (-2466.392) * (-2467.514) (-2461.708) (-2458.038) [-2466.430] -- 0:02:32
      296000 -- (-2460.598) [-2462.315] (-2458.008) (-2461.813) * (-2462.115) (-2459.532) [-2458.058] (-2462.690) -- 0:02:34
      296500 -- (-2462.549) (-2461.204) [-2463.652] (-2464.205) * (-2458.515) (-2458.807) [-2466.921] (-2467.780) -- 0:02:34
      297000 -- (-2465.341) [-2466.026] (-2461.639) (-2464.228) * [-2462.962] (-2459.712) (-2463.343) (-2461.620) -- 0:02:33
      297500 -- (-2459.004) (-2474.989) [-2461.686] (-2467.027) * (-2464.133) [-2462.759] (-2465.442) (-2471.135) -- 0:02:33
      298000 -- (-2462.807) (-2471.479) [-2461.231] (-2462.951) * (-2465.486) (-2460.964) [-2460.506] (-2467.804) -- 0:02:33
      298500 -- (-2461.929) (-2466.299) (-2462.100) [-2465.036] * (-2466.693) (-2465.002) (-2463.058) [-2461.226] -- 0:02:32
      299000 -- [-2459.195] (-2462.737) (-2465.441) (-2463.551) * (-2467.158) [-2464.327] (-2464.353) (-2460.329) -- 0:02:32
      299500 -- (-2460.369) (-2466.231) [-2462.142] (-2464.802) * [-2459.061] (-2468.466) (-2464.840) (-2464.198) -- 0:02:32
      300000 -- (-2456.822) [-2462.751] (-2464.189) (-2461.973) * [-2463.131] (-2462.646) (-2456.643) (-2460.525) -- 0:02:31

      Average standard deviation of split frequencies: 0.003920

      300500 -- (-2460.921) [-2460.933] (-2462.789) (-2462.943) * (-2459.211) [-2461.218] (-2464.870) (-2466.269) -- 0:02:33
      301000 -- (-2470.208) (-2463.159) (-2461.866) [-2461.741] * (-2464.459) [-2458.567] (-2459.479) (-2461.299) -- 0:02:33
      301500 -- (-2461.584) [-2464.788] (-2467.711) (-2462.067) * (-2464.635) (-2462.777) [-2465.638] (-2464.026) -- 0:02:32
      302000 -- (-2468.396) [-2458.426] (-2463.070) (-2459.117) * [-2462.293] (-2461.661) (-2470.022) (-2464.528) -- 0:02:32
      302500 -- (-2465.814) (-2461.596) (-2463.141) [-2462.793] * [-2462.407] (-2460.533) (-2462.435) (-2466.145) -- 0:02:32
      303000 -- (-2463.256) (-2460.980) (-2461.027) [-2460.969] * [-2469.735] (-2462.502) (-2459.981) (-2465.990) -- 0:02:31
      303500 -- (-2465.957) [-2459.279] (-2464.736) (-2462.065) * (-2464.701) (-2459.888) (-2471.367) [-2462.890] -- 0:02:31
      304000 -- (-2458.170) (-2458.745) [-2464.719] (-2463.404) * (-2467.447) (-2462.678) (-2463.121) [-2465.426] -- 0:02:31
      304500 -- (-2470.514) (-2457.630) [-2471.732] (-2465.431) * (-2464.210) [-2465.207] (-2467.543) (-2466.537) -- 0:02:30
      305000 -- (-2464.341) [-2460.716] (-2467.398) (-2471.566) * (-2469.217) (-2466.361) [-2461.969] (-2465.108) -- 0:02:30

      Average standard deviation of split frequencies: 0.003851

      305500 -- (-2465.165) (-2463.669) [-2467.258] (-2473.717) * (-2467.690) (-2461.652) [-2459.182] (-2464.119) -- 0:02:32
      306000 -- (-2466.085) (-2465.445) [-2465.306] (-2471.380) * (-2463.336) (-2467.240) [-2459.845] (-2464.926) -- 0:02:31
      306500 -- (-2462.439) [-2460.073] (-2463.732) (-2470.063) * (-2466.951) (-2464.040) [-2462.275] (-2464.180) -- 0:02:31
      307000 -- (-2463.850) (-2464.021) (-2466.206) [-2465.805] * (-2466.244) [-2459.322] (-2463.859) (-2465.181) -- 0:02:31
      307500 -- (-2460.633) (-2463.693) (-2460.150) [-2469.693] * [-2461.097] (-2460.548) (-2466.066) (-2466.273) -- 0:02:30
      308000 -- (-2465.925) (-2462.893) [-2463.852] (-2463.149) * [-2457.815] (-2457.132) (-2464.473) (-2468.354) -- 0:02:30
      308500 -- (-2470.272) (-2457.952) (-2466.707) [-2463.389] * (-2463.841) (-2464.626) [-2460.769] (-2468.749) -- 0:02:30
      309000 -- (-2473.435) [-2457.742] (-2463.544) (-2462.003) * (-2460.053) [-2465.236] (-2463.452) (-2469.023) -- 0:02:29
      309500 -- (-2470.569) (-2467.892) [-2460.709] (-2467.423) * (-2459.516) [-2462.540] (-2458.571) (-2460.347) -- 0:02:29
      310000 -- [-2462.452] (-2461.441) (-2461.987) (-2461.286) * [-2462.439] (-2464.170) (-2457.704) (-2467.333) -- 0:02:31

      Average standard deviation of split frequencies: 0.004552

      310500 -- (-2459.552) (-2461.776) [-2465.548] (-2461.290) * [-2464.064] (-2466.168) (-2468.231) (-2462.904) -- 0:02:31
      311000 -- (-2463.795) (-2461.647) [-2460.933] (-2466.799) * [-2462.414] (-2467.771) (-2457.462) (-2468.125) -- 0:02:30
      311500 -- (-2463.402) (-2466.893) (-2460.834) [-2463.439] * (-2461.066) (-2470.819) [-2465.528] (-2468.502) -- 0:02:30
      312000 -- [-2464.420] (-2472.781) (-2471.195) (-2466.353) * (-2466.018) (-2466.320) (-2464.333) [-2462.807] -- 0:02:29
      312500 -- (-2461.134) (-2464.092) (-2467.605) [-2462.303] * [-2461.240] (-2460.440) (-2465.320) (-2464.696) -- 0:02:29
      313000 -- (-2462.169) [-2462.965] (-2460.573) (-2470.941) * [-2456.919] (-2465.291) (-2466.145) (-2460.260) -- 0:02:29
      313500 -- (-2468.909) (-2466.712) [-2459.122] (-2470.052) * (-2465.717) [-2461.815] (-2473.040) (-2466.903) -- 0:02:28
      314000 -- [-2470.464] (-2467.224) (-2459.487) (-2469.482) * [-2464.443] (-2465.957) (-2470.230) (-2467.601) -- 0:02:28
      314500 -- [-2470.371] (-2463.825) (-2464.272) (-2466.563) * [-2461.258] (-2462.824) (-2466.359) (-2461.692) -- 0:02:28
      315000 -- [-2468.870] (-2467.662) (-2466.344) (-2461.353) * (-2456.470) (-2458.014) (-2460.960) [-2470.416] -- 0:02:30

      Average standard deviation of split frequencies: 0.005221

      315500 -- (-2464.303) (-2461.076) (-2465.932) [-2461.570] * (-2462.030) (-2462.271) [-2470.773] (-2463.697) -- 0:02:29
      316000 -- (-2465.902) [-2461.096] (-2472.221) (-2467.940) * [-2460.999] (-2460.161) (-2469.985) (-2469.290) -- 0:02:29
      316500 -- (-2464.507) [-2460.305] (-2477.713) (-2464.556) * (-2460.531) [-2459.762] (-2462.874) (-2464.389) -- 0:02:29
      317000 -- [-2468.125] (-2458.840) (-2471.373) (-2465.453) * (-2467.352) (-2467.194) [-2460.359] (-2458.007) -- 0:02:28
      317500 -- [-2461.503] (-2460.822) (-2471.833) (-2459.421) * (-2469.643) (-2458.802) (-2465.657) [-2459.608] -- 0:02:28
      318000 -- (-2462.673) [-2468.540] (-2460.601) (-2460.126) * (-2467.542) (-2459.777) (-2469.553) [-2459.127] -- 0:02:27
      318500 -- [-2460.076] (-2462.844) (-2466.326) (-2463.138) * (-2460.421) (-2464.844) (-2463.419) [-2461.724] -- 0:02:27
      319000 -- (-2459.724) (-2466.616) (-2461.167) [-2463.405] * [-2459.781] (-2459.038) (-2464.370) (-2460.501) -- 0:02:27
      319500 -- (-2463.106) (-2464.220) [-2463.165] (-2468.087) * (-2468.669) [-2459.026] (-2472.968) (-2460.277) -- 0:02:29
      320000 -- (-2464.428) (-2463.462) [-2461.346] (-2468.510) * (-2462.198) [-2459.694] (-2460.628) (-2464.496) -- 0:02:28

      Average standard deviation of split frequencies: 0.005880

      320500 -- (-2461.972) [-2463.419] (-2464.549) (-2464.391) * (-2467.157) (-2465.170) [-2461.511] (-2463.768) -- 0:02:28
      321000 -- (-2462.457) [-2461.855] (-2463.514) (-2470.207) * (-2469.814) (-2461.197) (-2466.406) [-2462.156] -- 0:02:28
      321500 -- (-2461.779) (-2465.651) (-2462.730) [-2462.085] * (-2462.881) (-2460.417) (-2459.768) [-2462.108] -- 0:02:27
      322000 -- [-2462.721] (-2464.593) (-2467.672) (-2462.847) * (-2465.276) (-2462.249) (-2464.590) [-2461.356] -- 0:02:27
      322500 -- (-2464.408) [-2466.006] (-2464.292) (-2462.466) * [-2465.638] (-2464.287) (-2460.775) (-2459.759) -- 0:02:27
      323000 -- (-2458.698) (-2473.705) (-2470.150) [-2458.818] * (-2468.986) [-2463.975] (-2465.360) (-2462.345) -- 0:02:26
      323500 -- (-2460.413) (-2461.388) (-2463.900) [-2464.304] * (-2474.467) [-2461.292] (-2457.295) (-2463.345) -- 0:02:26
      324000 -- [-2462.331] (-2462.846) (-2463.225) (-2461.832) * (-2462.753) [-2462.669] (-2465.055) (-2464.673) -- 0:02:26
      324500 -- (-2460.937) (-2461.305) [-2462.393] (-2464.945) * (-2467.848) (-2462.777) (-2459.369) [-2462.490] -- 0:02:27
      325000 -- (-2460.527) [-2465.996] (-2468.000) (-2466.983) * (-2463.019) [-2459.617] (-2458.765) (-2466.349) -- 0:02:27

      Average standard deviation of split frequencies: 0.006507

      325500 -- (-2466.130) (-2459.824) [-2460.307] (-2472.571) * (-2463.956) [-2461.840] (-2460.460) (-2471.853) -- 0:02:27
      326000 -- [-2460.263] (-2466.055) (-2470.700) (-2468.181) * (-2461.679) [-2458.419] (-2459.535) (-2468.679) -- 0:02:26
      326500 -- [-2464.473] (-2462.683) (-2460.457) (-2461.019) * (-2460.808) (-2468.497) (-2460.537) [-2463.327] -- 0:02:26
      327000 -- (-2462.702) [-2462.290] (-2466.246) (-2461.991) * (-2463.985) (-2464.082) [-2460.416] (-2467.800) -- 0:02:26
      327500 -- (-2468.836) [-2459.157] (-2459.377) (-2461.057) * (-2471.514) (-2462.192) [-2461.923] (-2459.727) -- 0:02:25
      328000 -- (-2460.607) [-2461.485] (-2467.411) (-2466.206) * [-2463.378] (-2463.945) (-2461.816) (-2469.643) -- 0:02:25
      328500 -- (-2462.602) (-2467.573) (-2473.928) [-2466.602] * (-2469.469) [-2461.812] (-2464.228) (-2471.057) -- 0:02:25
      329000 -- [-2460.213] (-2469.856) (-2484.599) (-2464.661) * (-2465.817) [-2460.929] (-2469.286) (-2458.774) -- 0:02:26
      329500 -- (-2466.449) (-2468.358) (-2474.365) [-2460.189] * (-2461.413) [-2463.408] (-2465.974) (-2462.265) -- 0:02:26
      330000 -- [-2462.962] (-2467.139) (-2467.809) (-2461.006) * (-2466.158) (-2463.339) (-2467.675) [-2460.617] -- 0:02:26

      Average standard deviation of split frequencies: 0.006415

      330500 -- (-2461.552) [-2464.139] (-2474.633) (-2461.465) * [-2459.275] (-2460.017) (-2472.276) (-2460.764) -- 0:02:25
      331000 -- (-2464.846) (-2460.743) (-2462.320) [-2462.175] * [-2461.800] (-2463.457) (-2459.551) (-2461.186) -- 0:02:25
      331500 -- (-2468.015) [-2459.358] (-2462.476) (-2460.852) * (-2466.647) (-2465.264) [-2462.024] (-2462.175) -- 0:02:25
      332000 -- [-2462.347] (-2463.859) (-2460.477) (-2459.563) * (-2459.109) (-2459.853) [-2463.264] (-2468.367) -- 0:02:24
      332500 -- (-2468.281) (-2464.628) (-2461.031) [-2457.469] * [-2459.726] (-2468.837) (-2460.122) (-2469.100) -- 0:02:24
      333000 -- (-2467.443) (-2460.471) [-2464.448] (-2463.911) * (-2458.982) (-2467.372) [-2459.511] (-2463.470) -- 0:02:24
      333500 -- (-2466.325) (-2469.079) [-2460.800] (-2460.866) * [-2462.551] (-2465.278) (-2465.096) (-2469.547) -- 0:02:23
      334000 -- (-2466.467) (-2462.140) (-2462.567) [-2463.452] * (-2464.706) (-2462.494) (-2470.827) [-2466.407] -- 0:02:25
      334500 -- [-2471.158] (-2465.510) (-2460.135) (-2460.085) * (-2466.824) (-2463.530) [-2464.142] (-2461.371) -- 0:02:25
      335000 -- (-2461.037) [-2471.063] (-2462.694) (-2468.941) * (-2468.717) (-2472.751) (-2461.404) [-2458.736] -- 0:02:24

      Average standard deviation of split frequencies: 0.005612

      335500 -- (-2461.357) (-2465.198) [-2467.916] (-2465.485) * (-2460.638) [-2462.139] (-2470.375) (-2465.800) -- 0:02:24
      336000 -- (-2463.435) (-2462.950) [-2458.063] (-2464.276) * (-2467.906) (-2459.440) (-2472.287) [-2461.039] -- 0:02:24
      336500 -- (-2470.488) (-2464.388) [-2458.618] (-2469.564) * [-2469.405] (-2468.553) (-2475.275) (-2468.056) -- 0:02:23
      337000 -- (-2468.755) (-2478.301) [-2459.562] (-2463.524) * (-2461.633) (-2471.007) (-2467.134) [-2459.119] -- 0:02:23
      337500 -- [-2465.177] (-2458.142) (-2466.780) (-2462.997) * (-2462.342) (-2475.853) [-2465.737] (-2461.407) -- 0:02:23
      338000 -- [-2466.475] (-2462.273) (-2458.217) (-2477.209) * (-2461.696) (-2468.631) (-2460.752) [-2460.610] -- 0:02:22
      338500 -- [-2463.650] (-2486.682) (-2462.919) (-2461.390) * (-2460.842) (-2464.663) (-2466.242) [-2463.243] -- 0:02:24
      339000 -- (-2463.182) (-2472.704) (-2470.583) [-2456.756] * [-2462.774] (-2462.877) (-2469.808) (-2462.933) -- 0:02:24
      339500 -- (-2473.131) (-2468.140) [-2458.755] (-2458.031) * (-2463.305) [-2468.443] (-2468.247) (-2463.514) -- 0:02:23
      340000 -- (-2466.229) [-2458.947] (-2464.320) (-2458.654) * [-2461.681] (-2469.932) (-2456.638) (-2465.749) -- 0:02:23

      Average standard deviation of split frequencies: 0.004843

      340500 -- [-2461.930] (-2461.224) (-2461.156) (-2468.013) * [-2462.246] (-2464.295) (-2462.860) (-2468.134) -- 0:02:23
      341000 -- (-2467.516) (-2458.472) (-2464.060) [-2464.856] * [-2462.470] (-2460.645) (-2460.270) (-2465.842) -- 0:02:23
      341500 -- [-2468.562] (-2461.427) (-2462.877) (-2460.910) * (-2460.327) (-2463.205) [-2462.974] (-2465.753) -- 0:02:22
      342000 -- (-2468.947) [-2462.135] (-2460.867) (-2459.950) * (-2470.283) [-2468.515] (-2464.355) (-2464.009) -- 0:02:22
      342500 -- (-2463.028) [-2467.556] (-2462.757) (-2461.380) * (-2472.940) (-2470.945) (-2461.568) [-2461.545] -- 0:02:22
      343000 -- (-2465.495) (-2464.728) (-2461.478) [-2458.543] * (-2465.115) [-2468.182] (-2463.076) (-2466.793) -- 0:02:21
      343500 -- (-2464.369) [-2462.717] (-2467.893) (-2459.859) * [-2467.160] (-2464.628) (-2465.085) (-2465.829) -- 0:02:23
      344000 -- (-2463.790) (-2461.495) [-2462.206] (-2462.609) * (-2469.463) (-2465.959) [-2471.510] (-2468.391) -- 0:02:23
      344500 -- (-2470.193) [-2462.680] (-2463.053) (-2463.798) * (-2469.184) (-2463.708) [-2460.047] (-2470.383) -- 0:02:22
      345000 -- (-2464.253) (-2469.155) [-2464.909] (-2465.947) * [-2463.472] (-2466.822) (-2462.739) (-2456.909) -- 0:02:22

      Average standard deviation of split frequencies: 0.004769

      345500 -- [-2464.260] (-2464.730) (-2464.114) (-2459.642) * (-2461.295) (-2468.387) [-2463.903] (-2463.295) -- 0:02:22
      346000 -- (-2463.325) [-2460.935] (-2468.067) (-2463.076) * (-2468.248) (-2463.972) (-2462.635) [-2460.708] -- 0:02:21
      346500 -- [-2459.502] (-2461.592) (-2467.421) (-2465.848) * [-2461.323] (-2464.197) (-2467.114) (-2462.132) -- 0:02:21
      347000 -- (-2461.675) (-2468.802) [-2466.666] (-2462.474) * (-2460.323) (-2463.090) [-2457.162] (-2462.020) -- 0:02:21
      347500 -- [-2462.222] (-2463.983) (-2464.230) (-2468.238) * (-2472.175) [-2461.812] (-2469.313) (-2466.860) -- 0:02:20
      348000 -- (-2462.260) (-2471.938) [-2463.255] (-2464.742) * [-2467.793] (-2466.676) (-2458.899) (-2464.743) -- 0:02:22
      348500 -- (-2466.374) [-2459.929] (-2466.490) (-2467.170) * [-2470.173] (-2461.952) (-2461.944) (-2469.540) -- 0:02:22
      349000 -- (-2457.960) (-2466.595) [-2463.886] (-2469.830) * (-2468.093) [-2466.881] (-2465.541) (-2476.521) -- 0:02:21
      349500 -- [-2461.180] (-2465.667) (-2468.544) (-2463.891) * (-2467.471) [-2467.276] (-2459.599) (-2469.244) -- 0:02:21
      350000 -- (-2463.780) (-2461.598) [-2461.704] (-2468.579) * (-2459.447) (-2463.599) [-2463.509] (-2467.675) -- 0:02:21

      Average standard deviation of split frequencies: 0.004705

      350500 -- (-2461.340) [-2461.878] (-2463.369) (-2463.571) * (-2462.932) [-2460.423] (-2467.294) (-2460.698) -- 0:02:20
      351000 -- (-2463.559) (-2466.041) (-2464.133) [-2458.863] * [-2456.240] (-2461.748) (-2466.293) (-2464.025) -- 0:02:20
      351500 -- (-2462.172) [-2462.576] (-2467.624) (-2464.460) * (-2462.152) (-2469.428) (-2466.879) [-2461.502] -- 0:02:20
      352000 -- (-2461.001) (-2467.207) [-2461.598] (-2470.075) * [-2461.037] (-2467.426) (-2462.425) (-2462.873) -- 0:02:19
      352500 -- [-2463.868] (-2468.000) (-2462.787) (-2465.323) * (-2459.009) (-2463.890) (-2465.028) [-2469.995] -- 0:02:21
      353000 -- (-2464.537) (-2462.005) (-2460.099) [-2468.027] * (-2461.579) [-2460.549] (-2467.546) (-2466.003) -- 0:02:21
      353500 -- (-2466.410) [-2459.429] (-2480.121) (-2463.835) * (-2459.945) [-2460.651] (-2466.205) (-2462.441) -- 0:02:20
      354000 -- (-2463.052) (-2457.832) [-2459.898] (-2466.281) * [-2462.511] (-2463.430) (-2467.230) (-2461.161) -- 0:02:20
      354500 -- (-2465.643) [-2459.833] (-2464.606) (-2461.196) * (-2464.791) (-2465.771) (-2470.320) [-2460.370] -- 0:02:20
      355000 -- (-2468.248) (-2462.399) (-2461.750) [-2459.663] * (-2469.166) (-2464.023) (-2468.015) [-2462.450] -- 0:02:19

      Average standard deviation of split frequencies: 0.004635

      355500 -- (-2459.921) (-2468.442) [-2463.606] (-2462.925) * (-2470.241) (-2465.239) (-2476.188) [-2460.582] -- 0:02:19
      356000 -- (-2464.020) (-2465.316) (-2468.106) [-2462.285] * (-2469.814) (-2464.770) (-2469.014) [-2459.607] -- 0:02:19
      356500 -- (-2462.469) (-2460.105) [-2457.602] (-2463.664) * (-2468.761) (-2470.344) [-2463.766] (-2463.676) -- 0:02:18
      357000 -- (-2462.587) (-2458.884) [-2460.865] (-2465.928) * (-2462.857) (-2464.619) (-2463.677) [-2460.000] -- 0:02:18
      357500 -- (-2458.653) [-2464.469] (-2459.194) (-2461.217) * [-2464.004] (-2468.771) (-2464.822) (-2467.159) -- 0:02:20
      358000 -- (-2461.599) (-2461.747) (-2459.585) [-2472.357] * (-2465.163) (-2461.593) (-2468.291) [-2460.512] -- 0:02:19
      358500 -- [-2461.853] (-2465.689) (-2462.028) (-2478.371) * (-2466.709) [-2460.547] (-2467.604) (-2459.816) -- 0:02:19
      359000 -- [-2461.041] (-2462.651) (-2472.320) (-2468.253) * [-2463.069] (-2459.517) (-2461.218) (-2463.450) -- 0:02:19
      359500 -- [-2462.412] (-2464.438) (-2466.900) (-2466.395) * [-2463.686] (-2459.721) (-2468.997) (-2465.478) -- 0:02:18
      360000 -- [-2465.715] (-2460.837) (-2464.557) (-2462.978) * (-2468.093) (-2465.518) (-2461.231) [-2463.931] -- 0:02:18

      Average standard deviation of split frequencies: 0.003921

      360500 -- [-2467.149] (-2460.790) (-2468.830) (-2462.080) * [-2463.777] (-2463.716) (-2461.428) (-2470.227) -- 0:02:18
      361000 -- (-2469.060) (-2459.837) (-2467.413) [-2461.505] * (-2470.716) [-2458.575] (-2466.126) (-2465.254) -- 0:02:18
      361500 -- [-2464.228] (-2456.971) (-2465.147) (-2463.268) * (-2469.656) (-2463.754) (-2470.983) [-2459.046] -- 0:02:17
      362000 -- (-2465.197) [-2459.878] (-2460.090) (-2463.371) * (-2465.787) [-2466.312] (-2463.526) (-2466.537) -- 0:02:19
      362500 -- [-2459.378] (-2467.601) (-2460.957) (-2466.508) * (-2467.402) (-2463.593) [-2467.882] (-2464.631) -- 0:02:18
      363000 -- (-2473.362) (-2467.830) [-2459.266] (-2470.064) * (-2464.943) [-2466.225] (-2464.680) (-2460.790) -- 0:02:18
      363500 -- [-2464.777] (-2462.469) (-2467.741) (-2472.835) * [-2466.902] (-2466.382) (-2461.572) (-2463.964) -- 0:02:18
      364000 -- (-2462.775) [-2465.826] (-2459.231) (-2468.114) * (-2462.815) [-2460.525] (-2463.813) (-2461.973) -- 0:02:18
      364500 -- (-2464.909) (-2471.734) [-2460.199] (-2462.725) * (-2463.443) (-2458.161) (-2464.193) [-2469.925] -- 0:02:17
      365000 -- (-2466.868) [-2460.536] (-2462.391) (-2472.839) * (-2473.675) [-2463.027] (-2464.785) (-2469.844) -- 0:02:17

      Average standard deviation of split frequencies: 0.003864

      365500 -- [-2464.032] (-2460.329) (-2471.130) (-2463.670) * (-2461.156) (-2465.447) [-2467.396] (-2462.046) -- 0:02:17
      366000 -- (-2462.383) (-2461.441) [-2457.049] (-2460.304) * (-2461.416) (-2463.097) (-2470.462) [-2465.023] -- 0:02:16
      366500 -- (-2461.772) (-2462.455) [-2458.839] (-2461.039) * (-2468.652) (-2469.594) (-2470.411) [-2464.555] -- 0:02:16
      367000 -- (-2463.673) (-2469.226) [-2462.603] (-2471.729) * (-2474.030) [-2462.883] (-2470.572) (-2467.622) -- 0:02:17
      367500 -- (-2458.857) (-2466.550) (-2459.979) [-2465.013] * (-2463.398) [-2461.090] (-2465.585) (-2465.349) -- 0:02:17
      368000 -- (-2462.318) (-2464.752) (-2463.672) [-2461.679] * (-2466.474) (-2462.506) [-2458.407] (-2464.886) -- 0:02:17
      368500 -- (-2461.146) [-2466.354] (-2464.359) (-2464.065) * (-2466.373) [-2463.847] (-2466.364) (-2465.404) -- 0:02:17
      369000 -- (-2463.838) (-2466.052) (-2462.489) [-2462.283] * (-2461.702) (-2466.425) (-2459.246) [-2468.979] -- 0:02:16
      369500 -- [-2464.523] (-2464.668) (-2462.951) (-2462.384) * [-2463.971] (-2461.726) (-2464.408) (-2463.452) -- 0:02:16
      370000 -- (-2462.503) [-2459.853] (-2459.410) (-2467.857) * (-2462.893) (-2462.299) [-2458.360] (-2462.494) -- 0:02:16

      Average standard deviation of split frequencies: 0.003179

      370500 -- (-2461.743) (-2471.802) [-2458.331] (-2463.478) * (-2462.995) (-2462.656) (-2463.873) [-2462.988] -- 0:02:15
      371000 -- (-2465.876) [-2465.861] (-2462.707) (-2462.630) * (-2461.109) (-2465.497) [-2467.343] (-2467.057) -- 0:02:15
      371500 -- (-2471.611) (-2471.680) (-2466.710) [-2469.110] * (-2465.985) (-2462.064) [-2463.750] (-2461.459) -- 0:02:17
      372000 -- (-2459.695) (-2469.908) (-2460.883) [-2465.877] * (-2465.238) (-2460.033) [-2462.521] (-2466.196) -- 0:02:16
      372500 -- (-2465.849) (-2465.217) (-2459.424) [-2462.877] * (-2461.233) [-2461.337] (-2470.597) (-2468.272) -- 0:02:16
      373000 -- (-2463.656) (-2458.914) [-2464.501] (-2460.585) * [-2458.609] (-2459.590) (-2468.864) (-2462.403) -- 0:02:16
      373500 -- (-2463.592) [-2462.785] (-2462.352) (-2467.250) * (-2459.954) [-2458.999] (-2462.862) (-2466.969) -- 0:02:15
      374000 -- (-2460.529) [-2466.096] (-2459.556) (-2460.233) * (-2463.646) (-2465.688) [-2463.392] (-2461.446) -- 0:02:15
      374500 -- [-2462.610] (-2462.930) (-2464.713) (-2462.633) * [-2460.918] (-2464.265) (-2462.593) (-2467.796) -- 0:02:15
      375000 -- (-2465.575) (-2465.115) [-2462.938] (-2464.720) * (-2460.720) [-2461.653] (-2464.084) (-2466.159) -- 0:02:15

      Average standard deviation of split frequencies: 0.003761

      375500 -- (-2463.693) [-2464.418] (-2464.430) (-2476.579) * (-2462.392) [-2467.832] (-2469.664) (-2463.072) -- 0:02:14
      376000 -- (-2462.177) (-2471.670) (-2465.152) [-2464.132] * [-2461.788] (-2466.304) (-2462.671) (-2467.935) -- 0:02:14
      376500 -- [-2459.056] (-2460.231) (-2462.181) (-2460.696) * (-2469.695) [-2463.698] (-2460.656) (-2459.991) -- 0:02:15
      377000 -- [-2464.849] (-2461.878) (-2464.071) (-2466.212) * [-2465.792] (-2462.855) (-2462.245) (-2463.367) -- 0:02:15
      377500 -- (-2466.416) (-2465.138) (-2463.623) [-2463.007] * [-2469.510] (-2459.656) (-2465.687) (-2468.101) -- 0:02:15
      378000 -- (-2469.132) (-2468.166) [-2460.336] (-2468.964) * (-2464.248) (-2465.039) [-2465.047] (-2460.513) -- 0:02:14
      378500 -- [-2460.414] (-2463.091) (-2458.943) (-2462.009) * [-2464.475] (-2476.567) (-2463.583) (-2465.999) -- 0:02:14
      379000 -- (-2467.621) [-2459.919] (-2464.056) (-2462.942) * (-2467.652) (-2468.577) [-2461.281] (-2464.398) -- 0:02:14
      379500 -- (-2474.818) (-2457.479) [-2459.192] (-2459.494) * (-2465.563) (-2469.862) [-2463.420] (-2468.600) -- 0:02:14
      380000 -- [-2463.654] (-2463.099) (-2460.464) (-2461.426) * (-2462.539) [-2467.903] (-2464.586) (-2463.964) -- 0:02:13

      Average standard deviation of split frequencies: 0.003715

      380500 -- (-2464.557) [-2465.111] (-2474.443) (-2458.884) * [-2468.484] (-2460.470) (-2464.367) (-2460.190) -- 0:02:13
      381000 -- (-2461.993) (-2465.729) (-2462.150) [-2458.985] * (-2461.916) (-2464.398) (-2460.431) [-2465.249] -- 0:02:14
      381500 -- (-2466.315) (-2463.616) (-2464.142) [-2463.661] * [-2458.248] (-2459.385) (-2465.582) (-2467.449) -- 0:02:14
      382000 -- [-2464.751] (-2466.423) (-2463.270) (-2465.742) * [-2458.922] (-2463.565) (-2461.675) (-2465.739) -- 0:02:14
      382500 -- [-2459.068] (-2461.838) (-2464.165) (-2462.247) * (-2460.185) (-2459.667) (-2463.328) [-2465.193] -- 0:02:13
      383000 -- (-2463.214) (-2463.535) [-2465.889] (-2460.361) * (-2468.323) (-2457.260) (-2461.318) [-2460.841] -- 0:02:13
      383500 -- (-2466.498) (-2458.463) (-2460.501) [-2458.392] * [-2458.329] (-2465.484) (-2462.269) (-2459.151) -- 0:02:13
      384000 -- (-2461.908) (-2470.643) (-2458.715) [-2458.647] * (-2463.674) (-2464.998) [-2456.036] (-2463.601) -- 0:02:13
      384500 -- (-2461.954) (-2468.821) [-2468.828] (-2461.170) * (-2460.319) [-2459.572] (-2466.607) (-2464.256) -- 0:02:12
      385000 -- (-2467.078) (-2474.603) (-2470.787) [-2462.733] * [-2462.441] (-2457.331) (-2470.269) (-2462.460) -- 0:02:12

      Average standard deviation of split frequencies: 0.003664

      385500 -- (-2460.523) (-2466.193) (-2468.536) [-2459.782] * (-2458.729) [-2458.584] (-2463.996) (-2467.652) -- 0:02:13
      386000 -- (-2463.589) [-2461.968] (-2464.122) (-2460.333) * (-2460.043) (-2459.236) [-2467.673] (-2462.778) -- 0:02:13
      386500 -- (-2458.274) (-2461.155) [-2466.689] (-2464.203) * (-2459.309) (-2469.335) [-2464.811] (-2466.408) -- 0:02:13
      387000 -- (-2460.797) (-2467.679) (-2465.024) [-2464.272] * (-2471.463) [-2462.157] (-2461.901) (-2458.642) -- 0:02:13
      387500 -- [-2461.381] (-2469.187) (-2464.597) (-2466.256) * (-2470.796) (-2460.780) (-2464.050) [-2461.754] -- 0:02:12
      388000 -- (-2467.958) [-2464.994] (-2457.627) (-2466.534) * (-2465.701) [-2466.892] (-2467.007) (-2459.311) -- 0:02:12
      388500 -- (-2464.869) [-2467.887] (-2459.670) (-2469.584) * [-2466.028] (-2473.828) (-2465.408) (-2468.453) -- 0:02:12
      389000 -- (-2465.209) (-2460.815) (-2461.048) [-2468.349] * [-2463.330] (-2472.081) (-2461.921) (-2460.134) -- 0:02:11
      389500 -- (-2463.327) (-2464.396) [-2460.461] (-2460.782) * (-2462.532) (-2461.251) [-2458.730] (-2460.375) -- 0:02:11
      390000 -- (-2466.055) (-2467.640) [-2466.432] (-2462.792) * (-2460.489) [-2457.748] (-2461.290) (-2467.056) -- 0:02:11

      Average standard deviation of split frequencies: 0.003620

      390500 -- (-2461.215) (-2461.880) [-2464.194] (-2463.796) * (-2474.833) [-2461.034] (-2465.944) (-2464.666) -- 0:02:12
      391000 -- (-2464.448) (-2466.161) (-2457.160) [-2459.286] * [-2461.122] (-2466.538) (-2464.361) (-2460.540) -- 0:02:12
      391500 -- (-2462.891) (-2465.110) (-2467.016) [-2462.623] * (-2468.331) (-2477.693) (-2462.909) [-2456.751] -- 0:02:12
      392000 -- [-2460.426] (-2459.028) (-2464.460) (-2461.741) * (-2465.805) (-2463.599) (-2469.437) [-2462.705] -- 0:02:11
      392500 -- (-2460.508) (-2460.414) [-2462.702] (-2461.103) * [-2464.719] (-2460.425) (-2467.601) (-2462.645) -- 0:02:11
      393000 -- (-2464.645) (-2463.185) [-2459.871] (-2466.533) * [-2466.023] (-2458.877) (-2465.194) (-2464.348) -- 0:02:11
      393500 -- (-2468.032) [-2459.526] (-2462.174) (-2466.496) * (-2459.916) (-2459.198) (-2462.096) [-2462.658] -- 0:02:11
      394000 -- (-2470.523) (-2461.175) (-2465.115) [-2464.612] * (-2468.053) [-2457.478] (-2463.481) (-2464.064) -- 0:02:10
      394500 -- (-2467.555) [-2462.709] (-2470.743) (-2464.198) * (-2466.171) (-2461.390) [-2462.707] (-2465.051) -- 0:02:10
      395000 -- (-2472.700) [-2464.616] (-2468.640) (-2461.462) * [-2466.139] (-2468.809) (-2461.834) (-2464.860) -- 0:02:11

      Average standard deviation of split frequencies: 0.003571

      395500 -- (-2465.818) (-2458.509) (-2465.166) [-2465.388] * (-2464.906) (-2459.962) [-2457.223] (-2463.042) -- 0:02:11
      396000 -- (-2466.609) (-2458.720) (-2462.878) [-2471.956] * (-2468.541) (-2459.983) (-2464.992) [-2465.315] -- 0:02:11
      396500 -- [-2466.550] (-2468.205) (-2467.470) (-2464.901) * (-2472.498) (-2461.432) [-2456.955] (-2464.630) -- 0:02:10
      397000 -- (-2462.898) (-2465.016) (-2466.234) [-2459.600] * [-2463.072] (-2465.752) (-2461.143) (-2460.722) -- 0:02:10
      397500 -- (-2462.649) (-2461.280) [-2466.319] (-2468.792) * (-2465.457) [-2464.549] (-2471.129) (-2462.383) -- 0:02:10
      398000 -- [-2466.723] (-2474.108) (-2473.107) (-2464.405) * (-2463.155) [-2465.448] (-2464.339) (-2458.850) -- 0:02:10
      398500 -- (-2462.094) (-2469.942) [-2459.435] (-2466.089) * [-2459.712] (-2465.734) (-2458.834) (-2465.499) -- 0:02:09
      399000 -- (-2459.975) (-2461.267) [-2460.134] (-2463.317) * (-2465.112) (-2464.916) (-2458.486) [-2464.435] -- 0:02:09
      399500 -- (-2462.466) (-2466.352) [-2468.252] (-2462.712) * (-2466.020) [-2463.341] (-2469.357) (-2464.684) -- 0:02:09
      400000 -- (-2460.862) [-2466.601] (-2461.967) (-2465.066) * (-2463.135) [-2464.029] (-2460.862) (-2458.765) -- 0:02:10

      Average standard deviation of split frequencies: 0.004118

      400500 -- (-2464.754) (-2464.437) [-2467.350] (-2465.852) * (-2464.205) (-2464.071) [-2457.593] (-2470.411) -- 0:02:10
      401000 -- (-2457.258) [-2461.405] (-2468.410) (-2465.972) * (-2467.531) [-2465.638] (-2461.197) (-2463.391) -- 0:02:09
      401500 -- (-2459.980) [-2459.589] (-2466.298) (-2463.437) * [-2465.486] (-2470.728) (-2461.986) (-2462.257) -- 0:02:09
      402000 -- [-2459.187] (-2468.663) (-2462.655) (-2472.131) * (-2469.057) (-2472.235) [-2458.255] (-2461.541) -- 0:02:09
      402500 -- [-2465.614] (-2464.714) (-2466.091) (-2463.429) * (-2466.538) (-2465.465) (-2461.029) [-2459.442] -- 0:02:09
      403000 -- (-2459.340) (-2471.678) [-2462.991] (-2469.381) * [-2463.768] (-2465.202) (-2464.794) (-2471.555) -- 0:02:08
      403500 -- [-2461.406] (-2465.528) (-2461.204) (-2468.731) * (-2464.640) (-2465.318) (-2465.627) [-2460.612] -- 0:02:08
      404000 -- (-2465.343) (-2465.060) (-2465.479) [-2463.547] * (-2467.990) [-2466.657] (-2462.146) (-2460.698) -- 0:02:08
      404500 -- [-2464.873] (-2465.049) (-2461.968) (-2464.767) * (-2463.927) (-2462.628) [-2459.255] (-2464.923) -- 0:02:09
      405000 -- (-2463.602) (-2459.307) [-2462.155] (-2461.294) * [-2460.997] (-2460.394) (-2459.344) (-2460.191) -- 0:02:09

      Average standard deviation of split frequencies: 0.003483

      405500 -- (-2459.865) [-2458.904] (-2461.636) (-2462.209) * (-2463.199) [-2466.538] (-2467.959) (-2458.971) -- 0:02:09
      406000 -- (-2462.527) (-2461.146) [-2462.996] (-2462.693) * (-2464.503) (-2460.927) (-2459.596) [-2459.410] -- 0:02:08
      406500 -- (-2460.058) (-2465.363) [-2460.636] (-2461.511) * (-2461.429) (-2464.378) [-2460.145] (-2459.522) -- 0:02:08
      407000 -- (-2461.798) [-2462.364] (-2467.289) (-2463.109) * (-2462.599) (-2459.895) (-2464.442) [-2461.884] -- 0:02:08
      407500 -- (-2464.076) (-2463.202) (-2462.874) [-2464.286] * (-2465.855) [-2461.800] (-2466.390) (-2460.243) -- 0:02:07
      408000 -- (-2460.152) [-2466.190] (-2467.589) (-2471.647) * (-2468.163) (-2462.699) [-2464.843] (-2469.843) -- 0:02:07
      408500 -- (-2475.360) (-2462.361) (-2466.072) [-2462.465] * (-2462.970) [-2457.104] (-2463.177) (-2463.013) -- 0:02:07
      409000 -- [-2470.961] (-2458.741) (-2461.674) (-2462.670) * (-2463.641) (-2458.142) [-2460.649] (-2467.165) -- 0:02:08
      409500 -- (-2464.197) [-2467.650] (-2460.307) (-2461.308) * (-2458.832) [-2460.602] (-2460.178) (-2465.792) -- 0:02:08
      410000 -- (-2466.247) [-2461.250] (-2460.806) (-2466.326) * (-2467.225) [-2461.294] (-2467.664) (-2475.883) -- 0:02:08

      Average standard deviation of split frequencies: 0.002870

      410500 -- (-2470.745) (-2465.748) (-2469.670) [-2467.483] * (-2461.493) (-2471.991) [-2469.490] (-2466.478) -- 0:02:07
      411000 -- (-2462.865) (-2462.775) (-2458.489) [-2470.980] * (-2463.864) [-2467.859] (-2461.703) (-2464.814) -- 0:02:07
      411500 -- (-2465.378) [-2462.405] (-2458.925) (-2465.655) * (-2465.714) (-2458.336) [-2462.496] (-2463.445) -- 0:02:07
      412000 -- (-2468.404) (-2461.078) (-2461.524) [-2464.436] * (-2464.676) [-2459.520] (-2462.574) (-2467.535) -- 0:02:07
      412500 -- (-2463.649) (-2461.011) [-2458.234] (-2467.866) * [-2463.351] (-2465.506) (-2457.348) (-2464.923) -- 0:02:06
      413000 -- (-2458.786) (-2463.567) (-2464.392) [-2463.879] * [-2464.457] (-2461.831) (-2460.851) (-2458.998) -- 0:02:06
      413500 -- (-2460.208) (-2469.499) [-2463.318] (-2461.119) * (-2459.880) (-2462.760) [-2462.750] (-2461.428) -- 0:02:06
      414000 -- (-2475.096) (-2463.536) [-2464.097] (-2459.844) * (-2468.258) (-2458.558) [-2460.078] (-2466.372) -- 0:02:07
      414500 -- (-2465.717) (-2465.408) (-2463.793) [-2462.781] * (-2460.033) (-2463.152) (-2459.958) [-2463.101] -- 0:02:07
      415000 -- (-2465.363) [-2460.472] (-2464.721) (-2462.185) * (-2462.045) (-2462.987) [-2461.710] (-2469.369) -- 0:02:06

      Average standard deviation of split frequencies: 0.002833

      415500 -- [-2460.655] (-2466.370) (-2461.946) (-2461.606) * (-2463.606) (-2460.258) [-2460.687] (-2462.336) -- 0:02:06
      416000 -- (-2467.183) [-2465.601] (-2466.305) (-2465.264) * (-2468.625) (-2466.226) [-2458.332] (-2461.242) -- 0:02:06
      416500 -- (-2461.665) (-2469.183) [-2465.404] (-2464.760) * (-2459.991) (-2469.537) [-2458.695] (-2466.153) -- 0:02:06
      417000 -- (-2458.524) (-2465.068) [-2461.811] (-2474.544) * [-2464.845] (-2463.304) (-2464.276) (-2464.368) -- 0:02:05
      417500 -- [-2460.515] (-2467.596) (-2464.926) (-2467.523) * (-2469.919) (-2465.643) [-2457.960] (-2462.289) -- 0:02:05
      418000 -- [-2462.404] (-2460.535) (-2465.997) (-2465.029) * (-2463.800) (-2465.895) [-2462.413] (-2462.092) -- 0:02:05
      418500 -- (-2467.173) (-2458.017) [-2465.332] (-2462.559) * (-2464.160) [-2462.899] (-2458.338) (-2460.829) -- 0:02:06
      419000 -- (-2463.031) [-2460.510] (-2467.904) (-2468.591) * (-2463.203) (-2465.034) (-2464.690) [-2464.663] -- 0:02:06
      419500 -- [-2464.057] (-2458.796) (-2464.000) (-2464.757) * (-2461.610) (-2469.754) [-2459.416] (-2465.164) -- 0:02:05
      420000 -- (-2465.950) (-2462.263) [-2467.837] (-2462.510) * (-2467.161) (-2463.145) [-2463.705] (-2462.075) -- 0:02:05

      Average standard deviation of split frequencies: 0.002241

      420500 -- (-2461.951) (-2463.329) [-2456.706] (-2458.303) * (-2466.844) (-2466.793) [-2466.486] (-2461.042) -- 0:02:05
      421000 -- [-2469.662] (-2460.964) (-2462.894) (-2463.438) * (-2462.790) [-2458.604] (-2463.744) (-2459.326) -- 0:02:05
      421500 -- (-2462.403) (-2463.112) (-2462.091) [-2458.251] * [-2460.177] (-2464.864) (-2463.840) (-2461.202) -- 0:02:04
      422000 -- (-2463.140) (-2465.725) (-2456.904) [-2463.227] * (-2462.084) (-2460.502) [-2462.774] (-2458.784) -- 0:02:04
      422500 -- [-2459.726] (-2468.537) (-2458.410) (-2461.232) * (-2468.918) (-2463.128) (-2468.823) [-2463.466] -- 0:02:04
      423000 -- (-2462.179) (-2468.435) (-2460.112) [-2460.101] * (-2458.465) (-2458.349) [-2463.864] (-2465.656) -- 0:02:04
      423500 -- (-2461.947) (-2460.015) (-2461.969) [-2457.840] * (-2466.154) (-2461.110) [-2465.142] (-2458.797) -- 0:02:05
      424000 -- (-2463.698) (-2461.046) (-2463.030) [-2471.471] * (-2467.926) (-2463.023) (-2461.681) [-2465.173] -- 0:02:04
      424500 -- [-2460.260] (-2460.086) (-2466.159) (-2468.236) * (-2467.554) (-2462.897) (-2475.314) [-2461.592] -- 0:02:04
      425000 -- [-2462.888] (-2464.112) (-2458.978) (-2458.168) * (-2474.981) (-2464.630) (-2468.153) [-2463.389] -- 0:02:04

      Average standard deviation of split frequencies: 0.002213

      425500 -- [-2460.365] (-2469.226) (-2465.789) (-2463.610) * (-2461.338) [-2461.450] (-2462.296) (-2466.846) -- 0:02:04
      426000 -- [-2458.709] (-2472.201) (-2467.139) (-2459.439) * [-2464.079] (-2462.395) (-2461.942) (-2463.058) -- 0:02:03
      426500 -- (-2459.959) (-2473.261) [-2461.699] (-2464.684) * [-2460.002] (-2462.791) (-2461.931) (-2463.467) -- 0:02:03
      427000 -- (-2462.506) (-2469.796) [-2460.472] (-2462.000) * [-2458.768] (-2462.590) (-2457.336) (-2461.119) -- 0:02:03
      427500 -- (-2461.238) (-2463.294) [-2462.477] (-2459.093) * (-2467.640) (-2459.734) [-2463.848] (-2467.459) -- 0:02:03
      428000 -- (-2462.966) (-2464.146) (-2461.396) [-2461.430] * (-2469.467) (-2464.722) (-2459.584) [-2466.984] -- 0:02:04
      428500 -- (-2463.851) (-2464.710) [-2462.137] (-2470.336) * (-2463.876) (-2468.013) (-2458.493) [-2461.985] -- 0:02:04
      429000 -- (-2460.350) [-2464.133] (-2467.450) (-2465.766) * (-2463.242) (-2467.592) [-2461.901] (-2459.085) -- 0:02:03
      429500 -- (-2465.385) [-2472.939] (-2464.320) (-2469.587) * (-2471.051) (-2469.938) [-2465.263] (-2464.922) -- 0:02:03
      430000 -- (-2467.693) [-2458.571] (-2458.844) (-2473.459) * [-2463.471] (-2465.430) (-2471.644) (-2467.006) -- 0:02:03

      Average standard deviation of split frequencies: 0.002736

      430500 -- (-2464.834) [-2460.837] (-2462.546) (-2466.112) * (-2464.184) (-2473.699) (-2468.719) [-2460.631] -- 0:02:03
      431000 -- (-2461.367) (-2458.925) [-2462.284] (-2472.092) * [-2462.216] (-2467.990) (-2471.064) (-2466.610) -- 0:02:02
      431500 -- (-2467.284) [-2460.267] (-2464.060) (-2470.062) * [-2461.625] (-2465.047) (-2462.054) (-2466.726) -- 0:02:02
      432000 -- (-2462.322) (-2462.135) (-2462.903) [-2463.329] * (-2461.407) (-2463.907) (-2465.087) [-2468.637] -- 0:02:02
      432500 -- [-2459.267] (-2459.131) (-2463.645) (-2470.674) * [-2462.611] (-2466.416) (-2460.520) (-2466.761) -- 0:02:02
      433000 -- (-2457.858) (-2460.812) [-2466.872] (-2461.779) * [-2463.440] (-2465.935) (-2463.289) (-2473.603) -- 0:02:03
      433500 -- (-2463.615) (-2462.878) [-2462.338] (-2458.146) * (-2471.442) [-2464.938] (-2463.568) (-2466.625) -- 0:02:02
      434000 -- (-2463.402) [-2463.640] (-2461.574) (-2459.705) * (-2468.319) (-2463.758) (-2463.982) [-2460.807] -- 0:02:02
      434500 -- (-2466.200) [-2459.860] (-2464.201) (-2462.487) * [-2464.873] (-2464.477) (-2462.696) (-2460.045) -- 0:02:02
      435000 -- [-2463.032] (-2460.407) (-2462.815) (-2457.718) * (-2465.416) (-2466.616) (-2469.171) [-2464.447] -- 0:02:02

      Average standard deviation of split frequencies: 0.003244

      435500 -- (-2456.982) [-2462.626] (-2466.612) (-2462.719) * [-2462.099] (-2458.374) (-2467.011) (-2459.747) -- 0:02:01
      436000 -- [-2460.863] (-2460.613) (-2462.173) (-2459.466) * (-2465.672) (-2460.798) [-2464.184] (-2473.199) -- 0:02:01
      436500 -- [-2463.205] (-2468.343) (-2462.367) (-2460.950) * (-2464.801) (-2464.618) (-2466.730) [-2464.898] -- 0:02:01
      437000 -- (-2464.947) (-2465.042) (-2463.112) [-2463.811] * [-2469.365] (-2463.554) (-2465.493) (-2459.010) -- 0:02:01
      437500 -- (-2465.536) (-2475.778) [-2461.734] (-2460.272) * (-2470.157) [-2460.744] (-2468.086) (-2463.738) -- 0:02:02
      438000 -- (-2459.757) (-2468.350) [-2469.042] (-2462.049) * (-2464.542) (-2464.534) (-2460.660) [-2463.380] -- 0:02:01
      438500 -- (-2463.249) (-2466.483) [-2462.213] (-2465.854) * (-2466.939) (-2462.574) (-2465.385) [-2464.549] -- 0:02:01
      439000 -- [-2461.212] (-2465.755) (-2460.582) (-2467.244) * (-2467.093) (-2466.488) (-2471.297) [-2464.096] -- 0:02:01
      439500 -- [-2464.277] (-2460.612) (-2463.782) (-2465.906) * (-2465.137) [-2466.223] (-2472.307) (-2471.827) -- 0:02:01
      440000 -- (-2461.623) (-2455.758) [-2459.621] (-2460.880) * (-2463.219) [-2462.229] (-2464.383) (-2465.946) -- 0:02:00

      Average standard deviation of split frequencies: 0.003209

      440500 -- (-2461.370) (-2462.961) (-2469.981) [-2463.306] * (-2461.810) (-2465.662) [-2461.515] (-2459.819) -- 0:02:00
      441000 -- (-2462.231) (-2461.060) [-2457.806] (-2465.617) * [-2460.561] (-2464.296) (-2460.955) (-2466.172) -- 0:02:00
      441500 -- [-2463.963] (-2461.630) (-2460.371) (-2470.827) * (-2466.734) (-2467.760) [-2464.919] (-2460.809) -- 0:02:00
      442000 -- (-2467.562) [-2461.710] (-2463.526) (-2467.015) * (-2466.849) (-2464.638) [-2464.055] (-2463.474) -- 0:02:01
      442500 -- (-2461.322) (-2464.845) [-2461.087] (-2467.249) * (-2459.992) [-2465.058] (-2457.983) (-2459.696) -- 0:02:00
      443000 -- (-2462.783) (-2464.780) (-2462.772) [-2467.485] * (-2464.527) (-2468.652) [-2462.347] (-2458.205) -- 0:02:00
      443500 -- (-2460.916) [-2465.073] (-2471.447) (-2466.155) * (-2470.485) (-2467.809) (-2462.647) [-2459.257] -- 0:02:00
      444000 -- (-2461.511) (-2462.244) (-2458.824) [-2466.899] * (-2463.207) (-2463.480) (-2458.978) [-2459.913] -- 0:02:00
      444500 -- (-2466.482) [-2459.453] (-2461.019) (-2456.637) * (-2461.345) (-2471.691) (-2458.992) [-2460.043] -- 0:01:59
      445000 -- (-2470.340) (-2465.962) (-2461.539) [-2466.955] * (-2468.504) [-2462.285] (-2464.355) (-2465.701) -- 0:01:59

      Average standard deviation of split frequencies: 0.003171

      445500 -- [-2463.467] (-2462.471) (-2461.501) (-2459.973) * (-2465.834) [-2461.313] (-2461.022) (-2462.612) -- 0:01:59
      446000 -- (-2460.810) (-2468.830) (-2464.934) [-2463.923] * (-2464.212) (-2463.783) (-2463.171) [-2464.470] -- 0:01:59
      446500 -- [-2461.028] (-2466.076) (-2463.783) (-2464.499) * (-2465.404) (-2462.432) [-2464.985] (-2467.020) -- 0:01:59
      447000 -- (-2467.882) [-2464.231] (-2469.689) (-2467.902) * (-2464.373) (-2464.902) [-2460.567] (-2459.710) -- 0:02:00
      447500 -- (-2465.785) (-2463.420) (-2463.661) [-2465.479] * (-2465.226) [-2465.338] (-2465.143) (-2459.711) -- 0:01:59
      448000 -- [-2468.701] (-2468.618) (-2461.207) (-2469.710) * (-2461.845) (-2461.189) [-2461.515] (-2463.968) -- 0:01:59
      448500 -- (-2466.278) (-2468.352) (-2466.043) [-2464.568] * (-2464.767) (-2469.847) (-2459.712) [-2462.586] -- 0:01:59
      449000 -- (-2471.109) (-2461.182) (-2465.622) [-2470.062] * (-2464.545) (-2461.931) [-2462.275] (-2461.996) -- 0:01:59
      449500 -- (-2464.095) (-2464.330) (-2459.032) [-2464.779] * (-2465.435) (-2465.004) [-2464.449] (-2457.683) -- 0:01:58
      450000 -- (-2458.621) (-2467.161) [-2467.772] (-2467.089) * (-2468.054) (-2466.365) (-2462.410) [-2463.318] -- 0:01:58

      Average standard deviation of split frequencies: 0.003138

      450500 -- (-2460.028) [-2460.720] (-2461.282) (-2468.384) * (-2468.058) (-2469.722) (-2466.205) [-2460.442] -- 0:01:58
      451000 -- (-2464.224) (-2456.702) [-2458.261] (-2477.348) * (-2464.395) (-2472.249) (-2460.153) [-2463.168] -- 0:01:58
      451500 -- (-2464.654) [-2461.641] (-2463.597) (-2470.740) * (-2462.600) [-2463.305] (-2464.308) (-2465.795) -- 0:01:59
      452000 -- (-2463.116) [-2464.242] (-2465.011) (-2473.027) * (-2469.942) [-2469.998] (-2464.878) (-2466.890) -- 0:01:58
      452500 -- (-2463.784) (-2457.719) (-2466.756) [-2466.515] * (-2459.196) (-2462.717) [-2466.751] (-2474.021) -- 0:01:58
      453000 -- (-2468.522) (-2464.133) [-2464.398] (-2466.211) * (-2464.768) (-2462.876) [-2462.414] (-2472.264) -- 0:01:58
      453500 -- (-2462.143) (-2461.489) [-2464.586] (-2459.706) * (-2462.856) (-2463.973) [-2469.265] (-2465.906) -- 0:01:58
      454000 -- (-2465.625) (-2470.630) [-2468.295] (-2467.587) * [-2460.605] (-2466.429) (-2468.074) (-2468.119) -- 0:01:57
      454500 -- (-2466.570) (-2462.143) [-2459.049] (-2459.282) * [-2463.822] (-2459.556) (-2465.473) (-2463.586) -- 0:01:57
      455000 -- (-2461.506) [-2457.674] (-2462.194) (-2463.050) * [-2463.462] (-2469.984) (-2463.734) (-2469.597) -- 0:01:57

      Average standard deviation of split frequencies: 0.003101

      455500 -- (-2463.433) [-2471.583] (-2464.103) (-2460.851) * [-2461.407] (-2463.392) (-2462.172) (-2464.699) -- 0:01:57
      456000 -- (-2466.929) (-2461.837) (-2460.059) [-2461.793] * (-2463.102) (-2476.219) (-2462.253) [-2458.332] -- 0:01:56
      456500 -- (-2461.369) [-2465.840] (-2460.469) (-2471.564) * (-2462.855) (-2470.360) (-2465.962) [-2461.035] -- 0:01:57
      457000 -- (-2468.303) (-2459.022) [-2456.858] (-2472.716) * (-2462.474) [-2465.555] (-2461.540) (-2461.148) -- 0:01:57
      457500 -- (-2462.850) [-2461.533] (-2462.700) (-2471.121) * (-2470.069) (-2465.068) (-2463.887) [-2465.464] -- 0:01:57
      458000 -- (-2462.331) [-2460.815] (-2464.376) (-2466.267) * (-2466.553) (-2460.533) [-2460.479] (-2464.462) -- 0:01:57
      458500 -- (-2462.463) [-2457.874] (-2465.418) (-2469.610) * (-2465.658) [-2461.075] (-2457.985) (-2463.336) -- 0:01:56
      459000 -- (-2465.375) [-2457.795] (-2468.255) (-2471.961) * (-2466.289) (-2459.475) (-2457.903) [-2458.230] -- 0:01:56
      459500 -- [-2465.817] (-2466.598) (-2466.179) (-2467.352) * [-2463.487] (-2471.765) (-2463.319) (-2461.199) -- 0:01:56
      460000 -- [-2469.027] (-2461.822) (-2461.348) (-2467.175) * [-2464.478] (-2460.330) (-2463.594) (-2463.499) -- 0:01:56

      Average standard deviation of split frequencies: 0.003582

      460500 -- [-2465.660] (-2467.750) (-2468.847) (-2463.350) * (-2468.748) [-2462.500] (-2461.380) (-2466.768) -- 0:01:55
      461000 -- (-2460.498) (-2466.521) (-2460.980) [-2459.569] * (-2468.679) [-2460.815] (-2463.818) (-2462.267) -- 0:01:56
      461500 -- (-2465.924) (-2465.510) (-2462.304) [-2471.703] * (-2462.403) (-2461.112) [-2463.054] (-2460.961) -- 0:01:56
      462000 -- [-2460.374] (-2469.319) (-2459.534) (-2463.415) * [-2464.388] (-2465.251) (-2461.704) (-2465.394) -- 0:01:56
      462500 -- (-2461.355) (-2466.778) [-2471.235] (-2466.070) * (-2463.322) (-2468.208) [-2464.923] (-2467.097) -- 0:01:56
      463000 -- [-2460.727] (-2466.497) (-2467.652) (-2465.575) * (-2463.325) [-2459.713] (-2466.647) (-2460.371) -- 0:01:55
      463500 -- [-2459.410] (-2469.165) (-2465.346) (-2466.353) * (-2469.223) (-2464.326) (-2461.635) [-2460.989] -- 0:01:55
      464000 -- (-2457.767) [-2460.204] (-2463.740) (-2463.957) * (-2460.094) [-2463.692] (-2469.536) (-2465.158) -- 0:01:55
      464500 -- (-2461.602) (-2464.264) (-2463.542) [-2461.047] * (-2463.083) [-2459.043] (-2463.860) (-2462.102) -- 0:01:55
      465000 -- (-2457.427) (-2466.603) (-2474.405) [-2459.827] * (-2463.711) (-2467.972) [-2458.422] (-2462.765) -- 0:01:55

      Average standard deviation of split frequencies: 0.003541

      465500 -- (-2466.887) (-2464.399) [-2468.743] (-2461.087) * (-2463.677) (-2461.991) [-2461.808] (-2459.894) -- 0:01:55
      466000 -- (-2470.014) [-2464.244] (-2473.284) (-2457.792) * [-2459.459] (-2458.560) (-2465.205) (-2460.224) -- 0:01:55
      466500 -- (-2456.889) (-2462.864) [-2459.793] (-2461.464) * (-2461.068) [-2461.593] (-2465.196) (-2460.447) -- 0:01:55
      467000 -- (-2473.004) [-2463.638] (-2466.230) (-2463.427) * (-2462.671) [-2458.542] (-2467.470) (-2459.534) -- 0:01:55
      467500 -- (-2464.108) (-2462.779) [-2470.973] (-2475.687) * [-2459.365] (-2460.763) (-2465.346) (-2463.932) -- 0:01:55
      468000 -- (-2466.156) [-2463.223] (-2463.958) (-2463.419) * (-2462.686) (-2467.088) [-2460.892] (-2463.212) -- 0:01:54
      468500 -- (-2469.069) (-2461.721) [-2459.089] (-2468.412) * [-2464.701] (-2471.503) (-2466.769) (-2470.889) -- 0:01:54
      469000 -- (-2458.776) [-2463.259] (-2464.817) (-2464.154) * [-2462.216] (-2462.690) (-2460.115) (-2464.741) -- 0:01:54
      469500 -- [-2464.522] (-2463.792) (-2469.845) (-2466.279) * [-2461.678] (-2455.617) (-2472.714) (-2465.118) -- 0:01:54
      470000 -- [-2464.366] (-2460.690) (-2459.485) (-2459.160) * (-2462.725) (-2466.550) [-2465.033] (-2470.130) -- 0:01:53

      Average standard deviation of split frequencies: 0.002003

      470500 -- (-2462.095) (-2466.730) (-2467.621) [-2456.572] * (-2464.133) [-2464.200] (-2466.508) (-2471.761) -- 0:01:54
      471000 -- (-2466.487) [-2461.798] (-2473.820) (-2465.582) * (-2461.037) (-2459.837) [-2465.465] (-2461.845) -- 0:01:54
      471500 -- (-2471.426) (-2458.856) (-2467.004) [-2462.949] * [-2463.954] (-2462.967) (-2476.867) (-2474.748) -- 0:01:54
      472000 -- (-2463.334) (-2463.396) [-2461.300] (-2462.476) * (-2463.530) [-2469.056] (-2463.539) (-2465.649) -- 0:01:54
      472500 -- (-2464.020) [-2459.678] (-2457.126) (-2469.306) * (-2464.656) (-2467.172) [-2460.108] (-2471.251) -- 0:01:53
      473000 -- [-2461.807] (-2464.598) (-2461.763) (-2463.026) * (-2473.910) (-2463.564) (-2460.863) [-2465.714] -- 0:01:53
      473500 -- (-2462.647) (-2457.904) (-2464.670) [-2460.850] * (-2473.877) (-2467.587) (-2462.420) [-2463.557] -- 0:01:53
      474000 -- (-2458.497) (-2462.413) (-2464.289) [-2460.302] * [-2463.133] (-2463.186) (-2462.526) (-2460.496) -- 0:01:53
      474500 -- [-2464.574] (-2461.800) (-2460.946) (-2459.852) * (-2469.289) (-2462.675) [-2460.810] (-2464.123) -- 0:01:52
      475000 -- (-2465.539) (-2466.183) [-2469.139] (-2461.287) * (-2471.095) (-2464.938) (-2462.438) [-2459.046] -- 0:01:53

      Average standard deviation of split frequencies: 0.001486

      475500 -- (-2463.022) (-2459.192) [-2463.344] (-2468.033) * (-2463.024) [-2461.354] (-2461.666) (-2466.847) -- 0:01:53
      476000 -- (-2468.165) (-2463.438) [-2462.086] (-2471.407) * (-2470.770) (-2459.689) (-2465.047) [-2460.210] -- 0:01:53
      476500 -- (-2462.661) (-2467.563) (-2465.026) [-2461.880] * (-2461.680) (-2458.966) (-2468.177) [-2464.447] -- 0:01:53
      477000 -- (-2464.725) [-2463.114] (-2472.129) (-2465.794) * (-2461.511) (-2461.998) [-2464.038] (-2462.200) -- 0:01:52
      477500 -- (-2464.205) (-2466.038) (-2462.458) [-2461.132] * (-2465.372) (-2464.437) [-2460.975] (-2459.853) -- 0:01:52
      478000 -- (-2469.840) [-2466.340] (-2463.295) (-2461.726) * [-2465.389] (-2467.630) (-2467.179) (-2462.645) -- 0:01:52
      478500 -- (-2462.128) [-2465.705] (-2464.429) (-2460.458) * (-2459.629) (-2468.007) (-2461.609) [-2466.105] -- 0:01:52
      479000 -- (-2466.762) (-2461.812) (-2464.170) [-2460.881] * [-2467.217] (-2472.003) (-2459.986) (-2468.285) -- 0:01:52
      479500 -- (-2460.943) (-2460.751) [-2459.331] (-2465.814) * (-2460.584) (-2472.737) [-2459.184] (-2471.049) -- 0:01:51
      480000 -- [-2464.911] (-2462.905) (-2459.670) (-2472.347) * [-2464.252] (-2468.155) (-2459.780) (-2467.464) -- 0:01:52

      Average standard deviation of split frequencies: 0.000981

      480500 -- (-2462.070) (-2460.263) [-2461.254] (-2464.780) * (-2462.064) (-2469.192) (-2473.164) [-2467.714] -- 0:01:52
      481000 -- (-2467.878) (-2465.332) (-2465.274) [-2460.322] * (-2462.053) [-2461.766] (-2465.511) (-2474.792) -- 0:01:52
      481500 -- (-2460.574) (-2458.057) [-2463.270] (-2465.040) * (-2463.425) (-2465.130) [-2467.233] (-2465.484) -- 0:01:51
      482000 -- (-2460.568) [-2464.186] (-2460.983) (-2466.071) * (-2463.200) (-2464.935) [-2471.296] (-2460.951) -- 0:01:51
      482500 -- (-2463.153) (-2460.338) (-2467.426) [-2467.806] * (-2466.309) (-2472.066) [-2466.141] (-2468.352) -- 0:01:51
      483000 -- [-2460.260] (-2465.704) (-2459.003) (-2464.143) * (-2462.743) (-2466.179) [-2459.947] (-2471.475) -- 0:01:51
      483500 -- (-2465.188) [-2463.420] (-2465.175) (-2466.713) * (-2467.072) (-2462.570) [-2464.777] (-2462.561) -- 0:01:51
      484000 -- [-2460.571] (-2464.455) (-2459.917) (-2466.524) * (-2464.968) (-2459.501) (-2465.911) [-2461.384] -- 0:01:50
      484500 -- (-2463.896) (-2458.351) (-2462.017) [-2462.182] * (-2464.600) (-2465.412) [-2466.615] (-2464.291) -- 0:01:51
      485000 -- (-2464.094) [-2460.948] (-2458.548) (-2464.474) * (-2462.010) [-2462.045] (-2466.592) (-2464.328) -- 0:01:51

      Average standard deviation of split frequencies: 0.001455

      485500 -- (-2463.631) (-2462.403) [-2459.170] (-2465.533) * (-2464.617) (-2459.995) (-2464.517) [-2461.505] -- 0:01:51
      486000 -- (-2465.442) [-2467.238] (-2464.330) (-2467.510) * [-2463.194] (-2467.423) (-2459.681) (-2466.938) -- 0:01:51
      486500 -- (-2461.919) (-2462.505) [-2461.564] (-2468.137) * (-2463.746) (-2461.382) [-2463.051] (-2467.616) -- 0:01:50
      487000 -- (-2463.664) (-2462.534) (-2465.038) [-2460.984] * (-2464.988) [-2462.519] (-2471.604) (-2466.900) -- 0:01:50
      487500 -- (-2470.118) [-2459.750] (-2464.674) (-2464.528) * (-2461.908) (-2462.012) (-2466.875) [-2467.225] -- 0:01:50
      488000 -- [-2472.478] (-2461.077) (-2459.714) (-2464.826) * (-2462.851) (-2465.354) [-2461.679] (-2468.276) -- 0:01:50
      488500 -- (-2461.524) (-2460.608) [-2463.283] (-2465.000) * [-2464.842] (-2466.006) (-2473.115) (-2469.018) -- 0:01:49
      489000 -- [-2463.585] (-2469.134) (-2466.307) (-2474.244) * (-2473.115) [-2466.597] (-2467.218) (-2468.761) -- 0:01:49
      489500 -- (-2460.189) [-2464.806] (-2467.303) (-2467.350) * [-2460.662] (-2463.570) (-2462.402) (-2468.271) -- 0:01:50
      490000 -- [-2466.431] (-2464.781) (-2468.725) (-2456.473) * [-2466.451] (-2462.646) (-2466.705) (-2467.554) -- 0:01:50

      Average standard deviation of split frequencies: 0.002402

      490500 -- (-2472.546) (-2459.476) (-2465.371) [-2461.116] * (-2462.975) [-2463.919] (-2461.769) (-2466.478) -- 0:01:50
      491000 -- (-2464.049) (-2459.157) [-2469.867] (-2457.607) * [-2466.913] (-2469.512) (-2464.829) (-2466.981) -- 0:01:49
      491500 -- (-2465.578) (-2469.207) [-2463.893] (-2465.295) * (-2463.860) [-2463.036] (-2471.054) (-2458.557) -- 0:01:49
      492000 -- (-2460.011) (-2467.171) (-2462.776) [-2459.245] * [-2467.221] (-2461.273) (-2459.533) (-2460.586) -- 0:01:49
      492500 -- [-2461.495] (-2466.420) (-2460.592) (-2465.363) * [-2465.177] (-2466.489) (-2459.088) (-2463.267) -- 0:01:49
      493000 -- (-2463.399) (-2462.276) [-2459.023] (-2463.322) * (-2463.329) (-2460.830) [-2467.776] (-2468.261) -- 0:01:49
      493500 -- [-2461.814] (-2466.622) (-2462.261) (-2460.144) * (-2472.203) [-2463.150] (-2469.636) (-2465.441) -- 0:01:48
      494000 -- [-2462.734] (-2463.774) (-2457.396) (-2461.529) * (-2460.363) [-2461.834] (-2470.410) (-2465.600) -- 0:01:49
      494500 -- (-2462.928) (-2462.033) [-2461.133] (-2465.852) * (-2461.642) [-2465.179] (-2465.045) (-2471.749) -- 0:01:49
      495000 -- (-2460.770) (-2460.432) [-2463.770] (-2467.169) * (-2461.503) (-2466.900) [-2461.946] (-2459.801) -- 0:01:49

      Average standard deviation of split frequencies: 0.002376

      495500 -- (-2465.063) [-2458.822] (-2468.299) (-2464.578) * [-2460.535] (-2463.797) (-2468.193) (-2466.468) -- 0:01:48
      496000 -- (-2456.257) [-2461.105] (-2472.408) (-2469.144) * [-2462.720] (-2464.175) (-2462.249) (-2466.572) -- 0:01:48
      496500 -- (-2460.563) (-2463.899) (-2468.403) [-2465.068] * [-2461.504] (-2465.442) (-2465.612) (-2465.460) -- 0:01:48
      497000 -- (-2464.671) (-2460.614) [-2461.989] (-2468.855) * [-2463.367] (-2463.360) (-2463.831) (-2468.973) -- 0:01:48
      497500 -- (-2471.733) (-2458.963) [-2465.715] (-2463.273) * (-2462.721) [-2463.684] (-2464.116) (-2468.871) -- 0:01:48
      498000 -- (-2464.175) (-2470.251) (-2465.502) [-2460.651] * [-2457.959] (-2460.834) (-2466.351) (-2465.945) -- 0:01:47
      498500 -- (-2472.007) (-2464.864) [-2466.304] (-2465.742) * [-2454.677] (-2463.610) (-2462.848) (-2465.990) -- 0:01:48
      499000 -- (-2459.445) (-2475.301) [-2460.943] (-2459.271) * [-2464.603] (-2464.606) (-2462.615) (-2471.148) -- 0:01:48
      499500 -- [-2460.039] (-2465.205) (-2462.174) (-2462.153) * (-2458.917) (-2463.839) [-2463.412] (-2467.541) -- 0:01:48
      500000 -- (-2465.400) (-2467.742) [-2462.685] (-2462.814) * [-2461.068] (-2463.844) (-2459.838) (-2468.544) -- 0:01:48

      Average standard deviation of split frequencies: 0.001883

      500500 -- (-2465.134) (-2462.348) (-2465.853) [-2460.672] * [-2463.557] (-2463.157) (-2467.290) (-2463.477) -- 0:01:47
      501000 -- (-2459.893) [-2459.684] (-2465.174) (-2466.511) * [-2460.210] (-2467.743) (-2464.944) (-2460.681) -- 0:01:47
      501500 -- (-2467.361) [-2462.672] (-2458.522) (-2472.724) * (-2465.456) (-2472.583) (-2462.090) [-2463.500] -- 0:01:47
      502000 -- (-2470.352) [-2460.211] (-2460.774) (-2464.755) * (-2465.334) [-2469.548] (-2461.004) (-2462.185) -- 0:01:47
      502500 -- (-2465.954) [-2459.481] (-2470.260) (-2464.051) * (-2466.021) (-2467.181) [-2461.421] (-2465.212) -- 0:01:46
      503000 -- [-2464.137] (-2466.364) (-2462.403) (-2468.056) * (-2466.800) [-2467.455] (-2464.345) (-2472.720) -- 0:01:46
      503500 -- (-2461.632) (-2474.151) (-2457.906) [-2458.475] * [-2465.617] (-2466.414) (-2461.567) (-2478.803) -- 0:01:47
      504000 -- [-2466.347] (-2464.864) (-2468.625) (-2463.438) * (-2466.947) [-2460.455] (-2463.516) (-2474.691) -- 0:01:47
      504500 -- (-2465.358) (-2462.453) [-2468.056] (-2461.501) * (-2467.201) (-2457.971) [-2465.736] (-2470.782) -- 0:01:47
      505000 -- (-2464.791) (-2461.528) [-2459.729] (-2469.462) * [-2462.502] (-2469.381) (-2464.829) (-2465.730) -- 0:01:46

      Average standard deviation of split frequencies: 0.000932

      505500 -- (-2458.705) [-2461.011] (-2463.413) (-2465.722) * (-2462.856) (-2469.957) [-2461.627] (-2467.475) -- 0:01:46
      506000 -- (-2459.444) (-2462.488) [-2464.374] (-2469.401) * (-2461.825) (-2458.475) (-2467.407) [-2465.705] -- 0:01:46
      506500 -- (-2462.439) (-2461.015) [-2468.213] (-2463.293) * [-2457.863] (-2464.127) (-2468.138) (-2464.043) -- 0:01:46
      507000 -- [-2466.940] (-2465.795) (-2469.765) (-2459.753) * [-2466.304] (-2467.312) (-2468.331) (-2467.367) -- 0:01:45
      507500 -- (-2462.366) (-2464.538) (-2468.953) [-2463.551] * (-2465.212) (-2472.508) [-2464.767] (-2462.612) -- 0:01:45
      508000 -- (-2466.972) (-2467.364) (-2466.462) [-2469.033] * [-2458.865] (-2471.106) (-2457.375) (-2464.456) -- 0:01:46
      508500 -- (-2460.335) (-2472.461) (-2467.973) [-2459.601] * [-2461.575] (-2464.041) (-2471.244) (-2460.832) -- 0:01:46
      509000 -- (-2470.124) (-2473.724) (-2464.606) [-2461.322] * [-2468.387] (-2460.911) (-2464.595) (-2458.787) -- 0:01:46
      509500 -- (-2468.340) (-2462.937) (-2460.585) [-2467.541] * (-2471.571) (-2464.349) [-2461.140] (-2465.559) -- 0:01:45
      510000 -- (-2462.729) [-2461.103] (-2466.225) (-2463.943) * [-2460.491] (-2467.236) (-2466.918) (-2467.729) -- 0:01:45

      Average standard deviation of split frequencies: 0.000923

      510500 -- (-2470.867) (-2456.786) [-2460.169] (-2465.761) * [-2459.528] (-2460.944) (-2462.656) (-2470.222) -- 0:01:45
      511000 -- (-2463.005) [-2461.628] (-2473.945) (-2457.862) * (-2462.140) (-2465.263) [-2461.431] (-2461.504) -- 0:01:45
      511500 -- (-2463.658) (-2459.999) [-2468.068] (-2464.505) * (-2465.272) (-2468.111) (-2464.835) [-2461.098] -- 0:01:45
      512000 -- (-2462.676) [-2460.938] (-2466.212) (-2460.437) * (-2475.422) (-2473.430) [-2465.037] (-2461.209) -- 0:01:44
      512500 -- (-2466.862) (-2465.246) (-2460.779) [-2460.033] * (-2463.182) (-2471.286) [-2463.763] (-2458.223) -- 0:01:44
      513000 -- (-2464.611) (-2458.885) [-2468.518] (-2466.374) * (-2461.298) (-2468.373) [-2462.506] (-2462.234) -- 0:01:45
      513500 -- (-2465.439) [-2463.859] (-2466.888) (-2462.526) * (-2460.344) (-2461.099) [-2458.186] (-2464.093) -- 0:01:45
      514000 -- (-2461.393) [-2459.051] (-2464.869) (-2465.891) * (-2461.909) (-2463.762) (-2466.673) [-2465.065] -- 0:01:44
      514500 -- (-2464.040) (-2458.451) [-2463.624] (-2461.032) * (-2463.352) (-2462.871) [-2469.380] (-2458.905) -- 0:01:44
      515000 -- (-2467.133) (-2466.786) (-2474.356) [-2460.334] * (-2462.786) [-2469.986] (-2465.960) (-2462.511) -- 0:01:44

      Average standard deviation of split frequencies: 0.000914

      515500 -- (-2461.228) [-2460.458] (-2476.976) (-2461.489) * (-2461.619) (-2469.710) (-2468.066) [-2463.109] -- 0:01:44
      516000 -- (-2460.574) (-2464.634) [-2467.076] (-2460.119) * [-2466.687] (-2471.342) (-2463.852) (-2464.408) -- 0:01:44
      516500 -- (-2465.645) (-2463.350) [-2463.429] (-2460.835) * (-2459.139) (-2466.030) [-2464.904] (-2469.518) -- 0:01:43
      517000 -- (-2463.943) (-2458.284) [-2466.354] (-2460.552) * [-2458.749] (-2469.944) (-2459.009) (-2459.644) -- 0:01:43
      517500 -- (-2462.283) (-2462.942) [-2466.796] (-2463.792) * (-2460.176) (-2467.078) [-2462.685] (-2469.253) -- 0:01:44
      518000 -- [-2465.495] (-2461.164) (-2470.909) (-2466.670) * (-2465.473) [-2462.123] (-2462.098) (-2477.055) -- 0:01:44
      518500 -- (-2465.583) (-2462.553) [-2458.789] (-2464.452) * [-2464.110] (-2472.299) (-2465.002) (-2468.347) -- 0:01:44
      519000 -- (-2459.934) (-2464.665) [-2465.825] (-2471.150) * (-2464.727) (-2461.714) (-2474.797) [-2464.125] -- 0:01:43
      519500 -- (-2462.023) (-2463.411) (-2462.054) [-2464.952] * (-2466.153) (-2470.146) [-2461.150] (-2469.692) -- 0:01:43
      520000 -- (-2467.831) [-2461.348] (-2467.356) (-2462.133) * [-2467.971] (-2464.085) (-2466.777) (-2466.869) -- 0:01:43

      Average standard deviation of split frequencies: 0.001358

      520500 -- [-2467.575] (-2465.614) (-2469.275) (-2462.943) * (-2466.389) [-2462.983] (-2464.946) (-2479.443) -- 0:01:43
      521000 -- (-2461.389) (-2463.360) (-2467.622) [-2464.753] * (-2472.964) (-2460.374) [-2466.995] (-2468.193) -- 0:01:42
      521500 -- [-2464.060] (-2463.967) (-2467.074) (-2461.486) * [-2472.355] (-2461.938) (-2467.542) (-2466.532) -- 0:01:42
      522000 -- (-2460.096) (-2462.375) [-2463.728] (-2464.094) * [-2460.989] (-2461.119) (-2460.688) (-2467.100) -- 0:01:42
      522500 -- (-2467.107) (-2460.659) [-2456.998] (-2462.091) * [-2461.477] (-2470.209) (-2470.537) (-2466.368) -- 0:01:43
      523000 -- (-2468.453) (-2465.991) [-2462.212] (-2459.261) * (-2462.553) (-2463.444) [-2463.849] (-2467.023) -- 0:01:43
      523500 -- (-2470.701) [-2458.263] (-2458.125) (-2470.892) * (-2462.076) (-2466.233) (-2462.546) [-2459.461] -- 0:01:42
      524000 -- (-2462.289) (-2463.875) [-2461.140] (-2465.294) * (-2471.068) (-2457.446) (-2469.248) [-2460.679] -- 0:01:42
      524500 -- (-2465.093) (-2468.461) [-2460.164] (-2473.342) * (-2469.322) (-2458.841) (-2465.831) [-2462.808] -- 0:01:42
      525000 -- (-2468.653) [-2462.717] (-2465.463) (-2468.963) * (-2459.000) (-2459.357) (-2461.608) [-2459.309] -- 0:01:42

      Average standard deviation of split frequencies: 0.001344

      525500 -- (-2475.736) (-2462.040) [-2461.699] (-2459.428) * [-2467.855] (-2462.379) (-2464.654) (-2461.544) -- 0:01:42
      526000 -- (-2466.398) (-2467.934) (-2464.703) [-2469.034] * [-2460.265] (-2458.508) (-2462.412) (-2465.594) -- 0:01:41
      526500 -- (-2466.788) (-2465.371) [-2457.557] (-2461.377) * (-2456.829) [-2459.720] (-2459.535) (-2464.620) -- 0:01:41
      527000 -- [-2468.695] (-2465.784) (-2459.258) (-2462.624) * (-2460.143) [-2461.634] (-2462.082) (-2462.148) -- 0:01:42
      527500 -- (-2463.906) (-2467.905) [-2462.923] (-2466.887) * (-2459.001) [-2459.741] (-2463.420) (-2460.219) -- 0:01:42
      528000 -- (-2461.864) [-2458.267] (-2465.782) (-2462.626) * (-2465.526) (-2461.090) [-2464.215] (-2456.603) -- 0:01:41
      528500 -- [-2459.295] (-2459.009) (-2465.566) (-2471.482) * (-2473.565) (-2467.367) [-2463.122] (-2465.654) -- 0:01:41
      529000 -- (-2462.344) (-2469.790) [-2460.009] (-2458.433) * (-2461.365) (-2465.366) (-2461.551) [-2461.568] -- 0:01:41
      529500 -- [-2465.021] (-2464.041) (-2460.641) (-2460.932) * [-2459.127] (-2463.073) (-2465.011) (-2461.727) -- 0:01:41
      530000 -- [-2458.380] (-2469.762) (-2470.290) (-2463.090) * (-2463.383) (-2459.665) (-2459.334) [-2460.414] -- 0:01:41

      Average standard deviation of split frequencies: 0.001777

      530500 -- (-2468.789) (-2462.725) (-2473.093) [-2457.783] * (-2463.572) (-2468.013) [-2458.893] (-2463.505) -- 0:01:40
      531000 -- [-2463.096] (-2463.067) (-2471.484) (-2462.754) * (-2465.691) [-2462.528] (-2459.795) (-2462.558) -- 0:01:40
      531500 -- (-2458.326) [-2460.632] (-2466.970) (-2459.079) * (-2465.232) (-2466.514) (-2466.186) [-2463.327] -- 0:01:40
      532000 -- [-2461.133] (-2466.729) (-2462.928) (-2467.204) * [-2466.111] (-2465.582) (-2465.843) (-2463.695) -- 0:01:41
      532500 -- (-2469.461) (-2459.311) (-2463.579) [-2463.117] * (-2466.272) (-2463.557) (-2465.210) [-2468.247] -- 0:01:40
      533000 -- (-2464.390) (-2461.876) [-2465.892] (-2461.618) * [-2460.366] (-2464.802) (-2464.038) (-2461.759) -- 0:01:40
      533500 -- (-2465.437) (-2456.980) [-2462.694] (-2466.270) * (-2465.765) (-2463.397) [-2462.785] (-2466.105) -- 0:01:40
      534000 -- (-2470.396) (-2458.352) (-2460.204) [-2459.461] * (-2464.665) [-2463.064] (-2465.863) (-2459.666) -- 0:01:40
      534500 -- (-2467.942) (-2462.512) [-2472.229] (-2458.875) * (-2471.670) (-2466.020) [-2461.981] (-2463.475) -- 0:01:40
      535000 -- (-2481.828) (-2461.394) (-2464.527) [-2463.264] * (-2468.260) (-2467.267) (-2467.467) [-2465.608] -- 0:01:39

      Average standard deviation of split frequencies: 0.002638

      535500 -- (-2472.395) (-2462.610) (-2460.643) [-2467.303] * [-2459.706] (-2466.863) (-2467.588) (-2461.856) -- 0:01:39
      536000 -- (-2467.151) (-2468.614) (-2466.797) [-2461.379] * (-2461.133) [-2464.177] (-2465.885) (-2463.074) -- 0:01:39
      536500 -- (-2467.943) (-2461.047) (-2461.543) [-2465.603] * (-2462.254) [-2460.676] (-2465.630) (-2460.084) -- 0:01:40
      537000 -- (-2465.026) (-2465.679) (-2470.864) [-2460.738] * [-2467.435] (-2461.432) (-2462.705) (-2462.043) -- 0:01:40
      537500 -- [-2466.163] (-2462.220) (-2468.104) (-2458.294) * (-2461.394) [-2460.463] (-2461.574) (-2464.317) -- 0:01:39
      538000 -- (-2461.415) [-2463.776] (-2464.109) (-2460.869) * (-2462.111) (-2461.967) [-2457.803] (-2460.543) -- 0:01:39
      538500 -- (-2458.657) (-2472.042) [-2462.489] (-2463.027) * (-2463.507) (-2459.500) (-2465.229) [-2461.664] -- 0:01:39
      539000 -- (-2467.257) (-2459.082) [-2466.205] (-2461.382) * (-2463.683) [-2462.608] (-2460.915) (-2467.762) -- 0:01:39
      539500 -- (-2462.275) [-2465.743] (-2463.695) (-2469.013) * [-2461.972] (-2468.108) (-2462.132) (-2458.150) -- 0:01:39
      540000 -- (-2459.793) [-2460.555] (-2465.768) (-2466.059) * (-2461.138) (-2462.441) [-2462.908] (-2459.308) -- 0:01:38

      Average standard deviation of split frequencies: 0.002180

      540500 -- [-2464.759] (-2464.861) (-2470.449) (-2468.459) * [-2462.903] (-2465.681) (-2465.709) (-2461.201) -- 0:01:38
      541000 -- (-2468.619) [-2458.902] (-2464.663) (-2463.859) * [-2457.925] (-2459.709) (-2469.849) (-2461.424) -- 0:01:39
      541500 -- (-2465.569) (-2463.914) [-2463.401] (-2463.856) * (-2467.883) [-2462.288] (-2463.353) (-2463.643) -- 0:01:39
      542000 -- (-2468.743) (-2464.348) (-2470.293) [-2464.036] * [-2461.555] (-2460.704) (-2460.387) (-2463.063) -- 0:01:38
      542500 -- (-2467.099) [-2462.577] (-2466.003) (-2465.148) * [-2462.592] (-2466.849) (-2460.335) (-2467.464) -- 0:01:38
      543000 -- (-2461.935) (-2468.857) (-2464.000) [-2462.914] * (-2471.250) (-2464.421) [-2461.331] (-2474.454) -- 0:01:38
      543500 -- (-2464.102) [-2463.758] (-2457.442) (-2463.268) * (-2467.299) [-2460.785] (-2461.807) (-2468.204) -- 0:01:38
      544000 -- (-2465.305) (-2468.730) [-2460.855] (-2461.994) * (-2468.283) [-2462.333] (-2474.404) (-2470.748) -- 0:01:38
      544500 -- (-2465.692) (-2468.778) (-2469.757) [-2464.971] * (-2460.609) (-2463.202) [-2464.317] (-2467.195) -- 0:01:37
      545000 -- (-2462.265) [-2458.873] (-2461.511) (-2456.536) * (-2464.043) (-2458.793) [-2467.648] (-2471.318) -- 0:01:37

      Average standard deviation of split frequencies: 0.001727

      545500 -- (-2458.111) (-2463.625) [-2459.963] (-2469.479) * (-2463.347) [-2462.219] (-2465.709) (-2472.331) -- 0:01:37
      546000 -- (-2464.900) (-2459.482) (-2465.834) [-2459.115] * (-2476.726) [-2458.601] (-2460.755) (-2466.476) -- 0:01:38
      546500 -- [-2461.165] (-2466.107) (-2472.929) (-2460.792) * [-2463.083] (-2463.924) (-2464.375) (-2466.426) -- 0:01:37
      547000 -- (-2470.333) (-2460.319) (-2463.177) [-2457.012] * [-2461.146] (-2460.619) (-2466.560) (-2464.993) -- 0:01:37
      547500 -- [-2464.751] (-2463.271) (-2465.202) (-2463.409) * [-2460.782] (-2465.036) (-2462.362) (-2463.578) -- 0:01:37
      548000 -- (-2468.906) (-2462.886) [-2463.407] (-2465.733) * (-2462.793) (-2473.376) [-2463.584] (-2459.986) -- 0:01:37
      548500 -- [-2465.780] (-2458.426) (-2465.190) (-2467.510) * (-2466.050) [-2464.444] (-2461.465) (-2469.113) -- 0:01:37
      549000 -- [-2464.542] (-2463.156) (-2469.400) (-2471.097) * (-2466.227) (-2470.405) (-2461.088) [-2465.344] -- 0:01:36
      549500 -- (-2458.425) (-2472.379) (-2465.357) [-2463.124] * (-2462.521) (-2468.448) (-2464.699) [-2458.639] -- 0:01:36
      550000 -- (-2463.722) (-2467.634) [-2458.269] (-2464.656) * (-2464.472) [-2468.371] (-2463.612) (-2463.165) -- 0:01:36

      Average standard deviation of split frequencies: 0.001712

      550500 -- (-2474.523) [-2462.097] (-2460.559) (-2469.059) * (-2464.444) (-2463.562) [-2462.644] (-2469.072) -- 0:01:37
      551000 -- (-2470.552) (-2469.944) (-2465.695) [-2461.317] * (-2466.617) (-2471.054) (-2467.233) [-2456.757] -- 0:01:36
      551500 -- [-2466.509] (-2458.462) (-2461.646) (-2460.979) * (-2461.314) [-2462.553] (-2459.167) (-2458.276) -- 0:01:36
      552000 -- (-2463.249) (-2473.237) [-2464.415] (-2464.429) * (-2457.837) (-2463.106) (-2462.877) [-2463.349] -- 0:01:36
      552500 -- (-2463.693) (-2462.860) (-2467.724) [-2465.794] * (-2469.685) [-2460.640] (-2459.865) (-2462.004) -- 0:01:36
      553000 -- [-2468.599] (-2465.314) (-2460.548) (-2466.136) * (-2464.787) [-2462.656] (-2461.161) (-2459.809) -- 0:01:36
      553500 -- (-2463.333) (-2464.722) (-2470.077) [-2460.745] * [-2458.830] (-2469.544) (-2463.446) (-2463.300) -- 0:01:35
      554000 -- (-2466.159) (-2463.907) (-2466.764) [-2463.414] * (-2466.588) (-2464.298) (-2468.539) [-2467.905] -- 0:01:35
      554500 -- [-2463.831] (-2470.905) (-2464.008) (-2463.019) * [-2461.256] (-2469.334) (-2467.094) (-2459.838) -- 0:01:35
      555000 -- (-2466.097) (-2465.771) [-2464.146] (-2466.666) * [-2465.671] (-2469.102) (-2474.629) (-2457.332) -- 0:01:35

      Average standard deviation of split frequencies: 0.002120

      555500 -- [-2466.719] (-2466.647) (-2462.230) (-2464.260) * (-2466.136) [-2471.584] (-2463.054) (-2459.205) -- 0:01:36
      556000 -- [-2462.308] (-2471.867) (-2467.759) (-2465.239) * (-2466.627) (-2470.018) [-2466.579] (-2457.434) -- 0:01:35
      556500 -- (-2461.748) [-2461.593] (-2464.293) (-2469.570) * (-2467.543) (-2466.603) (-2468.815) [-2458.684] -- 0:01:35
      557000 -- [-2464.388] (-2463.108) (-2463.177) (-2470.240) * [-2462.282] (-2463.539) (-2471.459) (-2465.168) -- 0:01:35
      557500 -- [-2461.715] (-2465.223) (-2465.199) (-2463.768) * [-2466.113] (-2460.329) (-2469.205) (-2466.225) -- 0:01:35
      558000 -- (-2461.316) (-2465.016) (-2468.146) [-2462.965] * (-2460.083) (-2459.311) [-2463.010] (-2466.978) -- 0:01:35
      558500 -- (-2463.781) (-2461.370) (-2468.316) [-2464.561] * (-2462.891) (-2462.103) (-2462.316) [-2467.908] -- 0:01:34
      559000 -- (-2477.539) (-2462.431) (-2462.778) [-2465.615] * (-2464.874) (-2458.232) [-2469.867] (-2461.573) -- 0:01:34
      559500 -- (-2459.700) (-2465.815) (-2462.826) [-2469.050] * (-2458.911) (-2462.414) [-2458.065] (-2459.939) -- 0:01:34
      560000 -- [-2462.362] (-2472.971) (-2458.976) (-2460.790) * [-2458.280] (-2463.557) (-2461.427) (-2468.411) -- 0:01:35

      Average standard deviation of split frequencies: 0.001261

      560500 -- (-2463.217) (-2458.955) (-2466.601) [-2461.386] * (-2472.494) (-2463.411) [-2463.508] (-2464.221) -- 0:01:34
      561000 -- (-2464.205) [-2462.723] (-2461.231) (-2460.158) * (-2457.765) [-2465.406] (-2465.242) (-2468.845) -- 0:01:34
      561500 -- (-2466.847) (-2468.218) [-2467.052] (-2460.799) * (-2462.777) [-2463.261] (-2461.333) (-2473.892) -- 0:01:34
      562000 -- (-2464.916) (-2462.960) (-2468.416) [-2466.024] * [-2469.067] (-2461.395) (-2465.599) (-2462.317) -- 0:01:34
      562500 -- [-2464.939] (-2462.900) (-2472.014) (-2464.082) * (-2465.763) [-2463.759] (-2465.125) (-2459.416) -- 0:01:34
      563000 -- (-2459.074) [-2455.927] (-2465.266) (-2461.652) * [-2456.751] (-2464.136) (-2462.230) (-2458.923) -- 0:01:33
      563500 -- [-2459.909] (-2464.502) (-2464.562) (-2461.668) * (-2462.753) (-2462.571) (-2462.132) [-2462.789] -- 0:01:33
      564000 -- (-2463.954) (-2458.425) [-2465.005] (-2463.329) * [-2464.773] (-2463.842) (-2470.761) (-2469.086) -- 0:01:33
      564500 -- (-2463.496) (-2466.656) [-2464.166] (-2459.366) * (-2460.639) (-2467.264) [-2461.584] (-2463.967) -- 0:01:34
      565000 -- [-2461.379] (-2464.724) (-2458.664) (-2462.955) * (-2462.077) [-2458.095] (-2467.576) (-2468.862) -- 0:01:33

      Average standard deviation of split frequencies: 0.000833

      565500 -- (-2466.144) (-2464.935) (-2469.823) [-2460.920] * (-2462.264) [-2464.213] (-2467.497) (-2463.426) -- 0:01:33
      566000 -- (-2470.359) (-2463.844) [-2468.854] (-2463.179) * (-2462.879) (-2471.742) [-2461.984] (-2459.574) -- 0:01:33
      566500 -- (-2465.407) (-2459.800) (-2470.627) [-2460.368] * (-2463.049) (-2469.034) [-2464.430] (-2463.648) -- 0:01:33
      567000 -- (-2466.874) (-2460.236) (-2462.386) [-2460.599] * (-2465.238) (-2465.485) (-2467.595) [-2461.888] -- 0:01:33
      567500 -- [-2462.500] (-2462.204) (-2468.122) (-2458.019) * (-2462.644) (-2468.615) [-2463.356] (-2458.698) -- 0:01:32
      568000 -- (-2462.197) (-2458.161) (-2461.736) [-2460.531] * [-2459.645] (-2474.899) (-2465.763) (-2468.587) -- 0:01:32
      568500 -- (-2464.340) (-2460.654) (-2460.908) [-2469.153] * (-2475.641) (-2462.926) [-2461.222] (-2470.236) -- 0:01:32
      569000 -- (-2471.400) [-2466.568] (-2462.402) (-2462.486) * (-2462.107) [-2460.666] (-2464.892) (-2462.967) -- 0:01:32
      569500 -- (-2467.551) (-2467.449) [-2464.925] (-2465.541) * [-2465.457] (-2470.551) (-2467.184) (-2462.809) -- 0:01:32
      570000 -- (-2465.267) (-2466.407) (-2467.894) [-2469.404] * [-2468.121] (-2474.720) (-2469.167) (-2462.291) -- 0:01:32

      Average standard deviation of split frequencies: 0.001652

      570500 -- [-2460.647] (-2466.690) (-2467.612) (-2459.998) * (-2460.878) (-2467.794) (-2468.205) [-2464.246] -- 0:01:32
      571000 -- (-2462.723) (-2460.301) [-2460.957] (-2459.523) * (-2463.595) (-2463.985) (-2465.790) [-2467.399] -- 0:01:32
      571500 -- (-2462.155) (-2463.562) (-2459.970) [-2460.606] * [-2463.067] (-2459.488) (-2469.822) (-2462.861) -- 0:01:32
      572000 -- (-2469.127) (-2463.873) [-2463.242] (-2462.958) * [-2460.525] (-2463.407) (-2467.480) (-2467.833) -- 0:01:32
      572500 -- (-2462.466) (-2469.462) [-2461.249] (-2463.482) * (-2461.715) [-2460.485] (-2463.573) (-2466.749) -- 0:01:31