--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 09 21:08:53 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/Zasp66-PJ/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1471.16 -1490.39
2 -1470.48 -1495.08
--------------------------------------
TOTAL -1470.77 -1494.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.403169 0.008361 0.244051 0.582413 0.392317 1337.32 1419.16 1.000
r(A<->C){all} 0.038332 0.000385 0.002582 0.074501 0.035372 810.84 914.61 1.000
r(A<->G){all} 0.273954 0.005556 0.140000 0.422116 0.269295 603.38 631.21 1.000
r(A<->T){all} 0.117096 0.002359 0.025616 0.208425 0.111109 617.58 707.69 1.000
r(C<->G){all} 0.016841 0.000199 0.000025 0.043797 0.013573 697.55 1045.66 1.003
r(C<->T){all} 0.329072 0.006110 0.183904 0.490241 0.323133 420.15 491.99 1.000
r(G<->T){all} 0.224705 0.004705 0.097021 0.361446 0.218151 546.30 548.83 1.000
pi(A){all} 0.282464 0.000273 0.251466 0.315721 0.282592 848.48 967.22 1.000
pi(C){all} 0.311878 0.000292 0.279574 0.345157 0.311299 1317.17 1322.66 1.000
pi(G){all} 0.225431 0.000233 0.195145 0.253978 0.224970 1186.47 1191.87 1.000
pi(T){all} 0.180226 0.000198 0.152509 0.207730 0.179871 1235.00 1254.41 1.000
alpha{1,2} 0.134427 0.001056 0.077437 0.195588 0.129330 1107.56 1273.70 1.000
alpha{3} 1.864624 0.511070 0.725502 3.373885 1.747059 1156.47 1302.96 1.000
pinvar{all} 0.753254 0.001375 0.680777 0.822836 0.756370 1348.77 1408.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1421.59398
Model 2: PositiveSelection -1421.59398
Model 0: one-ratio -1425.53985
Model 3: discrete -1420.990276
Model 7: beta -1421.138297
Model 8: beta&w>1 -1421.138308
Model 0 vs 1 7.891739999999572
Model 2 vs 1 0.0
Model 8 vs 7 2.2000000171829015E-5
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=239
C1 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C2 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C3 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C4 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C5 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C6 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C7 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
C8 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C9 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C10 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C11 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
************************************************:*
C1 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C2 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C3 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C4 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C5 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C6 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C7 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C8 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C9 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
C10 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C11 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
**************************************:***********
C1 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C2 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C3 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C4 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C5 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV
C6 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C7 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C8 NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
C9 NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV
C10 NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV
C11 NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV
********* ***************:****::********:******:**
C1 QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C2 QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C3 QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C4 QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C5 QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C6 QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C7 QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C8 QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C9 QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
C10 QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP
C11 QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP
*******:************.**:::**********:*************
C1 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C2 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C3 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C4 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C5 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C6 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C7 ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C8 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C9 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C10 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
C11 VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
.**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 239 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 239 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26290]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [26290]--->[26290]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.615 Mb, Max= 31.338 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
FORMAT of file /tmp/tmp2485967744140362910aln Not Supported[FATAL:T-COFFEE]
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:239 S:100 BS:239
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 99.58 C1 C4 99.58
TOP 3 0 99.58 C4 C1 99.58
BOT 0 4 99.58 C1 C5 99.58
TOP 4 0 99.58 C5 C1 99.58
BOT 0 5 99.58 C1 C6 99.58
TOP 5 0 99.58 C6 C1 99.58
BOT 0 6 98.74 C1 C7 98.74
TOP 6 0 98.74 C7 C1 98.74
BOT 0 7 98.74 C1 C8 98.74
TOP 7 0 98.74 C8 C1 98.74
BOT 0 8 98.74 C1 C9 98.74
TOP 8 0 98.74 C9 C1 98.74
BOT 0 9 97.49 C1 C10 97.49
TOP 9 0 97.49 C10 C1 97.49
BOT 0 10 98.33 C1 C11 98.33
TOP 10 0 98.33 C11 C1 98.33
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 99.58 C2 C4 99.58
TOP 3 1 99.58 C4 C2 99.58
BOT 1 4 99.58 C2 C5 99.58
TOP 4 1 99.58 C5 C2 99.58
BOT 1 5 99.58 C2 C6 99.58
TOP 5 1 99.58 C6 C2 99.58
BOT 1 6 98.74 C2 C7 98.74
TOP 6 1 98.74 C7 C2 98.74
BOT 1 7 98.74 C2 C8 98.74
TOP 7 1 98.74 C8 C2 98.74
BOT 1 8 98.74 C2 C9 98.74
TOP 8 1 98.74 C9 C2 98.74
BOT 1 9 97.49 C2 C10 97.49
TOP 9 1 97.49 C10 C2 97.49
BOT 1 10 98.33 C2 C11 98.33
TOP 10 1 98.33 C11 C2 98.33
BOT 2 3 99.58 C3 C4 99.58
TOP 3 2 99.58 C4 C3 99.58
BOT 2 4 99.58 C3 C5 99.58
TOP 4 2 99.58 C5 C3 99.58
BOT 2 5 99.58 C3 C6 99.58
TOP 5 2 99.58 C6 C3 99.58
BOT 2 6 98.74 C3 C7 98.74
TOP 6 2 98.74 C7 C3 98.74
BOT 2 7 98.74 C3 C8 98.74
TOP 7 2 98.74 C8 C3 98.74
BOT 2 8 98.74 C3 C9 98.74
TOP 8 2 98.74 C9 C3 98.74
BOT 2 9 97.49 C3 C10 97.49
TOP 9 2 97.49 C10 C3 97.49
BOT 2 10 98.33 C3 C11 98.33
TOP 10 2 98.33 C11 C3 98.33
BOT 3 4 99.16 C4 C5 99.16
TOP 4 3 99.16 C5 C4 99.16
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 99.16 C4 C7 99.16
TOP 6 3 99.16 C7 C4 99.16
BOT 3 7 99.16 C4 C8 99.16
TOP 7 3 99.16 C8 C4 99.16
BOT 3 8 98.33 C4 C9 98.33
TOP 8 3 98.33 C9 C4 98.33
BOT 3 9 97.91 C4 C10 97.91
TOP 9 3 97.91 C10 C4 97.91
BOT 3 10 98.74 C4 C11 98.74
TOP 10 3 98.74 C11 C4 98.74
BOT 4 5 99.16 C5 C6 99.16
TOP 5 4 99.16 C6 C5 99.16
BOT 4 6 98.33 C5 C7 98.33
TOP 6 4 98.33 C7 C5 98.33
BOT 4 7 98.33 C5 C8 98.33
TOP 7 4 98.33 C8 C5 98.33
BOT 4 8 98.33 C5 C9 98.33
TOP 8 4 98.33 C9 C5 98.33
BOT 4 9 97.07 C5 C10 97.07
TOP 9 4 97.07 C10 C5 97.07
BOT 4 10 97.91 C5 C11 97.91
TOP 10 4 97.91 C11 C5 97.91
BOT 5 6 99.16 C6 C7 99.16
TOP 6 5 99.16 C7 C6 99.16
BOT 5 7 99.16 C6 C8 99.16
TOP 7 5 99.16 C8 C6 99.16
BOT 5 8 98.33 C6 C9 98.33
TOP 8 5 98.33 C9 C6 98.33
BOT 5 9 97.91 C6 C10 97.91
TOP 9 5 97.91 C10 C6 97.91
BOT 5 10 98.74 C6 C11 98.74
TOP 10 5 98.74 C11 C6 98.74
BOT 6 7 98.33 C7 C8 98.33
TOP 7 6 98.33 C8 C7 98.33
BOT 6 8 97.49 C7 C9 97.49
TOP 8 6 97.49 C9 C7 97.49
BOT 6 9 97.07 C7 C10 97.07
TOP 9 6 97.07 C10 C7 97.07
BOT 6 10 97.91 C7 C11 97.91
TOP 10 6 97.91 C11 C7 97.91
BOT 7 8 97.91 C8 C9 97.91
TOP 8 7 97.91 C9 C8 97.91
BOT 7 9 97.07 C8 C10 97.07
TOP 9 7 97.07 C10 C8 97.07
BOT 7 10 97.91 C8 C11 97.91
TOP 10 7 97.91 C11 C8 97.91
BOT 8 9 96.23 C9 C10 96.23
TOP 9 8 96.23 C10 C9 96.23
BOT 8 10 97.07 C9 C11 97.07
TOP 10 8 97.07 C11 C9 97.07
BOT 9 10 97.49 C10 C11 97.49
TOP 10 9 97.49 C11 C10 97.49
AVG 0 C1 * 99.08
AVG 1 C2 * 99.08
AVG 2 C3 * 99.08
AVG 3 C4 * 99.12
AVG 4 C5 * 98.70
AVG 5 C6 * 99.12
AVG 6 C7 * 98.37
AVG 7 C8 * 98.41
AVG 8 C9 * 97.99
AVG 9 C10 * 97.32
AVG 10 C11 * 98.08
TOT TOT * 98.58
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C2 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C3 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C4 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C5 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C6 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C7 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C8 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C9 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA
C10 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA
C11 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
********************************:**************.**
C1 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C2 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C3 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C4 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C5 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C6 GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC
C7 GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC
C8 GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC
C9 GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC
C10 GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC
C11 GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC
********* *****.***** ***** ***** ***** ******** *
C1 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C2 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C3 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C4 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C5 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C6 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C7 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC
C8 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C9 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC
C10 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C11 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
******************************* ************** ***
C1 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C2 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C3 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C4 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C5 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C6 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C7 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C8 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA
C9 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C10 TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C11 TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA
************** ********.************** ***********
C1 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C2 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C3 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C4 CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
C5 CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
C6 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
C7 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
C8 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C9 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C10 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C11 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
*************************** ******** *************
C1 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C2 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C3 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C4 AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C5 AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C6 AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C7 AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C8 AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C9 AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC
C10 AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C11 AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
**** ******** ** ************** ******************
C1 AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C2 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C3 AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C4 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C5 AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
C6 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C7 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C8 AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG
C9 AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG
C10 AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
C11 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
******** ** *****.*********..*********************
C1 ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C2 ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C3 ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C4 ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C5 ATCCACAGTTCCCTTCGCCACGAGCGAAAGCAATCGCTTGAAGGAAAGTC
C6 ATCTACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C7 ATCAACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C8 ATCAACAGTTCCTTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
C9 ATCAACAGTTCCCTTCGCCACAAGCGACAGCAATCGCTTGAAGGACAGTC
C10 ATCAACAGTTCCCTTCGCCACGAGCGAAAGCAATCGCTTGAGGGACAGTC
C11 ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
*** ******** ********.*****.*************.***.****
C1 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
C2 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
C3 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGTTATAAGAAAACTGTC
C4 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
C5 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
C6 CTTTGCATCGTCCTTTGCCAACGAAACTTAACGGCTATAAGAAAACTGTC
C7 CTTTGCATCGTCCTTTGCCAACGAAACTTAACGGCTATAAGAAAACTGTC
C8 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
C9 CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
C10 CTCTGCATCGTCCTTTGCCAACGAAGCTTAACGGCTATAAGAAAACTGTC
C11 CTTTGCATCGTCCTTTGCCATCGAAACTTAACGGCTATAAGCAAACTGTC
** *****************:*.**.******** ******.********
C1 CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
C2 CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
C3 CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
C4 CAGTACGATCCCAGGAACAGCGACACCTACAGAGCCATTCAAGAAGAGGG
C5 CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
C6 CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
C7 CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
C8 CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAGGAGGG
C9 CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATCCAAGAGGAGGG
C10 CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
C11 CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
*********************** ************** *****.*****
C1 CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
C2 CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
C3 CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
C4 CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
C5 CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
C6 CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG
C7 CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG
C8 CGGCTACAGCAGCTATGGCCAATCCTCGCCACAGGAAGTAACCATTCCTG
C9 CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAGGTGACCATTCCTG
C10 CGGCTACAGCAACTACGGCAATGCCGCGCCACAGGAAGTAACCATACCTG
C11 CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG
***********.*** ***.* ** **********.**.*****:****
C1 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C2 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C3 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C4 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C5 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C6 TGCAGACTAAGGTCTATCAGCCGAATAGATTGGTTCCAGGAAAGAAACCA
C7 TGCAGACTAAGGTCTATCAGCCGAATAGATTGGTTCCAGGAAAGAAACCA
C8 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C9 TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C10 TGCAGACTAGGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
C11 TGCAGACTAGGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
*********.************ ***************************
C1 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C2 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCATGA
C3 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C4 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C5 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C6 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C7 GCTTCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C8 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C9 GTTTCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
C10 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCATGA
C11 GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
* :******************************************** **
C1 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA
C2 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA
C3 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA
C4 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
C5 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
C6 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTCA
C7 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
C8 CGAGAACATACGCCAGAGCGGCTCTTTCAATCGTCTCATGTACAGCGTTA
C9 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
C10 TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
C11 CGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
*********************** *********************** *
C1 TTGGTGCCACCGAGTAC
C2 TTGGTGCCACCGAGTAC
C3 TTGGTGCCACCGAGTAC
C4 TTGGTGCCACCGAGTAC
C5 TTGGTGCCACCGAGTAC
C6 TTGGTGCCACCGAGTAC
C7 TTGGTGCCACCGAGTAC
C8 TTGGTGCCACCGAGTAC
C9 TTGGTGCCACCGAGTAC
C10 TTGGTGCCACCGAATAC
C11 TTGGTGCCACCGAGTAC
*************.***
>C1
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA
TTGGTGCCACCGAGTAC
>C2
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCATGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA
TTGGTGCCACCGAGTAC
>C3
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGTTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA
TTGGTGCCACCGAGTAC
>C4
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGACACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAGTAC
>C5
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTTCGCCACGAGCGAAAGCAATCGCTTGAAGGAAAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAGTAC
>C6
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCTACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACGAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG
TGCAGACTAAGGTCTATCAGCCGAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTCA
TTGGTGCCACCGAGTAC
>C7
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCAACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACGAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG
TGCAGACTAAGGTCTATCAGCCGAATAGATTGGTTCCAGGAAAGAAACCA
GCTTCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAGTAC
>C8
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG
ATCAACAGTTCCTTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAGGAGGG
CGGCTACAGCAGCTATGGCCAATCCTCGCCACAGGAAGTAACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
CGAGAACATACGCCAGAGCGGCTCTTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAGTAC
>C9
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA
GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG
ATCAACAGTTCCCTTCGCCACAAGCGACAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATCCAAGAGGAGGG
CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAGGTGACCATTCCTG
TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTTTCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAGTAC
>C10
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA
GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
ATCAACAGTTCCCTTCGCCACGAGCGAAAGCAATCGCTTGAGGGACAGTC
CTCTGCATCGTCCTTTGCCAACGAAGCTTAACGGCTATAAGAAAACTGTC
CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTACGGCAATGCCGCGCCACAGGAAGTAACCATACCTG
TGCAGACTAGGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCATGA
TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAATAC
>C11
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC
CTTTGCATCGTCCTTTGCCATCGAAACTTAACGGCTATAAGCAAACTGTC
CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG
CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG
TGCAGACTAGGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA
GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA
CGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA
TTGGTGCCACCGAGTAC
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV
QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV
QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV
QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP
VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 717 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481317201
Setting output file names to "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 921469823
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3196902254
Seed = 1557665374
Swapseed = 1481317201
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 10 unique site patterns
Division 2 has 8 unique site patterns
Division 3 has 43 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2548.809459 -- -24.640631
Chain 2 -- -2570.651778 -- -24.640631
Chain 3 -- -2575.629449 -- -24.640631
Chain 4 -- -2583.350431 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2564.832807 -- -24.640631
Chain 2 -- -2567.238926 -- -24.640631
Chain 3 -- -2554.837237 -- -24.640631
Chain 4 -- -2573.015244 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2548.809] (-2570.652) (-2575.629) (-2583.350) * [-2564.833] (-2567.239) (-2554.837) (-2573.015)
500 -- (-1530.726) [-1525.280] (-1537.706) (-1559.945) * (-1527.066) [-1519.559] (-1521.271) (-1528.347) -- 0:00:00
1000 -- (-1499.806) [-1502.786] (-1519.105) (-1515.593) * (-1512.356) [-1494.446] (-1529.674) (-1508.871) -- 0:00:00
1500 -- (-1494.576) [-1505.860] (-1507.692) (-1512.030) * (-1501.597) [-1477.920] (-1507.142) (-1513.818) -- 0:11:05
2000 -- [-1491.209] (-1496.398) (-1500.198) (-1511.328) * [-1490.283] (-1486.363) (-1496.854) (-1499.315) -- 0:08:19
2500 -- (-1487.674) (-1495.968) [-1488.107] (-1491.443) * (-1487.229) [-1484.801] (-1499.802) (-1503.973) -- 0:06:39
3000 -- (-1493.639) (-1484.377) [-1481.192] (-1491.011) * (-1497.789) [-1469.193] (-1509.009) (-1490.492) -- 0:05:32
3500 -- [-1480.064] (-1485.897) (-1481.892) (-1492.264) * (-1484.342) [-1478.151] (-1506.613) (-1482.872) -- 0:04:44
4000 -- (-1481.625) (-1481.515) [-1481.548] (-1491.318) * (-1490.846) (-1480.430) (-1509.991) [-1482.164] -- 0:04:09
4500 -- (-1476.560) (-1480.640) [-1486.008] (-1482.686) * (-1483.981) (-1480.617) (-1486.397) [-1484.172] -- 0:03:41
5000 -- (-1488.799) (-1493.315) [-1474.024] (-1488.365) * [-1474.776] (-1485.466) (-1511.733) (-1479.328) -- 0:06:38
Average standard deviation of split frequencies: 0.096698
5500 -- (-1497.338) (-1480.604) (-1476.417) [-1481.301] * (-1482.097) [-1469.659] (-1505.253) (-1481.045) -- 0:06:01
6000 -- (-1484.006) [-1482.070] (-1478.213) (-1475.383) * [-1474.910] (-1484.300) (-1500.522) (-1488.197) -- 0:05:31
6500 -- (-1483.663) (-1483.598) [-1475.345] (-1472.771) * [-1479.030] (-1480.289) (-1492.208) (-1489.456) -- 0:05:05
7000 -- (-1482.455) (-1511.992) [-1472.752] (-1483.756) * (-1481.570) (-1494.455) [-1482.520] (-1488.363) -- 0:04:43
7500 -- (-1480.821) (-1485.949) [-1473.740] (-1482.145) * [-1474.274] (-1489.206) (-1485.532) (-1474.171) -- 0:04:24
8000 -- (-1487.820) (-1487.618) (-1493.900) [-1482.452] * (-1480.005) [-1479.665] (-1488.268) (-1494.626) -- 0:04:08
8500 -- (-1473.527) (-1477.733) [-1487.463] (-1471.898) * [-1482.397] (-1494.133) (-1480.161) (-1481.928) -- 0:03:53
9000 -- (-1480.688) [-1486.491] (-1483.424) (-1487.622) * (-1493.706) [-1491.228] (-1489.508) (-1487.868) -- 0:05:30
9500 -- (-1484.274) (-1480.290) (-1486.845) [-1483.941] * (-1482.625) (-1484.295) [-1479.510] (-1473.011) -- 0:05:12
10000 -- (-1494.393) [-1468.743] (-1492.761) (-1475.481) * (-1484.468) (-1486.685) (-1485.042) [-1484.513] -- 0:04:57
Average standard deviation of split frequencies: 0.077866
10500 -- (-1509.243) (-1483.819) (-1493.423) [-1480.975] * [-1484.209] (-1487.692) (-1486.522) (-1484.459) -- 0:04:42
11000 -- (-1485.144) (-1493.304) [-1485.010] (-1511.674) * [-1485.468] (-1489.597) (-1481.967) (-1482.621) -- 0:04:29
11500 -- [-1479.122] (-1492.899) (-1493.856) (-1497.271) * [-1480.856] (-1494.179) (-1502.270) (-1482.810) -- 0:04:17
12000 -- (-1478.242) (-1486.835) (-1485.047) [-1471.901] * [-1479.632] (-1490.715) (-1491.843) (-1488.687) -- 0:04:07
12500 -- (-1479.062) (-1485.486) [-1482.759] (-1493.801) * [-1478.880] (-1478.979) (-1487.140) (-1497.516) -- 0:05:16
13000 -- [-1478.863] (-1500.820) (-1490.238) (-1490.435) * [-1474.134] (-1488.576) (-1497.826) (-1484.864) -- 0:05:03
13500 -- [-1482.052] (-1475.823) (-1489.300) (-1478.552) * [-1472.148] (-1491.460) (-1490.779) (-1481.888) -- 0:04:52
14000 -- (-1487.050) (-1478.908) [-1484.257] (-1503.291) * (-1480.925) (-1481.451) (-1491.554) [-1474.963] -- 0:04:41
14500 -- (-1493.645) (-1502.536) (-1494.850) [-1491.074] * (-1478.340) (-1485.898) [-1476.210] (-1484.075) -- 0:04:31
15000 -- [-1480.149] (-1481.037) (-1475.073) (-1495.196) * (-1478.523) (-1480.723) [-1475.291] (-1499.741) -- 0:04:22
Average standard deviation of split frequencies: 0.073657
15500 -- (-1480.059) [-1472.412] (-1512.813) (-1488.045) * (-1482.336) [-1477.738] (-1478.596) (-1504.672) -- 0:04:14
16000 -- (-1477.890) [-1476.071] (-1502.486) (-1486.655) * (-1482.813) (-1476.499) [-1482.739] (-1495.013) -- 0:04:06
16500 -- (-1478.987) [-1472.575] (-1487.330) (-1480.901) * (-1488.951) [-1471.444] (-1479.702) (-1485.906) -- 0:04:58
17000 -- (-1504.296) [-1482.263] (-1501.851) (-1474.971) * [-1479.011] (-1480.196) (-1492.134) (-1486.428) -- 0:04:49
17500 -- (-1495.324) (-1495.427) (-1507.595) [-1480.846] * [-1475.698] (-1480.604) (-1492.202) (-1491.696) -- 0:04:40
18000 -- (-1498.990) (-1481.402) (-1487.143) [-1475.248] * (-1484.153) [-1471.571] (-1498.279) (-1487.763) -- 0:04:32
18500 -- (-1484.692) (-1485.848) (-1493.182) [-1485.757] * (-1482.370) [-1478.746] (-1489.036) (-1492.987) -- 0:04:25
19000 -- (-1487.740) [-1475.214] (-1488.098) (-1471.652) * (-1484.818) [-1489.455] (-1491.153) (-1489.866) -- 0:04:18
19500 -- [-1482.952] (-1480.545) (-1489.305) (-1487.509) * (-1489.956) (-1498.908) (-1476.544) [-1482.983] -- 0:04:11
20000 -- [-1488.940] (-1488.022) (-1491.964) (-1477.400) * (-1485.473) (-1489.864) [-1478.549] (-1484.586) -- 0:04:54
Average standard deviation of split frequencies: 0.061172
20500 -- (-1481.573) [-1479.153] (-1491.135) (-1481.615) * (-1492.970) (-1482.505) [-1484.382] (-1479.296) -- 0:04:46
21000 -- (-1478.162) (-1494.132) [-1489.913] (-1481.400) * (-1487.726) [-1483.703] (-1471.912) (-1493.723) -- 0:04:39
21500 -- (-1488.014) (-1478.173) [-1483.012] (-1485.428) * (-1494.753) (-1481.804) [-1477.605] (-1476.370) -- 0:04:33
22000 -- (-1493.864) (-1482.042) (-1477.918) [-1482.972] * (-1477.937) (-1481.861) (-1478.104) [-1476.619] -- 0:04:26
22500 -- (-1498.403) (-1472.135) (-1498.952) [-1482.238] * (-1479.556) (-1488.101) (-1480.751) [-1475.879] -- 0:04:20
23000 -- (-1472.729) (-1497.890) [-1482.222] (-1482.846) * (-1489.594) (-1487.709) [-1473.465] (-1481.998) -- 0:04:14
23500 -- (-1481.985) [-1483.985] (-1496.520) (-1492.824) * (-1495.717) (-1475.501) [-1479.710] (-1490.538) -- 0:04:09
24000 -- [-1477.987] (-1488.308) (-1480.227) (-1475.061) * (-1483.050) [-1484.608] (-1500.291) (-1490.967) -- 0:04:44
24500 -- (-1482.941) (-1488.887) (-1482.209) [-1473.630] * (-1487.555) (-1480.923) [-1485.285] (-1486.494) -- 0:04:38
25000 -- (-1492.488) (-1494.832) (-1476.349) [-1472.936] * [-1474.015] (-1469.882) (-1481.581) (-1495.061) -- 0:04:33
Average standard deviation of split frequencies: 0.055181
25500 -- (-1484.848) [-1475.712] (-1488.521) (-1482.860) * [-1483.730] (-1480.879) (-1498.444) (-1491.315) -- 0:04:27
26000 -- [-1478.310] (-1481.595) (-1486.606) (-1479.934) * (-1486.957) (-1488.691) (-1488.674) [-1482.606] -- 0:04:22
26500 -- (-1478.417) (-1480.261) [-1481.917] (-1478.766) * [-1489.603] (-1473.794) (-1491.595) (-1478.459) -- 0:04:17
27000 -- [-1470.787] (-1482.165) (-1493.488) (-1486.496) * [-1483.139] (-1488.622) (-1489.903) (-1483.882) -- 0:04:12
27500 -- (-1483.349) (-1485.637) (-1497.344) [-1481.912] * (-1493.394) (-1497.656) [-1483.484] (-1475.373) -- 0:04:42
28000 -- (-1488.791) (-1489.794) (-1489.373) [-1476.279] * (-1482.125) [-1475.285] (-1485.463) (-1479.339) -- 0:04:37
28500 -- (-1486.750) (-1475.781) (-1485.513) [-1471.066] * (-1482.905) (-1487.916) (-1479.567) [-1475.272] -- 0:04:32
29000 -- (-1488.963) (-1482.048) [-1479.331] (-1491.149) * (-1488.093) (-1483.078) (-1478.460) [-1470.440] -- 0:04:27
29500 -- (-1479.367) (-1488.836) [-1482.500] (-1480.721) * [-1483.124] (-1491.625) (-1485.348) (-1472.956) -- 0:04:23
30000 -- (-1478.658) (-1477.370) (-1474.017) [-1479.400] * (-1491.324) [-1481.128] (-1488.873) (-1479.498) -- 0:04:18
Average standard deviation of split frequencies: 0.046814
30500 -- [-1473.477] (-1490.896) (-1498.085) (-1497.880) * [-1479.298] (-1481.176) (-1483.453) (-1489.177) -- 0:04:14
31000 -- (-1477.868) [-1474.619] (-1489.125) (-1480.713) * (-1482.474) (-1481.700) [-1478.783] (-1487.114) -- 0:04:41
31500 -- (-1488.386) (-1488.256) (-1494.519) [-1480.780] * [-1478.266] (-1485.142) (-1478.971) (-1481.046) -- 0:04:36
32000 -- [-1488.342] (-1486.250) (-1508.476) (-1488.957) * (-1486.306) (-1479.349) [-1483.843] (-1488.883) -- 0:04:32
32500 -- (-1486.475) [-1473.989] (-1492.246) (-1480.647) * (-1479.512) [-1478.163] (-1482.464) (-1480.556) -- 0:04:27
33000 -- (-1495.926) [-1476.663] (-1499.443) (-1484.428) * (-1484.910) [-1479.336] (-1477.400) (-1466.996) -- 0:04:23
33500 -- (-1486.617) [-1476.694] (-1485.382) (-1478.273) * [-1473.794] (-1486.936) (-1481.434) (-1488.622) -- 0:04:19
34000 -- [-1482.281] (-1477.997) (-1482.245) (-1492.810) * (-1478.636) [-1478.480] (-1483.621) (-1510.581) -- 0:04:15
34500 -- (-1490.556) (-1491.211) [-1477.685] (-1493.311) * [-1476.342] (-1492.201) (-1487.910) (-1492.954) -- 0:04:11
35000 -- (-1484.216) (-1490.665) (-1493.820) [-1489.081] * (-1482.414) (-1478.364) (-1498.621) [-1472.899] -- 0:04:35
Average standard deviation of split frequencies: 0.041561
35500 -- [-1491.373] (-1506.822) (-1482.564) (-1487.806) * (-1486.303) [-1475.838] (-1488.279) (-1491.858) -- 0:04:31
36000 -- (-1482.312) [-1489.199] (-1489.378) (-1479.371) * (-1504.772) [-1475.216] (-1502.881) (-1497.155) -- 0:04:27
36500 -- (-1489.578) (-1484.272) [-1477.350] (-1474.382) * (-1494.411) [-1478.568] (-1499.756) (-1485.049) -- 0:04:23
37000 -- (-1489.264) (-1479.436) [-1472.038] (-1485.551) * [-1477.679] (-1476.262) (-1504.450) (-1488.305) -- 0:04:20
37500 -- (-1489.271) (-1478.714) [-1478.818] (-1475.003) * [-1485.186] (-1486.022) (-1484.848) (-1495.197) -- 0:04:16
38000 -- (-1481.604) (-1484.954) [-1488.380] (-1493.976) * (-1487.814) (-1482.037) [-1477.412] (-1482.728) -- 0:04:13
38500 -- (-1485.134) [-1476.584] (-1498.157) (-1491.261) * [-1485.452] (-1495.556) (-1495.528) (-1487.622) -- 0:04:34
39000 -- (-1476.332) (-1486.496) [-1478.508] (-1484.576) * (-1480.097) [-1488.357] (-1488.913) (-1475.013) -- 0:04:31
39500 -- [-1484.974] (-1488.136) (-1481.109) (-1479.852) * (-1489.780) (-1491.938) [-1485.153] (-1482.842) -- 0:04:27
40000 -- (-1483.365) (-1491.819) [-1475.962] (-1480.899) * [-1479.947] (-1481.639) (-1490.273) (-1485.206) -- 0:04:24
Average standard deviation of split frequencies: 0.038088
40500 -- (-1485.266) (-1483.168) (-1482.468) [-1475.171] * (-1478.370) (-1487.861) (-1486.652) [-1480.262] -- 0:04:20
41000 -- (-1482.214) (-1475.748) (-1481.434) [-1481.614] * (-1477.723) (-1479.772) (-1497.610) [-1478.380] -- 0:04:17
41500 -- (-1473.012) (-1480.538) (-1491.933) [-1474.842] * (-1478.407) [-1492.821] (-1487.284) (-1480.931) -- 0:04:14
42000 -- (-1481.464) (-1482.025) [-1475.935] (-1490.281) * (-1484.371) (-1486.778) [-1484.790] (-1484.233) -- 0:04:10
42500 -- (-1480.198) (-1487.840) [-1483.387] (-1472.859) * (-1484.723) (-1478.694) [-1486.200] (-1472.668) -- 0:04:30
43000 -- (-1495.537) (-1480.167) [-1470.899] (-1482.402) * (-1479.715) (-1490.381) (-1486.984) [-1476.770] -- 0:04:27
43500 -- [-1482.104] (-1475.843) (-1490.536) (-1495.943) * [-1475.601] (-1482.461) (-1509.325) (-1481.784) -- 0:04:23
44000 -- [-1479.701] (-1478.836) (-1483.718) (-1476.292) * [-1469.981] (-1479.467) (-1481.334) (-1494.227) -- 0:04:20
44500 -- (-1478.358) (-1479.829) (-1486.608) [-1477.209] * [-1477.540] (-1477.582) (-1491.476) (-1490.606) -- 0:04:17
45000 -- [-1472.247] (-1481.512) (-1495.498) (-1476.742) * [-1479.274] (-1476.596) (-1498.413) (-1497.089) -- 0:04:14
Average standard deviation of split frequencies: 0.041923
45500 -- [-1467.490] (-1480.120) (-1480.741) (-1489.128) * (-1480.967) (-1483.268) [-1479.599] (-1506.018) -- 0:04:11
46000 -- (-1472.739) (-1499.600) [-1480.433] (-1489.756) * (-1480.417) (-1481.602) (-1485.157) [-1488.580] -- 0:04:29
46500 -- [-1486.891] (-1500.979) (-1487.139) (-1489.338) * [-1480.747] (-1486.189) (-1488.223) (-1488.850) -- 0:04:26
47000 -- (-1490.649) [-1471.574] (-1479.701) (-1482.629) * [-1474.587] (-1479.820) (-1488.996) (-1490.872) -- 0:04:23
47500 -- (-1483.345) [-1484.439] (-1480.655) (-1479.494) * (-1485.985) (-1495.708) (-1490.393) [-1488.635] -- 0:04:20
48000 -- (-1493.421) [-1479.054] (-1490.799) (-1478.342) * (-1482.645) (-1499.463) (-1479.200) [-1473.416] -- 0:04:17
48500 -- (-1485.335) (-1504.345) [-1475.878] (-1477.980) * [-1483.818] (-1486.959) (-1486.067) (-1492.562) -- 0:04:15
49000 -- (-1484.954) (-1495.442) (-1475.263) [-1478.841] * (-1486.059) [-1474.981] (-1474.261) (-1480.530) -- 0:04:12
49500 -- [-1478.469] (-1492.224) (-1485.418) (-1488.204) * (-1478.297) [-1488.759] (-1482.030) (-1488.801) -- 0:04:09
50000 -- [-1475.996] (-1477.687) (-1485.116) (-1480.438) * [-1478.773] (-1485.639) (-1473.443) (-1491.286) -- 0:04:26
Average standard deviation of split frequencies: 0.038545
50500 -- [-1481.162] (-1481.488) (-1472.510) (-1495.124) * (-1485.810) (-1490.036) (-1475.482) [-1472.179] -- 0:04:23
51000 -- (-1479.803) (-1480.259) [-1475.468] (-1488.775) * (-1479.843) (-1486.400) [-1474.899] (-1471.290) -- 0:04:20
51500 -- (-1479.072) (-1479.136) [-1476.712] (-1494.193) * (-1499.678) (-1481.965) (-1486.321) [-1473.787] -- 0:04:17
52000 -- (-1489.698) [-1475.210] (-1482.551) (-1495.725) * (-1497.168) [-1480.679] (-1480.337) (-1492.585) -- 0:04:15
52500 -- (-1481.542) (-1493.877) [-1482.046] (-1484.373) * (-1496.006) (-1484.219) (-1482.668) [-1478.937] -- 0:04:12
53000 -- (-1488.778) (-1483.537) [-1473.115] (-1479.939) * (-1492.313) [-1476.049] (-1479.009) (-1486.755) -- 0:04:10
53500 -- (-1479.942) (-1484.780) [-1484.357] (-1486.022) * (-1478.396) [-1482.051] (-1474.714) (-1497.989) -- 0:04:25
54000 -- [-1483.234] (-1480.985) (-1488.117) (-1484.725) * (-1474.141) [-1480.849] (-1481.334) (-1489.263) -- 0:04:22
54500 -- [-1479.793] (-1491.512) (-1486.488) (-1492.764) * (-1478.566) [-1477.717] (-1491.242) (-1493.731) -- 0:04:20
55000 -- (-1481.244) (-1489.749) [-1476.768] (-1492.548) * (-1485.919) (-1475.059) [-1476.475] (-1490.001) -- 0:04:17
Average standard deviation of split frequencies: 0.030064
55500 -- [-1485.888] (-1477.514) (-1485.599) (-1485.889) * (-1485.647) [-1475.165] (-1494.322) (-1474.517) -- 0:04:15
56000 -- (-1481.396) (-1475.281) (-1495.694) [-1480.457] * (-1494.210) (-1477.064) [-1478.309] (-1483.130) -- 0:04:12
56500 -- (-1472.417) (-1484.122) [-1486.073] (-1488.417) * (-1492.490) (-1490.208) (-1473.393) [-1476.724] -- 0:04:10
57000 -- (-1475.002) (-1491.134) [-1478.357] (-1488.600) * [-1488.226] (-1484.281) (-1484.204) (-1482.005) -- 0:04:08
57500 -- (-1474.672) (-1485.916) [-1480.715] (-1506.507) * (-1492.222) [-1476.635] (-1475.240) (-1478.071) -- 0:04:22
58000 -- [-1473.634] (-1479.643) (-1487.127) (-1489.157) * (-1495.550) (-1487.995) [-1476.705] (-1479.057) -- 0:04:19
58500 -- [-1476.956] (-1478.407) (-1483.966) (-1485.292) * (-1488.571) (-1474.886) (-1485.213) [-1479.754] -- 0:04:17
59000 -- [-1475.471] (-1478.893) (-1492.030) (-1479.366) * (-1494.613) [-1480.450] (-1480.960) (-1489.168) -- 0:04:15
59500 -- (-1482.162) (-1490.190) (-1478.226) [-1478.344] * (-1497.990) (-1481.947) [-1485.569] (-1494.035) -- 0:04:12
60000 -- (-1501.641) [-1479.534] (-1474.541) (-1494.398) * (-1487.292) [-1488.818] (-1500.076) (-1485.842) -- 0:04:10
Average standard deviation of split frequencies: 0.030673
60500 -- (-1485.639) (-1485.543) [-1477.036] (-1478.133) * (-1486.116) [-1473.806] (-1504.199) (-1478.043) -- 0:04:08
61000 -- (-1494.260) (-1500.462) [-1477.322] (-1485.732) * (-1498.652) (-1484.388) (-1482.447) [-1482.965] -- 0:04:21
61500 -- (-1482.962) (-1484.802) (-1496.798) [-1478.454] * (-1482.567) (-1487.340) (-1502.035) [-1473.728] -- 0:04:19
62000 -- (-1474.924) (-1487.846) (-1512.184) [-1473.733] * (-1484.589) (-1500.018) (-1482.850) [-1476.527] -- 0:04:17
62500 -- (-1484.954) (-1486.352) [-1471.205] (-1492.602) * (-1475.437) [-1480.948] (-1486.502) (-1495.351) -- 0:04:15
63000 -- (-1472.298) (-1475.399) (-1482.529) [-1474.515] * (-1483.967) [-1482.809] (-1486.280) (-1484.635) -- 0:04:12
63500 -- (-1483.574) (-1475.316) [-1469.837] (-1488.472) * (-1494.519) (-1481.317) (-1493.651) [-1481.710] -- 0:04:10
64000 -- (-1487.449) (-1497.548) [-1471.270] (-1491.690) * [-1477.340] (-1481.440) (-1475.679) (-1491.864) -- 0:04:08
64500 -- (-1477.861) (-1486.105) (-1478.734) [-1485.533] * (-1491.892) (-1473.394) (-1488.228) [-1485.793] -- 0:04:21
65000 -- (-1494.856) (-1477.786) [-1476.742] (-1491.974) * (-1489.584) [-1481.436] (-1471.807) (-1495.073) -- 0:04:18
Average standard deviation of split frequencies: 0.033570
65500 -- (-1486.693) [-1480.013] (-1480.796) (-1479.595) * (-1490.965) (-1488.646) [-1471.935] (-1489.520) -- 0:04:16
66000 -- [-1489.105] (-1482.130) (-1480.047) (-1473.565) * (-1488.180) [-1480.946] (-1470.182) (-1490.463) -- 0:04:14
66500 -- [-1488.919] (-1476.281) (-1483.520) (-1484.717) * (-1480.602) (-1484.157) [-1478.167] (-1487.867) -- 0:04:12
67000 -- (-1487.125) [-1477.281] (-1483.756) (-1487.146) * [-1484.967] (-1481.948) (-1481.140) (-1495.917) -- 0:04:10
67500 -- (-1485.039) [-1486.871] (-1477.352) (-1485.695) * (-1483.921) (-1504.806) (-1487.159) [-1482.992] -- 0:04:08
68000 -- (-1483.039) (-1479.779) [-1488.358] (-1472.435) * (-1485.324) (-1490.639) [-1485.049] (-1489.821) -- 0:04:06
68500 -- (-1506.873) [-1480.983] (-1486.794) (-1482.669) * (-1479.058) (-1477.352) [-1478.193] (-1496.167) -- 0:04:18
69000 -- (-1493.478) [-1474.000] (-1512.095) (-1473.622) * (-1492.886) (-1502.717) (-1483.681) [-1482.197] -- 0:04:16
69500 -- (-1489.787) (-1488.029) [-1485.325] (-1481.864) * (-1481.555) [-1487.970] (-1475.807) (-1488.800) -- 0:04:14
70000 -- (-1479.974) (-1478.704) (-1495.987) [-1475.282] * (-1476.903) [-1476.894] (-1483.609) (-1502.637) -- 0:04:12
Average standard deviation of split frequencies: 0.027385
70500 -- [-1488.563] (-1484.613) (-1484.116) (-1473.252) * (-1473.706) (-1493.686) (-1480.476) [-1481.360] -- 0:04:10
71000 -- (-1484.906) (-1488.633) (-1496.177) [-1481.674] * (-1486.675) (-1493.549) [-1473.494] (-1477.729) -- 0:04:08
71500 -- [-1488.764] (-1489.230) (-1483.320) (-1485.772) * [-1478.629] (-1500.615) (-1481.129) (-1478.153) -- 0:04:06
72000 -- (-1484.486) [-1482.291] (-1491.347) (-1487.876) * [-1477.764] (-1482.564) (-1488.223) (-1493.468) -- 0:04:17
72500 -- (-1486.297) (-1475.442) (-1496.265) [-1477.830] * (-1499.414) (-1489.785) (-1495.015) [-1472.357] -- 0:04:15
73000 -- (-1495.284) (-1484.930) (-1495.847) [-1483.173] * (-1479.544) (-1486.654) (-1492.976) [-1473.478] -- 0:04:13
73500 -- (-1489.185) (-1488.819) [-1478.481] (-1486.372) * (-1496.032) [-1485.900] (-1480.961) (-1486.069) -- 0:04:12
74000 -- (-1488.121) (-1502.145) [-1486.251] (-1489.211) * (-1489.014) (-1509.992) [-1477.835] (-1481.964) -- 0:04:10
74500 -- (-1482.169) [-1479.782] (-1486.812) (-1488.902) * (-1484.930) (-1486.005) (-1480.093) [-1477.730] -- 0:04:08
75000 -- [-1485.555] (-1474.499) (-1482.746) (-1481.618) * [-1483.504] (-1494.322) (-1485.013) (-1479.345) -- 0:04:06
Average standard deviation of split frequencies: 0.023880
75500 -- (-1479.425) (-1478.939) (-1476.515) [-1479.642] * (-1493.499) [-1478.911] (-1484.446) (-1482.993) -- 0:04:17
76000 -- [-1474.736] (-1486.001) (-1487.304) (-1489.342) * [-1481.839] (-1483.763) (-1495.735) (-1489.330) -- 0:04:15
76500 -- [-1475.910] (-1475.334) (-1496.759) (-1493.522) * (-1481.773) [-1484.652] (-1493.864) (-1484.768) -- 0:04:13
77000 -- (-1494.017) (-1487.955) [-1482.265] (-1483.590) * (-1484.449) [-1482.914] (-1493.811) (-1486.105) -- 0:04:11
77500 -- (-1487.832) (-1483.689) [-1474.316] (-1478.619) * (-1479.951) (-1492.862) (-1495.491) [-1478.317] -- 0:04:09
78000 -- (-1485.868) [-1481.822] (-1474.045) (-1485.003) * [-1487.720] (-1489.411) (-1488.624) (-1478.694) -- 0:04:08
78500 -- (-1491.867) (-1493.899) (-1477.911) [-1473.929] * (-1491.025) (-1486.468) (-1485.052) [-1473.752] -- 0:04:06
79000 -- (-1481.384) [-1470.486] (-1484.181) (-1484.277) * (-1488.084) [-1472.227] (-1502.907) (-1485.006) -- 0:04:04
79500 -- (-1483.593) (-1488.792) [-1482.955] (-1492.955) * (-1484.524) [-1481.536] (-1495.623) (-1495.455) -- 0:04:14
80000 -- (-1486.736) (-1474.349) (-1488.016) [-1482.298] * (-1495.412) (-1493.607) (-1489.693) [-1482.338] -- 0:04:13
Average standard deviation of split frequencies: 0.032726
80500 -- [-1473.278] (-1493.435) (-1504.695) (-1484.011) * [-1486.803] (-1496.396) (-1484.625) (-1492.584) -- 0:04:11
81000 -- (-1482.825) (-1492.108) [-1482.547] (-1487.848) * [-1475.591] (-1486.849) (-1484.998) (-1484.356) -- 0:04:09
81500 -- (-1474.904) (-1497.050) (-1485.080) [-1495.892] * [-1476.917] (-1482.275) (-1487.973) (-1477.475) -- 0:04:07
82000 -- [-1480.775] (-1493.808) (-1485.140) (-1472.431) * (-1492.400) [-1493.572] (-1478.783) (-1488.604) -- 0:04:06
82500 -- (-1477.410) [-1480.047] (-1495.454) (-1487.656) * (-1490.314) [-1484.926] (-1489.905) (-1501.188) -- 0:04:04
83000 -- (-1494.383) (-1478.904) [-1483.698] (-1483.750) * (-1478.791) [-1477.287] (-1485.431) (-1488.297) -- 0:04:14
83500 -- (-1485.994) (-1491.821) [-1486.783] (-1497.723) * (-1486.703) [-1486.021] (-1488.539) (-1484.316) -- 0:04:12
84000 -- (-1471.476) (-1473.836) [-1476.600] (-1477.453) * (-1475.516) (-1485.407) [-1473.484] (-1478.775) -- 0:04:10
84500 -- (-1484.620) [-1478.580] (-1489.334) (-1488.602) * (-1474.866) (-1496.277) [-1489.519] (-1476.093) -- 0:04:09
85000 -- (-1481.413) (-1482.584) (-1498.134) [-1476.782] * [-1473.602] (-1493.376) (-1478.820) (-1481.897) -- 0:04:07
Average standard deviation of split frequencies: 0.033933
85500 -- (-1494.472) [-1480.882] (-1482.390) (-1483.893) * (-1474.139) (-1503.528) [-1474.498] (-1501.768) -- 0:04:06
86000 -- (-1486.106) (-1486.374) [-1477.777] (-1500.789) * (-1481.346) [-1486.468] (-1474.300) (-1503.936) -- 0:04:15
86500 -- (-1488.573) (-1483.937) [-1475.845] (-1492.268) * (-1480.170) (-1495.758) [-1474.680] (-1493.635) -- 0:04:13
87000 -- (-1478.456) [-1484.402] (-1484.182) (-1481.955) * (-1488.744) [-1475.765] (-1485.326) (-1489.948) -- 0:04:11
87500 -- (-1488.965) [-1470.022] (-1478.044) (-1495.428) * (-1493.959) (-1490.089) (-1479.864) [-1480.050] -- 0:04:10
88000 -- (-1478.464) (-1487.081) (-1488.275) [-1479.738] * (-1485.017) (-1483.071) (-1487.573) [-1478.861] -- 0:04:08
88500 -- (-1486.702) [-1475.645] (-1482.727) (-1486.285) * (-1479.173) (-1496.858) [-1479.725] (-1499.151) -- 0:04:07
89000 -- [-1479.429] (-1482.157) (-1486.396) (-1486.743) * (-1489.972) (-1477.843) [-1475.791] (-1485.453) -- 0:04:05
89500 -- [-1483.545] (-1484.084) (-1476.748) (-1494.597) * (-1484.655) [-1481.968] (-1487.304) (-1481.983) -- 0:04:04
90000 -- [-1485.891] (-1486.934) (-1481.880) (-1485.308) * (-1487.195) (-1479.409) [-1479.544] (-1477.032) -- 0:04:12
Average standard deviation of split frequencies: 0.032236
90500 -- [-1480.565] (-1494.066) (-1480.469) (-1481.204) * (-1494.960) (-1496.866) (-1485.240) [-1486.159] -- 0:04:11
91000 -- (-1486.654) (-1491.349) (-1484.938) [-1480.008] * (-1494.119) (-1473.177) (-1489.770) [-1472.985] -- 0:04:09
91500 -- (-1477.313) (-1493.940) [-1484.541] (-1478.641) * (-1480.739) (-1492.023) (-1490.345) [-1467.941] -- 0:04:08
92000 -- (-1476.109) [-1489.483] (-1489.740) (-1483.740) * (-1503.929) (-1484.650) (-1481.226) [-1479.661] -- 0:04:06
92500 -- (-1489.084) (-1493.440) (-1490.478) [-1470.755] * (-1484.483) (-1474.489) (-1486.792) [-1479.725] -- 0:04:05
93000 -- (-1489.758) (-1483.966) [-1474.893] (-1488.450) * (-1490.875) (-1493.148) (-1484.449) [-1481.699] -- 0:04:03
93500 -- (-1499.949) (-1486.095) (-1486.127) [-1480.053] * [-1490.488] (-1481.487) (-1496.053) (-1480.931) -- 0:04:12
94000 -- [-1483.111] (-1501.489) (-1487.300) (-1483.566) * (-1486.038) [-1491.013] (-1479.454) (-1477.572) -- 0:04:10
94500 -- (-1489.754) (-1501.098) (-1473.554) [-1478.746] * (-1492.224) (-1486.801) (-1481.143) [-1472.787] -- 0:04:09
95000 -- [-1482.418] (-1508.855) (-1479.628) (-1482.655) * (-1488.243) (-1494.912) [-1485.172] (-1483.971) -- 0:04:07
Average standard deviation of split frequencies: 0.031333
95500 -- (-1473.175) (-1488.753) [-1472.574] (-1479.207) * [-1481.360] (-1498.015) (-1484.817) (-1469.848) -- 0:04:06
96000 -- (-1472.204) (-1486.085) (-1480.774) [-1480.646] * (-1491.743) (-1504.004) (-1481.441) [-1478.229] -- 0:04:04
96500 -- (-1489.951) (-1484.624) (-1491.884) [-1479.446] * (-1483.360) (-1494.123) (-1466.335) [-1479.753] -- 0:04:03
97000 -- (-1485.635) (-1483.072) (-1483.651) [-1485.295] * (-1479.400) (-1483.867) (-1475.289) [-1476.634] -- 0:04:02
97500 -- (-1477.290) (-1489.434) [-1483.294] (-1491.595) * (-1486.772) [-1473.276] (-1490.747) (-1487.300) -- 0:04:09
98000 -- (-1488.475) [-1471.696] (-1482.997) (-1485.809) * [-1479.816] (-1480.390) (-1488.229) (-1489.866) -- 0:04:08
98500 -- (-1470.146) (-1505.845) [-1474.181] (-1497.031) * (-1491.969) (-1482.150) [-1488.299] (-1497.620) -- 0:04:07
99000 -- [-1470.757] (-1497.864) (-1481.279) (-1480.885) * (-1478.309) [-1477.700] (-1477.835) (-1480.289) -- 0:04:05
99500 -- (-1491.972) (-1496.407) (-1486.218) [-1483.504] * (-1486.410) (-1477.964) (-1485.909) [-1487.840] -- 0:04:04
100000 -- [-1477.145] (-1490.172) (-1479.515) (-1472.332) * (-1503.729) [-1485.581] (-1487.368) (-1477.711) -- 0:04:03
Average standard deviation of split frequencies: 0.031375
100500 -- (-1483.301) (-1487.444) (-1489.345) [-1480.783] * (-1481.336) (-1485.706) [-1481.438] (-1483.937) -- 0:04:01
101000 -- (-1489.046) (-1491.884) (-1487.122) [-1477.692] * (-1487.924) [-1484.741] (-1499.301) (-1499.815) -- 0:04:09
101500 -- (-1483.652) [-1483.617] (-1474.155) (-1481.670) * (-1490.688) (-1489.241) [-1476.665] (-1499.096) -- 0:04:07
102000 -- (-1490.723) (-1485.158) [-1481.730] (-1488.536) * (-1484.848) (-1487.074) [-1471.248] (-1478.199) -- 0:04:06
102500 -- [-1476.015] (-1486.896) (-1496.734) (-1483.321) * (-1514.378) [-1482.317] (-1475.867) (-1480.866) -- 0:04:05
103000 -- (-1489.743) [-1476.062] (-1475.018) (-1488.114) * (-1521.736) (-1478.328) [-1492.046] (-1484.796) -- 0:04:03
103500 -- (-1494.468) (-1484.154) (-1483.982) [-1479.086] * (-1499.713) (-1474.916) (-1495.053) [-1480.161] -- 0:04:02
104000 -- (-1491.987) (-1493.989) [-1475.083] (-1489.804) * (-1484.197) (-1481.777) (-1491.171) [-1487.585] -- 0:04:01
104500 -- (-1495.974) (-1478.312) [-1482.518] (-1487.963) * (-1485.983) (-1481.971) (-1484.782) [-1478.734] -- 0:03:59
105000 -- (-1486.987) (-1482.793) [-1469.687] (-1489.792) * (-1490.248) (-1482.780) (-1490.053) [-1475.675] -- 0:04:07
Average standard deviation of split frequencies: 0.035578
105500 -- (-1497.216) (-1474.860) (-1483.650) [-1493.153] * [-1476.006] (-1480.245) (-1492.083) (-1491.474) -- 0:04:05
106000 -- (-1500.794) [-1482.152] (-1488.967) (-1479.334) * (-1485.008) [-1479.933] (-1488.113) (-1486.222) -- 0:04:04
106500 -- (-1499.206) [-1477.226] (-1481.963) (-1474.869) * (-1491.313) (-1485.242) [-1484.079] (-1476.873) -- 0:04:03
107000 -- (-1497.832) [-1484.967] (-1479.334) (-1486.243) * [-1480.713] (-1479.858) (-1487.610) (-1489.812) -- 0:04:02
107500 -- (-1504.626) [-1476.835] (-1497.075) (-1482.039) * [-1476.193] (-1476.496) (-1492.493) (-1485.209) -- 0:04:00
108000 -- (-1497.025) [-1474.379] (-1479.548) (-1489.735) * (-1486.966) [-1474.857] (-1491.056) (-1485.919) -- 0:03:59
108500 -- (-1486.250) (-1476.072) [-1474.308] (-1487.256) * (-1481.191) (-1477.292) (-1482.552) [-1483.855] -- 0:04:06
109000 -- (-1480.258) (-1480.154) (-1491.039) [-1477.541] * (-1495.317) (-1488.663) [-1480.475] (-1487.661) -- 0:04:05
109500 -- [-1468.870] (-1494.445) (-1470.419) (-1479.372) * (-1492.447) [-1474.719] (-1481.752) (-1493.588) -- 0:04:03
110000 -- [-1487.353] (-1478.767) (-1481.197) (-1490.167) * (-1489.627) (-1486.269) (-1479.269) [-1481.730] -- 0:04:02
Average standard deviation of split frequencies: 0.028540
110500 -- (-1476.623) (-1492.555) [-1485.253] (-1485.439) * (-1476.351) (-1485.635) (-1481.764) [-1473.819] -- 0:04:01
111000 -- (-1486.095) (-1492.145) (-1479.125) [-1479.634] * (-1484.348) (-1484.759) [-1479.329] (-1479.786) -- 0:04:00
111500 -- (-1482.142) (-1477.070) (-1482.454) [-1492.301] * [-1483.575] (-1493.573) (-1494.277) (-1474.181) -- 0:04:07
112000 -- (-1501.266) (-1500.877) [-1484.809] (-1479.924) * [-1483.064] (-1478.230) (-1491.017) (-1483.337) -- 0:04:05
112500 -- (-1495.684) (-1492.788) (-1480.656) [-1470.539] * (-1482.384) [-1473.869] (-1494.795) (-1496.466) -- 0:04:04
113000 -- (-1486.877) (-1482.192) (-1482.092) [-1488.808] * [-1479.025] (-1470.490) (-1499.356) (-1491.079) -- 0:04:03
113500 -- (-1485.312) (-1489.221) [-1471.747] (-1481.007) * [-1479.006] (-1500.849) (-1479.447) (-1493.953) -- 0:04:02
114000 -- (-1501.100) (-1479.785) (-1480.666) [-1475.111] * (-1477.689) (-1481.719) [-1478.213] (-1476.861) -- 0:04:00
114500 -- (-1489.521) (-1491.962) (-1494.987) [-1472.171] * (-1483.776) (-1489.115) (-1494.152) [-1485.515] -- 0:03:59
115000 -- (-1474.064) (-1501.853) (-1493.236) [-1472.905] * (-1490.078) (-1474.341) [-1476.496] (-1478.787) -- 0:04:06
Average standard deviation of split frequencies: 0.029056
115500 -- [-1479.406] (-1478.353) (-1492.796) (-1485.561) * (-1496.428) (-1485.406) (-1478.716) [-1478.638] -- 0:04:05
116000 -- (-1473.060) (-1492.326) [-1480.847] (-1485.571) * [-1490.683] (-1483.765) (-1481.121) (-1490.805) -- 0:04:03
116500 -- (-1481.490) (-1477.254) (-1484.035) [-1489.032] * (-1488.922) (-1486.984) [-1475.004] (-1486.452) -- 0:04:02
117000 -- (-1484.041) (-1493.889) [-1483.835] (-1482.840) * (-1484.336) (-1484.470) [-1478.412] (-1480.904) -- 0:04:01
117500 -- [-1480.278] (-1479.079) (-1485.494) (-1481.512) * (-1483.805) (-1488.366) [-1479.665] (-1497.495) -- 0:04:00
118000 -- (-1481.427) (-1489.340) (-1488.332) [-1483.646] * [-1489.642] (-1497.823) (-1488.345) (-1486.411) -- 0:03:59
118500 -- (-1476.935) (-1486.046) (-1493.433) [-1484.724] * (-1488.438) (-1481.753) (-1493.326) [-1485.071] -- 0:04:05
119000 -- [-1477.969] (-1483.225) (-1492.626) (-1488.605) * (-1483.242) (-1486.327) (-1500.750) [-1490.379] -- 0:04:04
119500 -- (-1487.120) [-1473.822] (-1488.217) (-1500.722) * (-1486.817) (-1488.383) [-1484.255] (-1477.615) -- 0:04:03
120000 -- (-1486.082) (-1482.144) [-1485.891] (-1492.442) * (-1482.296) (-1483.509) [-1477.432] (-1482.619) -- 0:04:02
Average standard deviation of split frequencies: 0.027347
120500 -- (-1480.645) [-1482.213] (-1491.522) (-1486.888) * (-1478.178) (-1498.399) (-1481.009) [-1485.115] -- 0:04:00
121000 -- (-1480.733) (-1483.413) [-1482.669] (-1478.316) * [-1472.485] (-1492.531) (-1483.684) (-1485.822) -- 0:03:59
121500 -- (-1479.361) (-1476.354) (-1479.356) [-1478.173] * (-1490.013) (-1484.734) [-1474.561] (-1481.263) -- 0:03:58
122000 -- (-1485.079) [-1478.827] (-1479.314) (-1479.726) * [-1474.258] (-1482.543) (-1491.882) (-1479.768) -- 0:03:57
122500 -- [-1472.569] (-1491.194) (-1490.902) (-1478.209) * (-1494.098) (-1480.039) (-1497.152) [-1478.288] -- 0:04:03
123000 -- (-1477.608) (-1476.200) [-1477.260] (-1479.530) * (-1485.001) (-1480.752) (-1496.570) [-1476.219] -- 0:04:02
123500 -- (-1495.181) [-1473.482] (-1478.402) (-1487.837) * (-1478.459) (-1474.923) (-1486.080) [-1475.259] -- 0:04:01
124000 -- (-1487.710) (-1479.275) [-1483.477] (-1484.632) * (-1494.149) (-1487.323) (-1473.787) [-1473.284] -- 0:04:00
124500 -- [-1477.442] (-1486.199) (-1487.863) (-1475.873) * [-1485.678] (-1485.148) (-1495.613) (-1485.810) -- 0:03:59
125000 -- [-1475.796] (-1484.165) (-1488.101) (-1472.754) * [-1473.249] (-1485.706) (-1476.586) (-1482.120) -- 0:03:58
Average standard deviation of split frequencies: 0.026563
125500 -- (-1492.985) [-1483.729] (-1484.082) (-1487.827) * (-1484.434) (-1491.024) [-1482.287] (-1485.820) -- 0:03:56
126000 -- (-1483.538) [-1477.320] (-1493.301) (-1499.914) * (-1488.520) (-1478.346) [-1469.775] (-1475.993) -- 0:04:02
126500 -- (-1480.877) (-1492.153) (-1497.623) [-1474.632] * [-1490.317] (-1481.168) (-1473.758) (-1494.612) -- 0:04:01
127000 -- (-1482.832) [-1480.261] (-1485.688) (-1481.798) * (-1483.150) [-1483.124] (-1479.187) (-1482.554) -- 0:04:00
127500 -- [-1478.144] (-1482.317) (-1487.368) (-1481.770) * (-1498.431) [-1479.835] (-1477.136) (-1486.290) -- 0:03:59
128000 -- (-1495.518) (-1478.799) (-1493.259) [-1480.016] * (-1483.978) (-1485.804) (-1492.747) [-1483.424] -- 0:03:58
128500 -- (-1486.951) (-1473.666) (-1491.436) [-1476.395] * [-1476.457] (-1479.444) (-1492.972) (-1488.846) -- 0:03:57
129000 -- (-1477.462) [-1477.210] (-1489.130) (-1470.364) * (-1480.758) (-1473.251) [-1473.401] (-1488.665) -- 0:03:56
129500 -- (-1484.341) (-1474.316) [-1477.644] (-1471.650) * (-1489.434) [-1480.537] (-1479.398) (-1487.255) -- 0:03:55
130000 -- (-1496.268) (-1477.800) [-1475.246] (-1487.283) * (-1484.874) (-1478.751) (-1492.000) [-1467.151] -- 0:04:00
Average standard deviation of split frequencies: 0.024893
130500 -- (-1480.407) (-1488.103) (-1481.929) [-1484.322] * [-1471.455] (-1481.133) (-1493.070) (-1469.921) -- 0:03:59
131000 -- (-1483.270) (-1494.947) (-1486.336) [-1475.356] * (-1480.348) (-1489.668) [-1477.365] (-1490.153) -- 0:03:58
131500 -- (-1489.535) [-1472.628] (-1483.363) (-1473.790) * (-1484.037) (-1479.950) [-1480.853] (-1481.780) -- 0:03:57
132000 -- (-1493.560) (-1479.415) [-1478.386] (-1479.149) * (-1501.903) (-1497.280) [-1469.375] (-1480.198) -- 0:03:56
132500 -- [-1481.811] (-1494.665) (-1481.870) (-1477.909) * (-1484.199) [-1483.043] (-1488.865) (-1484.078) -- 0:03:55
133000 -- (-1482.401) (-1481.822) [-1486.039] (-1487.555) * (-1500.132) (-1482.750) [-1477.278] (-1480.920) -- 0:03:54
133500 -- (-1482.309) (-1490.340) [-1481.466] (-1480.946) * (-1481.080) (-1480.391) (-1474.527) [-1480.906] -- 0:04:00
134000 -- (-1480.936) (-1497.331) (-1477.694) [-1472.348] * (-1481.266) [-1481.131] (-1489.990) (-1470.911) -- 0:03:59
134500 -- [-1470.911] (-1488.616) (-1478.234) (-1471.784) * (-1487.801) (-1484.434) [-1476.184] (-1475.715) -- 0:03:58
135000 -- (-1492.823) (-1506.571) [-1477.633] (-1474.933) * (-1483.249) (-1484.594) [-1472.470] (-1495.481) -- 0:03:57
Average standard deviation of split frequencies: 0.023438
135500 -- (-1492.672) (-1486.594) [-1476.038] (-1478.434) * (-1482.591) [-1477.207] (-1494.884) (-1496.454) -- 0:03:56
136000 -- (-1494.535) (-1491.849) [-1472.005] (-1478.275) * (-1488.375) (-1481.233) [-1474.031] (-1487.567) -- 0:03:55
136500 -- (-1483.588) (-1487.489) [-1482.591] (-1487.483) * (-1489.633) [-1485.846] (-1489.330) (-1476.062) -- 0:03:54
137000 -- (-1486.985) (-1477.574) (-1476.108) [-1475.609] * [-1479.608] (-1494.136) (-1477.170) (-1491.432) -- 0:03:53
137500 -- (-1491.770) (-1483.266) [-1479.170] (-1472.667) * (-1477.889) (-1483.642) (-1497.532) [-1482.353] -- 0:03:58
138000 -- (-1475.734) [-1481.148] (-1485.065) (-1478.197) * (-1489.548) (-1491.705) [-1475.496] (-1481.204) -- 0:03:57
138500 -- (-1480.592) [-1493.643] (-1485.230) (-1484.501) * [-1471.994] (-1487.510) (-1479.147) (-1484.394) -- 0:03:56
139000 -- (-1481.215) (-1493.293) (-1485.562) [-1483.536] * (-1488.297) (-1469.902) [-1478.657] (-1486.133) -- 0:03:55
139500 -- (-1485.563) (-1475.605) [-1475.926] (-1492.204) * (-1491.818) [-1481.376] (-1483.402) (-1484.564) -- 0:03:54
140000 -- (-1476.953) (-1479.822) [-1475.314] (-1498.069) * (-1480.050) [-1474.358] (-1485.348) (-1480.527) -- 0:03:53
Average standard deviation of split frequencies: 0.023459
140500 -- (-1489.076) (-1480.256) [-1476.760] (-1487.597) * [-1473.494] (-1479.760) (-1491.445) (-1498.078) -- 0:03:52
141000 -- (-1485.981) (-1489.633) (-1502.217) [-1486.024] * (-1490.028) (-1477.611) [-1479.900] (-1487.436) -- 0:03:57
141500 -- (-1480.493) (-1489.073) (-1488.828) [-1486.142] * (-1492.828) [-1483.586] (-1474.958) (-1486.882) -- 0:03:56
142000 -- (-1500.400) [-1472.127] (-1497.409) (-1483.574) * (-1481.454) (-1483.480) (-1475.808) [-1479.966] -- 0:03:55
142500 -- (-1490.893) [-1473.043] (-1494.342) (-1486.604) * (-1484.197) (-1488.391) [-1482.046] (-1488.691) -- 0:03:54
143000 -- (-1483.138) (-1487.450) [-1485.566] (-1489.442) * (-1482.613) (-1481.696) (-1483.774) [-1477.335] -- 0:03:53
143500 -- (-1485.666) (-1486.840) [-1486.059] (-1487.751) * (-1471.790) (-1485.891) (-1498.200) [-1479.780] -- 0:03:52
144000 -- (-1494.756) (-1487.679) [-1478.528] (-1476.246) * (-1492.224) [-1479.845] (-1483.440) (-1489.765) -- 0:03:51
144500 -- (-1485.141) (-1492.065) (-1492.434) [-1484.867] * (-1497.762) (-1482.517) (-1489.274) [-1478.112] -- 0:03:50
145000 -- (-1486.685) [-1481.651] (-1487.565) (-1486.089) * (-1486.733) (-1480.103) (-1495.487) [-1470.683] -- 0:03:55
Average standard deviation of split frequencies: 0.024447
145500 -- (-1488.502) (-1477.771) (-1497.852) [-1479.846] * (-1499.115) (-1490.835) [-1486.509] (-1478.301) -- 0:03:54
146000 -- (-1482.861) (-1473.355) (-1492.895) [-1480.051] * [-1491.991] (-1491.536) (-1482.299) (-1480.346) -- 0:03:53
146500 -- (-1480.327) (-1492.751) [-1476.291] (-1485.554) * (-1487.143) (-1486.651) (-1478.818) [-1479.965] -- 0:03:53
147000 -- (-1474.109) (-1488.318) [-1470.218] (-1507.765) * [-1487.218] (-1489.566) (-1480.830) (-1490.285) -- 0:03:52
147500 -- (-1479.083) (-1478.118) [-1476.773] (-1472.942) * (-1483.271) (-1483.424) (-1491.509) [-1478.935] -- 0:03:51
148000 -- (-1481.386) [-1478.237] (-1477.116) (-1479.821) * (-1480.966) [-1486.907] (-1487.875) (-1485.121) -- 0:03:50
148500 -- (-1480.010) (-1483.481) [-1468.068] (-1486.515) * (-1471.987) [-1479.335] (-1486.946) (-1481.965) -- 0:03:55
149000 -- (-1482.585) (-1477.838) [-1467.667] (-1496.570) * (-1490.351) (-1481.385) (-1490.923) [-1477.950] -- 0:03:54
149500 -- (-1484.536) [-1479.570] (-1482.283) (-1511.629) * [-1478.701] (-1490.784) (-1487.720) (-1475.839) -- 0:03:53
150000 -- (-1487.619) (-1482.157) (-1479.405) [-1487.597] * (-1491.408) (-1481.042) [-1489.406] (-1474.998) -- 0:03:52
Average standard deviation of split frequencies: 0.025500
150500 -- [-1478.863] (-1484.268) (-1479.175) (-1475.805) * (-1487.016) (-1487.117) (-1481.217) [-1481.146] -- 0:03:51
151000 -- [-1476.794] (-1495.083) (-1490.603) (-1480.367) * [-1478.525] (-1490.072) (-1480.930) (-1474.370) -- 0:03:50
151500 -- (-1483.540) (-1484.587) [-1482.153] (-1479.165) * (-1495.505) [-1480.982] (-1485.937) (-1500.299) -- 0:03:49
152000 -- (-1474.016) (-1496.796) [-1481.623] (-1477.786) * (-1488.142) (-1478.935) (-1489.344) [-1481.904] -- 0:03:48
152500 -- [-1470.197] (-1476.850) (-1474.528) (-1501.117) * [-1478.653] (-1477.880) (-1485.931) (-1483.069) -- 0:03:53
153000 -- (-1482.828) [-1480.801] (-1496.210) (-1490.450) * (-1489.182) (-1486.341) (-1477.818) [-1479.277] -- 0:03:52
153500 -- (-1480.773) [-1475.193] (-1496.262) (-1489.814) * (-1484.244) (-1479.603) [-1481.289] (-1492.657) -- 0:03:51
154000 -- (-1484.562) (-1492.386) (-1484.181) [-1479.284] * [-1481.042] (-1496.545) (-1487.414) (-1496.321) -- 0:03:50
154500 -- (-1490.594) (-1481.875) (-1483.970) [-1476.738] * (-1491.227) (-1484.313) [-1479.632] (-1486.012) -- 0:03:49
155000 -- (-1485.383) (-1481.448) [-1484.153] (-1477.063) * (-1484.867) (-1485.054) [-1481.939] (-1473.298) -- 0:03:48
Average standard deviation of split frequencies: 0.025686
155500 -- (-1483.535) [-1469.723] (-1479.432) (-1490.575) * (-1491.693) (-1488.148) (-1476.907) [-1472.100] -- 0:03:48
156000 -- (-1500.020) [-1484.028] (-1478.191) (-1485.301) * (-1487.880) (-1489.418) [-1484.223] (-1487.295) -- 0:03:52
156500 -- (-1473.595) (-1498.984) (-1493.166) [-1475.939] * [-1476.364] (-1491.529) (-1480.646) (-1476.185) -- 0:03:51
157000 -- (-1481.330) [-1486.444] (-1488.086) (-1494.191) * [-1480.791] (-1487.050) (-1481.207) (-1486.391) -- 0:03:50
157500 -- [-1486.566] (-1492.386) (-1480.170) (-1483.550) * (-1480.692) (-1486.665) [-1476.728] (-1473.665) -- 0:03:50
158000 -- [-1484.800] (-1483.020) (-1484.624) (-1487.980) * (-1494.219) (-1495.557) [-1471.899] (-1486.279) -- 0:03:49
158500 -- (-1481.673) (-1478.099) (-1486.323) [-1488.735] * (-1484.068) [-1486.966] (-1478.548) (-1490.612) -- 0:03:48
159000 -- (-1482.686) (-1478.870) (-1492.511) [-1480.983] * [-1475.893] (-1482.074) (-1484.781) (-1482.611) -- 0:03:47
159500 -- [-1481.168] (-1490.294) (-1505.477) (-1478.689) * (-1503.789) (-1478.697) [-1474.533] (-1481.275) -- 0:03:46
160000 -- (-1475.731) (-1489.532) [-1476.218] (-1476.639) * (-1482.871) (-1479.643) [-1488.337] (-1485.610) -- 0:03:51
Average standard deviation of split frequencies: 0.024450
160500 -- (-1484.025) (-1476.041) (-1480.748) [-1481.192] * (-1483.184) [-1482.100] (-1494.141) (-1486.759) -- 0:03:50
161000 -- [-1477.931] (-1480.965) (-1480.674) (-1494.692) * [-1477.654] (-1474.411) (-1482.712) (-1472.722) -- 0:03:49
161500 -- (-1477.690) [-1475.462] (-1492.956) (-1495.953) * [-1471.098] (-1482.379) (-1489.430) (-1479.973) -- 0:03:48
162000 -- (-1478.390) [-1473.331] (-1484.057) (-1493.183) * (-1475.081) (-1486.477) [-1483.893] (-1486.043) -- 0:03:47
162500 -- (-1490.581) [-1481.968] (-1495.983) (-1479.369) * (-1498.444) (-1486.806) [-1479.439] (-1481.455) -- 0:03:46
163000 -- [-1470.479] (-1482.132) (-1485.307) (-1486.029) * (-1500.538) (-1488.122) (-1476.333) [-1479.000] -- 0:03:45
163500 -- (-1510.520) [-1475.015] (-1476.464) (-1496.651) * (-1493.216) [-1472.496] (-1487.491) (-1476.015) -- 0:03:50
164000 -- (-1498.149) [-1479.637] (-1477.738) (-1508.669) * [-1474.740] (-1483.664) (-1495.258) (-1481.986) -- 0:03:49
164500 -- (-1489.606) [-1475.523] (-1484.695) (-1488.085) * (-1482.898) [-1480.015] (-1482.947) (-1482.140) -- 0:03:48
165000 -- (-1482.049) (-1473.555) [-1477.037] (-1491.132) * (-1475.108) [-1469.836] (-1470.696) (-1497.860) -- 0:03:47
Average standard deviation of split frequencies: 0.022448
165500 -- (-1487.133) (-1485.595) [-1471.060] (-1486.176) * [-1476.249] (-1473.455) (-1475.356) (-1504.744) -- 0:03:46
166000 -- [-1479.625] (-1481.674) (-1490.379) (-1491.182) * (-1476.870) (-1489.308) (-1490.025) [-1475.618] -- 0:03:46
166500 -- (-1482.862) (-1488.463) (-1485.609) [-1489.709] * (-1485.153) [-1477.893] (-1503.578) (-1503.270) -- 0:03:45
167000 -- [-1473.030] (-1488.697) (-1479.458) (-1487.995) * (-1489.962) (-1471.629) [-1480.282] (-1479.609) -- 0:03:49
167500 -- (-1481.637) (-1492.477) (-1488.021) [-1488.636] * (-1492.316) [-1482.167] (-1488.457) (-1479.130) -- 0:03:48
168000 -- [-1479.168] (-1487.213) (-1473.422) (-1490.195) * (-1483.916) (-1484.672) [-1480.569] (-1482.837) -- 0:03:47
168500 -- (-1476.962) (-1485.910) [-1473.247] (-1486.920) * [-1479.113] (-1480.784) (-1495.375) (-1478.009) -- 0:03:46
169000 -- [-1478.134] (-1495.618) (-1481.133) (-1478.820) * (-1492.769) (-1476.706) (-1489.355) [-1479.427] -- 0:03:46
169500 -- (-1493.564) (-1493.046) (-1476.511) [-1474.831] * (-1486.294) [-1469.633] (-1488.756) (-1470.918) -- 0:03:45
170000 -- (-1480.063) (-1485.307) (-1484.468) [-1475.482] * [-1483.733] (-1494.835) (-1488.685) (-1478.076) -- 0:03:44
Average standard deviation of split frequencies: 0.021176
170500 -- (-1485.187) [-1477.727] (-1484.463) (-1478.401) * (-1484.637) [-1485.810] (-1490.176) (-1477.143) -- 0:03:48
171000 -- (-1477.454) (-1479.566) (-1482.371) [-1476.047] * (-1476.710) (-1481.540) (-1487.611) [-1491.468] -- 0:03:47
171500 -- (-1480.144) [-1478.405] (-1482.985) (-1484.851) * (-1479.598) (-1480.738) [-1477.240] (-1498.678) -- 0:03:47
172000 -- (-1478.536) [-1475.041] (-1496.152) (-1483.064) * [-1473.379] (-1482.411) (-1492.230) (-1475.048) -- 0:03:46
172500 -- (-1477.889) [-1477.008] (-1476.983) (-1480.435) * (-1490.543) [-1475.579] (-1494.692) (-1479.557) -- 0:03:45
173000 -- (-1483.210) [-1471.260] (-1483.706) (-1481.782) * (-1495.297) (-1484.310) [-1486.358] (-1481.861) -- 0:03:44
173500 -- (-1480.571) [-1475.126] (-1474.496) (-1499.723) * [-1482.095] (-1487.956) (-1497.211) (-1480.581) -- 0:03:43
174000 -- (-1491.700) [-1479.038] (-1476.568) (-1491.972) * (-1493.551) (-1486.149) (-1488.267) [-1489.231] -- 0:03:47
174500 -- (-1484.008) [-1474.985] (-1482.397) (-1479.930) * (-1479.823) (-1488.416) (-1489.875) [-1483.050] -- 0:03:47
175000 -- [-1476.222] (-1489.146) (-1487.164) (-1497.427) * [-1485.648] (-1482.789) (-1484.593) (-1483.608) -- 0:03:46
Average standard deviation of split frequencies: 0.020662
175500 -- [-1472.347] (-1487.452) (-1488.856) (-1482.890) * (-1492.153) [-1488.464] (-1473.809) (-1488.156) -- 0:03:45
176000 -- (-1489.305) [-1472.821] (-1487.691) (-1486.815) * (-1481.177) [-1485.655] (-1491.825) (-1487.363) -- 0:03:44
176500 -- [-1486.959] (-1482.124) (-1477.514) (-1490.801) * (-1484.742) (-1489.559) (-1483.543) [-1472.457] -- 0:03:43
177000 -- (-1492.480) [-1471.200] (-1475.652) (-1492.463) * [-1487.077] (-1485.000) (-1490.620) (-1487.641) -- 0:03:47
177500 -- (-1483.645) (-1485.559) (-1478.799) [-1481.508] * (-1488.524) (-1492.671) [-1481.146] (-1479.896) -- 0:03:47
178000 -- (-1489.147) [-1471.168] (-1481.397) (-1493.253) * (-1482.138) [-1481.321] (-1478.894) (-1483.770) -- 0:03:46
178500 -- [-1480.174] (-1476.275) (-1484.874) (-1488.530) * (-1490.054) (-1474.352) (-1483.291) [-1484.235] -- 0:03:45
179000 -- (-1491.299) (-1485.620) [-1482.129] (-1500.434) * (-1486.936) (-1482.173) (-1491.997) [-1484.619] -- 0:03:44
179500 -- [-1472.568] (-1488.825) (-1481.654) (-1480.484) * [-1476.611] (-1478.828) (-1497.068) (-1489.384) -- 0:03:43
180000 -- (-1478.599) (-1481.396) [-1479.603] (-1484.115) * (-1492.420) (-1467.362) (-1506.357) [-1476.979] -- 0:03:43
Average standard deviation of split frequencies: 0.019308
180500 -- (-1487.971) [-1479.558] (-1490.297) (-1482.805) * [-1487.830] (-1478.732) (-1482.486) (-1486.428) -- 0:03:47
181000 -- (-1482.391) (-1478.582) [-1471.073] (-1502.441) * (-1478.245) (-1478.716) (-1502.696) [-1475.880] -- 0:03:46
181500 -- [-1481.149] (-1480.445) (-1491.008) (-1480.356) * (-1496.044) [-1488.260] (-1498.762) (-1479.469) -- 0:03:45
182000 -- (-1499.402) [-1477.386] (-1489.496) (-1477.464) * (-1497.031) [-1486.543] (-1503.706) (-1475.607) -- 0:03:44
182500 -- [-1476.626] (-1479.418) (-1490.699) (-1481.753) * (-1477.292) (-1485.712) (-1483.451) [-1474.956] -- 0:03:43
183000 -- (-1488.791) (-1484.634) [-1478.544] (-1477.741) * (-1477.689) (-1489.982) (-1477.598) [-1488.603] -- 0:03:43
183500 -- (-1487.287) (-1479.460) [-1476.862] (-1486.450) * [-1488.028] (-1498.176) (-1497.640) (-1481.569) -- 0:03:42
184000 -- (-1496.853) (-1483.818) [-1481.314] (-1495.643) * (-1480.161) (-1486.344) (-1482.289) [-1466.245] -- 0:03:46
184500 -- (-1479.267) (-1479.783) [-1485.598] (-1479.860) * (-1485.123) (-1486.905) (-1487.615) [-1486.887] -- 0:03:45
185000 -- (-1479.738) (-1491.872) [-1483.370] (-1480.397) * (-1486.712) (-1471.642) (-1490.049) [-1483.510] -- 0:03:44
Average standard deviation of split frequencies: 0.017741
185500 -- [-1474.289] (-1493.773) (-1485.177) (-1491.825) * [-1474.206] (-1498.319) (-1488.367) (-1500.783) -- 0:03:43
186000 -- (-1475.506) (-1492.216) [-1475.538] (-1480.624) * (-1473.091) (-1485.032) [-1485.321] (-1511.169) -- 0:03:43
186500 -- [-1490.166] (-1492.221) (-1478.468) (-1496.151) * (-1480.441) (-1491.449) (-1483.500) [-1478.298] -- 0:03:42
187000 -- [-1482.175] (-1500.555) (-1493.758) (-1487.213) * (-1483.769) (-1484.280) (-1489.914) [-1483.113] -- 0:03:41
187500 -- (-1477.258) (-1492.612) [-1486.598] (-1498.334) * [-1487.662] (-1491.548) (-1490.626) (-1485.215) -- 0:03:41
188000 -- (-1476.080) [-1487.512] (-1474.334) (-1491.116) * (-1481.290) [-1471.726] (-1473.270) (-1500.065) -- 0:03:44
188500 -- (-1488.141) (-1483.203) [-1482.369] (-1512.567) * [-1475.295] (-1475.760) (-1494.073) (-1471.276) -- 0:03:43
189000 -- (-1497.993) [-1480.547] (-1487.442) (-1491.633) * (-1477.689) [-1475.882] (-1483.304) (-1481.669) -- 0:03:43
189500 -- (-1484.094) [-1483.782] (-1476.661) (-1485.675) * (-1484.661) [-1471.179] (-1483.540) (-1479.529) -- 0:03:42
190000 -- (-1481.606) (-1487.283) [-1472.324] (-1490.706) * (-1485.597) [-1485.052] (-1480.922) (-1485.655) -- 0:03:41
Average standard deviation of split frequencies: 0.015576
190500 -- (-1481.210) (-1489.198) (-1482.167) [-1472.659] * [-1482.179] (-1474.668) (-1471.086) (-1503.696) -- 0:03:40
191000 -- (-1483.622) (-1493.298) [-1484.646] (-1480.950) * (-1477.450) [-1484.180] (-1493.327) (-1488.165) -- 0:03:40
191500 -- [-1478.327] (-1474.214) (-1491.635) (-1494.187) * [-1478.163] (-1482.840) (-1480.067) (-1483.190) -- 0:03:43
192000 -- (-1475.949) [-1477.999] (-1477.701) (-1478.201) * (-1470.488) [-1481.106] (-1473.500) (-1495.644) -- 0:03:43
192500 -- (-1484.731) (-1484.987) [-1472.422] (-1491.673) * (-1478.754) [-1483.461] (-1475.209) (-1482.789) -- 0:03:42
193000 -- (-1475.058) (-1496.802) [-1485.127] (-1475.594) * (-1483.026) (-1495.213) [-1469.587] (-1476.487) -- 0:03:41
193500 -- (-1488.299) [-1487.437] (-1486.401) (-1475.340) * (-1495.234) (-1495.433) [-1477.537] (-1480.692) -- 0:03:40
194000 -- [-1479.671] (-1488.683) (-1477.532) (-1482.077) * [-1477.963] (-1490.974) (-1479.882) (-1485.086) -- 0:03:40
194500 -- (-1486.115) (-1483.954) (-1482.947) [-1480.459] * (-1482.332) [-1480.917] (-1489.875) (-1484.945) -- 0:03:39
195000 -- [-1477.430] (-1492.542) (-1479.804) (-1487.733) * (-1475.631) (-1489.948) (-1487.324) [-1482.035] -- 0:03:38
Average standard deviation of split frequencies: 0.013589
195500 -- [-1482.911] (-1487.292) (-1482.545) (-1486.114) * (-1485.077) (-1487.616) (-1497.017) [-1482.467] -- 0:03:42
196000 -- (-1492.265) (-1491.978) (-1483.083) [-1491.068] * (-1478.881) [-1479.521] (-1483.004) (-1485.181) -- 0:03:41
196500 -- (-1484.383) [-1470.063] (-1472.594) (-1492.129) * (-1495.044) [-1471.397] (-1480.432) (-1475.813) -- 0:03:40
197000 -- (-1478.224) [-1474.716] (-1484.266) (-1494.470) * [-1496.577] (-1489.466) (-1486.380) (-1483.777) -- 0:03:40
197500 -- (-1495.856) (-1477.363) [-1488.491] (-1497.109) * (-1509.218) [-1489.104] (-1487.906) (-1481.819) -- 0:03:39
198000 -- [-1479.586] (-1489.255) (-1484.987) (-1480.487) * (-1489.111) (-1474.449) (-1507.444) [-1470.850] -- 0:03:38
198500 -- [-1477.153] (-1490.901) (-1495.169) (-1484.196) * [-1486.366] (-1476.553) (-1484.846) (-1473.576) -- 0:03:38
199000 -- [-1471.472] (-1501.225) (-1487.933) (-1498.931) * (-1492.071) [-1473.555] (-1489.634) (-1489.719) -- 0:03:41
199500 -- (-1480.558) [-1479.544] (-1490.667) (-1478.678) * (-1483.075) [-1483.726] (-1482.448) (-1490.945) -- 0:03:40
200000 -- (-1481.051) [-1484.403] (-1487.330) (-1490.965) * (-1477.791) (-1477.721) (-1484.552) [-1475.925] -- 0:03:40
Average standard deviation of split frequencies: 0.013625
200500 -- [-1480.513] (-1473.153) (-1489.315) (-1496.362) * (-1481.453) [-1475.285] (-1491.186) (-1482.581) -- 0:03:39
201000 -- (-1480.913) (-1493.392) [-1487.605] (-1483.374) * (-1489.826) (-1470.824) [-1480.094] (-1480.680) -- 0:03:38
201500 -- (-1482.160) (-1484.609) [-1477.314] (-1487.929) * [-1488.541] (-1490.966) (-1481.771) (-1482.866) -- 0:03:37
202000 -- (-1470.787) (-1484.825) (-1490.137) [-1490.615] * (-1494.631) [-1481.186] (-1480.643) (-1485.179) -- 0:03:41
202500 -- (-1488.545) (-1497.322) (-1496.672) [-1486.291] * (-1480.988) [-1472.234] (-1469.654) (-1506.894) -- 0:03:40
203000 -- [-1476.111] (-1483.381) (-1499.109) (-1493.691) * (-1478.972) (-1487.118) [-1480.081] (-1488.140) -- 0:03:39
203500 -- (-1480.615) [-1482.465] (-1505.495) (-1503.302) * [-1476.331] (-1478.246) (-1475.361) (-1495.411) -- 0:03:39
204000 -- (-1477.458) (-1492.062) [-1478.586] (-1501.907) * (-1499.592) (-1469.476) [-1483.357] (-1486.913) -- 0:03:38
204500 -- (-1485.049) (-1485.048) [-1484.855] (-1484.615) * [-1479.060] (-1508.516) (-1475.175) (-1485.886) -- 0:03:37
205000 -- (-1485.515) [-1480.324] (-1481.349) (-1478.675) * [-1482.373] (-1495.601) (-1478.994) (-1476.052) -- 0:03:41
Average standard deviation of split frequencies: 0.011785
205500 -- (-1480.299) [-1492.100] (-1476.839) (-1495.407) * (-1488.603) (-1494.584) (-1488.783) [-1475.859] -- 0:03:40
206000 -- [-1487.570] (-1478.163) (-1481.998) (-1493.991) * (-1478.026) (-1493.433) (-1483.172) [-1488.226] -- 0:03:39
206500 -- (-1485.385) (-1481.883) [-1477.489] (-1488.103) * (-1483.190) (-1493.674) [-1479.080] (-1474.700) -- 0:03:39
207000 -- (-1486.774) (-1488.431) [-1479.568] (-1490.273) * [-1476.633] (-1489.997) (-1476.565) (-1482.418) -- 0:03:38
207500 -- (-1476.957) (-1492.617) (-1486.356) [-1478.409] * (-1500.097) (-1477.205) (-1487.286) [-1479.058] -- 0:03:37
208000 -- (-1492.848) (-1488.729) (-1476.522) [-1474.768] * (-1477.708) (-1490.137) [-1476.711] (-1489.823) -- 0:03:37
208500 -- (-1488.824) [-1476.443] (-1482.925) (-1487.959) * (-1498.609) (-1492.604) (-1470.445) [-1477.322] -- 0:03:40
209000 -- (-1486.989) (-1481.533) (-1489.064) [-1477.173] * [-1495.255] (-1483.842) (-1494.503) (-1484.215) -- 0:03:39
209500 -- (-1475.822) (-1485.093) [-1479.741] (-1496.129) * (-1500.328) (-1487.939) [-1488.112] (-1493.278) -- 0:03:38
210000 -- (-1474.163) (-1487.725) (-1481.629) [-1473.403] * (-1487.711) (-1479.747) [-1476.745] (-1486.642) -- 0:03:38
Average standard deviation of split frequencies: 0.013985
210500 -- (-1487.294) (-1484.297) [-1484.384] (-1489.261) * (-1487.077) (-1485.259) (-1481.899) [-1479.541] -- 0:03:37
211000 -- [-1488.004] (-1481.339) (-1483.984) (-1485.877) * [-1483.253] (-1480.082) (-1480.660) (-1492.436) -- 0:03:36
211500 -- (-1486.740) (-1483.580) (-1479.719) [-1471.901] * (-1485.594) (-1487.293) [-1484.816] (-1481.180) -- 0:03:36
212000 -- (-1488.012) (-1473.659) [-1484.342] (-1476.067) * [-1479.595] (-1487.175) (-1475.716) (-1484.033) -- 0:03:35
212500 -- (-1493.989) (-1476.257) (-1485.722) [-1476.388] * (-1489.431) (-1489.560) (-1497.911) [-1483.874] -- 0:03:38
213000 -- (-1490.478) (-1483.267) (-1483.744) [-1474.472] * (-1490.514) (-1483.824) [-1480.221] (-1485.329) -- 0:03:37
213500 -- (-1500.645) [-1487.472] (-1489.946) (-1483.613) * [-1478.595] (-1479.129) (-1487.692) (-1484.698) -- 0:03:37
214000 -- (-1483.711) (-1475.494) [-1477.461] (-1477.111) * (-1502.770) (-1478.281) (-1498.236) [-1485.104] -- 0:03:36
214500 -- (-1482.737) (-1490.268) (-1479.162) [-1474.934] * (-1501.282) [-1486.839] (-1486.716) (-1480.339) -- 0:03:36
215000 -- (-1489.636) [-1480.833] (-1482.113) (-1497.182) * (-1474.335) (-1489.058) (-1477.474) [-1478.537] -- 0:03:35
Average standard deviation of split frequencies: 0.012549
215500 -- (-1476.279) (-1488.486) (-1494.004) [-1476.298] * (-1483.121) [-1479.946] (-1498.435) (-1480.875) -- 0:03:34
216000 -- (-1494.685) [-1480.476] (-1486.611) (-1485.569) * [-1476.458] (-1484.402) (-1507.713) (-1479.757) -- 0:03:37
216500 -- (-1500.514) (-1468.480) (-1490.479) [-1489.833] * (-1486.630) (-1479.836) [-1485.454] (-1480.790) -- 0:03:37
217000 -- (-1475.488) (-1473.440) (-1488.798) [-1482.287] * (-1488.620) (-1485.215) (-1489.029) [-1481.262] -- 0:03:36
217500 -- (-1494.174) [-1476.437] (-1483.628) (-1477.937) * (-1485.828) (-1485.458) [-1482.764] (-1481.691) -- 0:03:35
218000 -- (-1497.137) (-1488.102) (-1487.224) [-1480.635] * (-1493.005) (-1480.295) [-1480.215] (-1487.681) -- 0:03:35
218500 -- [-1475.407] (-1473.047) (-1489.870) (-1494.675) * (-1486.275) (-1483.366) [-1478.633] (-1477.967) -- 0:03:34
219000 -- [-1479.223] (-1497.638) (-1480.675) (-1485.217) * (-1484.566) (-1485.260) (-1486.099) [-1476.408] -- 0:03:33
219500 -- [-1480.935] (-1482.981) (-1484.247) (-1476.940) * [-1477.990] (-1485.343) (-1481.234) (-1481.568) -- 0:03:33
220000 -- (-1498.807) (-1488.062) (-1476.332) [-1482.475] * [-1481.854] (-1473.354) (-1487.119) (-1487.842) -- 0:03:36
Average standard deviation of split frequencies: 0.013352
220500 -- (-1483.113) (-1502.323) [-1484.026] (-1488.015) * [-1482.268] (-1481.505) (-1474.574) (-1481.871) -- 0:03:35
221000 -- [-1479.382] (-1481.998) (-1478.830) (-1481.634) * (-1482.639) (-1477.126) (-1490.571) [-1479.247] -- 0:03:35
221500 -- (-1474.960) [-1466.340] (-1485.184) (-1491.034) * (-1490.403) (-1480.311) (-1485.022) [-1480.765] -- 0:03:34
222000 -- (-1482.073) (-1477.566) [-1488.407] (-1486.465) * (-1479.833) [-1477.941] (-1492.090) (-1482.342) -- 0:03:33
222500 -- (-1478.682) (-1495.268) [-1474.431] (-1488.140) * (-1474.762) (-1484.220) (-1484.284) [-1482.041] -- 0:03:33
223000 -- (-1491.401) [-1471.588] (-1481.477) (-1487.898) * (-1476.745) (-1485.101) (-1501.916) [-1473.625] -- 0:03:32
223500 -- (-1486.011) [-1473.761] (-1483.238) (-1480.217) * (-1482.627) (-1486.343) (-1487.687) [-1476.487] -- 0:03:35
224000 -- (-1514.167) (-1477.305) [-1477.229] (-1494.344) * (-1478.203) (-1489.371) (-1483.970) [-1470.851] -- 0:03:34
224500 -- (-1485.695) [-1469.723] (-1496.644) (-1475.625) * (-1479.302) (-1491.335) (-1478.011) [-1483.534] -- 0:03:34
225000 -- (-1496.826) [-1483.560] (-1493.804) (-1480.392) * [-1487.143] (-1480.341) (-1484.691) (-1476.307) -- 0:03:33
Average standard deviation of split frequencies: 0.012307
225500 -- [-1490.459] (-1492.602) (-1481.779) (-1503.174) * (-1477.720) (-1491.920) [-1484.809] (-1483.467) -- 0:03:32
226000 -- (-1486.736) (-1495.270) (-1483.815) [-1476.393] * (-1482.378) [-1484.510] (-1480.929) (-1476.787) -- 0:03:32
226500 -- (-1492.404) (-1497.658) [-1476.039] (-1480.227) * (-1488.631) (-1487.027) (-1486.211) [-1477.876] -- 0:03:31
227000 -- (-1495.722) (-1498.745) (-1481.772) [-1469.583] * (-1476.620) [-1490.009] (-1487.480) (-1494.366) -- 0:03:31
227500 -- (-1489.141) (-1489.523) [-1482.105] (-1473.407) * (-1480.812) (-1500.808) [-1478.535] (-1488.676) -- 0:03:33
228000 -- (-1487.682) (-1485.192) [-1483.531] (-1485.515) * (-1481.294) (-1503.697) (-1485.582) [-1479.981] -- 0:03:33
228500 -- (-1485.594) (-1485.544) [-1480.744] (-1507.927) * [-1473.399] (-1487.447) (-1484.296) (-1489.557) -- 0:03:32
229000 -- [-1478.859] (-1488.452) (-1479.912) (-1497.475) * [-1484.809] (-1470.855) (-1503.439) (-1479.863) -- 0:03:32
229500 -- [-1477.675] (-1491.147) (-1478.837) (-1494.807) * (-1489.565) (-1476.567) (-1484.900) [-1482.732] -- 0:03:31
230000 -- [-1469.890] (-1494.541) (-1497.994) (-1474.879) * (-1492.311) [-1474.689] (-1481.914) (-1492.178) -- 0:03:30
Average standard deviation of split frequencies: 0.013590
230500 -- (-1487.548) [-1474.674] (-1478.916) (-1491.039) * (-1497.532) (-1475.825) (-1486.348) [-1483.800] -- 0:03:30
231000 -- [-1494.746] (-1487.145) (-1484.347) (-1488.848) * (-1474.576) [-1474.305] (-1488.117) (-1479.272) -- 0:03:33
231500 -- (-1491.369) [-1482.462] (-1487.552) (-1483.378) * [-1473.143] (-1473.189) (-1485.320) (-1480.110) -- 0:03:32
232000 -- (-1484.660) (-1490.889) (-1500.168) [-1471.986] * (-1477.411) (-1482.724) (-1497.663) [-1469.733] -- 0:03:31
232500 -- (-1477.413) [-1484.939] (-1501.421) (-1480.720) * (-1467.805) (-1488.490) (-1474.125) [-1483.053] -- 0:03:31
233000 -- (-1477.619) (-1496.923) (-1493.111) [-1476.078] * [-1478.876] (-1483.341) (-1491.327) (-1481.003) -- 0:03:30
233500 -- (-1495.137) (-1490.097) (-1485.951) [-1479.516] * (-1487.211) (-1481.204) [-1483.328] (-1496.615) -- 0:03:30
234000 -- (-1491.609) (-1480.097) (-1493.829) [-1473.296] * (-1483.229) [-1486.233] (-1480.743) (-1485.022) -- 0:03:29
234500 -- (-1480.480) (-1478.922) (-1485.359) [-1469.119] * (-1486.764) (-1486.760) [-1474.700] (-1494.556) -- 0:03:28
235000 -- (-1485.122) (-1478.682) (-1483.963) [-1468.878] * (-1499.424) (-1482.418) (-1483.862) [-1469.005] -- 0:03:31
Average standard deviation of split frequencies: 0.013483
235500 -- (-1481.207) [-1478.996] (-1478.580) (-1480.575) * (-1492.616) (-1501.378) [-1469.283] (-1481.509) -- 0:03:31
236000 -- (-1471.868) [-1480.057] (-1497.120) (-1501.322) * (-1499.251) (-1491.232) [-1473.519] (-1496.983) -- 0:03:30
236500 -- (-1478.462) (-1483.724) (-1484.338) [-1479.965] * (-1477.343) [-1483.236] (-1481.058) (-1487.618) -- 0:03:29
237000 -- [-1484.017] (-1487.178) (-1495.787) (-1482.038) * (-1480.338) (-1482.692) [-1485.274] (-1482.525) -- 0:03:29
237500 -- (-1491.613) (-1502.428) (-1488.209) [-1472.062] * (-1489.186) (-1492.328) (-1490.750) [-1476.953] -- 0:03:28
238000 -- (-1486.436) [-1494.823] (-1479.305) (-1478.589) * [-1469.720] (-1476.719) (-1494.112) (-1490.470) -- 0:03:31
238500 -- [-1482.601] (-1497.214) (-1484.876) (-1475.900) * (-1476.913) (-1483.569) (-1486.283) [-1495.861] -- 0:03:30
239000 -- [-1479.664] (-1488.539) (-1472.828) (-1487.986) * (-1502.943) (-1472.877) [-1476.211] (-1480.922) -- 0:03:30
239500 -- [-1479.414] (-1479.868) (-1478.194) (-1484.245) * [-1487.776] (-1490.582) (-1482.263) (-1482.180) -- 0:03:29
240000 -- [-1475.195] (-1480.494) (-1482.344) (-1478.383) * (-1472.854) [-1485.763] (-1480.301) (-1508.553) -- 0:03:29
Average standard deviation of split frequencies: 0.014789
240500 -- (-1477.382) [-1471.168] (-1483.987) (-1503.978) * (-1489.004) (-1482.802) (-1496.390) [-1489.897] -- 0:03:28
241000 -- (-1491.519) (-1476.210) [-1477.192] (-1485.241) * (-1507.186) [-1472.650] (-1484.609) (-1474.637) -- 0:03:27
241500 -- [-1474.973] (-1489.799) (-1483.214) (-1487.600) * (-1490.148) (-1477.368) (-1482.966) [-1478.586] -- 0:03:27
242000 -- (-1484.034) [-1488.092] (-1480.298) (-1487.838) * (-1482.861) [-1467.299] (-1481.069) (-1496.300) -- 0:03:29
242500 -- (-1488.980) [-1483.387] (-1473.780) (-1497.265) * (-1485.440) (-1484.913) (-1483.680) [-1478.214] -- 0:03:29
243000 -- (-1478.873) [-1475.915] (-1486.688) (-1488.919) * [-1479.058] (-1484.863) (-1493.493) (-1473.870) -- 0:03:28
243500 -- [-1494.396] (-1480.093) (-1480.091) (-1479.741) * (-1484.019) (-1488.374) [-1484.381] (-1482.420) -- 0:03:28
244000 -- (-1490.791) (-1480.837) (-1484.386) [-1473.926] * (-1481.011) (-1485.516) [-1478.344] (-1482.251) -- 0:03:27
244500 -- (-1486.489) (-1483.182) [-1471.348] (-1503.568) * (-1485.166) (-1480.759) [-1480.966] (-1485.422) -- 0:03:27
245000 -- (-1488.252) (-1478.440) [-1472.386] (-1488.562) * [-1476.442] (-1490.143) (-1483.684) (-1494.139) -- 0:03:26
Average standard deviation of split frequencies: 0.014947
245500 -- (-1478.573) (-1484.074) [-1476.417] (-1476.760) * (-1482.908) [-1469.915] (-1489.053) (-1501.453) -- 0:03:28
246000 -- (-1482.035) (-1486.489) [-1475.080] (-1496.509) * (-1484.890) (-1488.924) [-1475.169] (-1482.386) -- 0:03:28
246500 -- (-1488.908) [-1486.440] (-1484.438) (-1486.782) * (-1481.376) (-1484.789) [-1482.198] (-1494.555) -- 0:03:27
247000 -- (-1485.089) (-1487.172) [-1482.206] (-1487.078) * (-1485.211) [-1479.230] (-1494.084) (-1491.500) -- 0:03:27
247500 -- (-1495.351) [-1485.484] (-1474.050) (-1482.580) * (-1483.574) (-1490.811) [-1479.333] (-1493.139) -- 0:03:26
248000 -- (-1496.627) [-1475.774] (-1477.292) (-1485.134) * (-1481.630) [-1480.156] (-1482.671) (-1492.802) -- 0:03:26
248500 -- (-1494.380) (-1475.571) [-1473.447] (-1491.990) * (-1487.020) (-1484.239) [-1485.671] (-1490.025) -- 0:03:25
249000 -- (-1488.421) (-1492.933) [-1482.000] (-1494.418) * (-1492.573) [-1487.945] (-1494.905) (-1490.332) -- 0:03:28
249500 -- (-1485.063) [-1472.422] (-1482.548) (-1488.850) * (-1480.871) (-1488.417) [-1488.983] (-1485.422) -- 0:03:27
250000 -- [-1480.727] (-1479.325) (-1480.972) (-1487.126) * [-1472.553] (-1505.388) (-1487.817) (-1487.356) -- 0:03:27
Average standard deviation of split frequencies: 0.016173
250500 -- (-1493.548) (-1487.085) [-1478.470] (-1494.791) * (-1480.017) (-1476.793) [-1478.862] (-1487.015) -- 0:03:26
251000 -- (-1494.006) (-1488.882) (-1490.112) [-1484.487] * (-1498.747) [-1477.628] (-1479.560) (-1483.277) -- 0:03:25
251500 -- [-1485.269] (-1474.369) (-1479.926) (-1490.002) * (-1513.834) (-1486.982) (-1474.680) [-1496.123] -- 0:03:25
252000 -- (-1492.056) (-1484.634) [-1492.664] (-1491.249) * (-1480.346) (-1491.119) (-1475.487) [-1488.909] -- 0:03:24
252500 -- (-1476.043) (-1488.851) (-1489.986) [-1485.899] * (-1479.140) (-1484.546) [-1485.386] (-1487.950) -- 0:03:24
253000 -- [-1484.295] (-1486.009) (-1489.440) (-1492.270) * (-1486.545) (-1484.485) [-1480.196] (-1492.201) -- 0:03:26
253500 -- (-1490.141) (-1489.357) [-1478.806] (-1482.841) * (-1474.478) (-1483.551) (-1481.326) [-1478.350] -- 0:03:26
254000 -- (-1501.420) (-1478.694) [-1473.291] (-1490.661) * (-1485.066) (-1486.820) (-1489.688) [-1481.376] -- 0:03:25
254500 -- (-1478.039) (-1483.196) [-1478.329] (-1483.555) * (-1493.050) [-1482.577] (-1479.911) (-1485.345) -- 0:03:25
255000 -- [-1481.252] (-1476.732) (-1484.009) (-1485.494) * [-1478.081] (-1488.874) (-1481.341) (-1497.175) -- 0:03:24
Average standard deviation of split frequencies: 0.015836
255500 -- [-1482.354] (-1488.622) (-1488.645) (-1482.308) * (-1485.637) (-1479.863) (-1476.250) [-1467.937] -- 0:03:23
256000 -- (-1481.846) [-1480.327] (-1484.091) (-1483.135) * (-1477.268) [-1484.665] (-1481.930) (-1478.275) -- 0:03:23
256500 -- (-1487.555) (-1491.556) [-1474.935] (-1488.323) * [-1479.036] (-1474.967) (-1499.449) (-1491.699) -- 0:03:25
257000 -- (-1487.131) [-1473.519] (-1479.479) (-1492.855) * [-1474.917] (-1488.919) (-1473.357) (-1492.369) -- 0:03:25
257500 -- (-1478.602) (-1481.076) [-1473.655] (-1473.967) * (-1487.445) [-1484.745] (-1486.694) (-1478.027) -- 0:03:24
258000 -- [-1472.608] (-1483.221) (-1475.089) (-1476.830) * (-1486.164) [-1476.701] (-1479.030) (-1491.724) -- 0:03:24
258500 -- (-1473.783) [-1474.309] (-1479.059) (-1481.758) * (-1486.795) (-1485.242) [-1471.560] (-1483.538) -- 0:03:23
259000 -- (-1482.045) (-1483.799) (-1487.971) [-1469.509] * (-1498.297) [-1475.335] (-1483.675) (-1490.005) -- 0:03:23
259500 -- (-1485.979) [-1478.077] (-1488.871) (-1474.256) * (-1492.313) (-1493.993) (-1483.796) [-1482.015] -- 0:03:22
260000 -- (-1480.541) (-1480.815) (-1486.958) [-1482.935] * (-1499.143) (-1480.321) [-1480.228] (-1484.242) -- 0:03:22
Average standard deviation of split frequencies: 0.015553
260500 -- [-1481.762] (-1485.958) (-1495.405) (-1485.680) * (-1503.347) (-1482.246) [-1476.197] (-1486.186) -- 0:03:24
261000 -- (-1485.126) [-1480.090] (-1493.322) (-1484.496) * (-1491.818) [-1475.958] (-1481.256) (-1486.617) -- 0:03:23
261500 -- (-1480.346) [-1481.329] (-1498.615) (-1482.981) * (-1482.032) (-1474.549) (-1481.238) [-1483.866] -- 0:03:23
262000 -- (-1478.922) (-1484.228) [-1494.711] (-1484.542) * [-1501.091] (-1482.774) (-1482.027) (-1487.110) -- 0:03:22
262500 -- (-1474.185) (-1493.678) (-1498.027) [-1490.175] * [-1490.068] (-1492.858) (-1482.370) (-1471.592) -- 0:03:22
263000 -- (-1482.130) [-1482.178] (-1490.067) (-1494.698) * [-1476.026] (-1488.604) (-1480.745) (-1485.816) -- 0:03:21
263500 -- (-1490.870) [-1473.689] (-1491.032) (-1481.857) * (-1482.192) (-1481.196) [-1479.057] (-1488.798) -- 0:03:21
264000 -- (-1489.985) [-1467.025] (-1489.576) (-1495.614) * (-1483.070) (-1488.951) (-1479.489) [-1480.777] -- 0:03:23
264500 -- (-1487.844) (-1480.545) (-1491.665) [-1483.315] * [-1483.845] (-1490.974) (-1488.725) (-1485.479) -- 0:03:22
265000 -- (-1484.878) [-1479.419] (-1476.826) (-1485.175) * [-1472.783] (-1487.501) (-1491.997) (-1476.016) -- 0:03:22
Average standard deviation of split frequencies: 0.014886
265500 -- (-1483.547) (-1482.778) (-1486.631) [-1476.372] * (-1481.917) (-1488.397) (-1478.080) [-1477.866] -- 0:03:21
266000 -- (-1480.789) (-1473.647) (-1478.846) [-1481.049] * [-1481.476] (-1484.553) (-1480.598) (-1498.102) -- 0:03:21
266500 -- [-1478.397] (-1486.998) (-1479.284) (-1487.125) * (-1480.747) [-1482.072] (-1479.173) (-1487.579) -- 0:03:20
267000 -- (-1481.447) [-1476.057] (-1484.248) (-1479.917) * (-1495.841) (-1490.222) [-1475.612] (-1489.853) -- 0:03:20
267500 -- (-1490.760) [-1480.876] (-1479.770) (-1492.556) * [-1496.683] (-1495.347) (-1488.880) (-1491.665) -- 0:03:19
268000 -- (-1486.590) (-1484.866) (-1494.259) [-1485.635] * (-1486.277) (-1486.624) [-1477.597] (-1493.155) -- 0:03:22
268500 -- [-1483.240] (-1478.515) (-1481.698) (-1475.246) * (-1474.399) [-1479.501] (-1503.660) (-1490.515) -- 0:03:21
269000 -- (-1496.692) (-1486.790) (-1483.403) [-1471.757] * (-1482.451) (-1479.389) [-1488.099] (-1497.885) -- 0:03:21
269500 -- (-1485.023) (-1475.609) (-1481.757) [-1480.054] * [-1489.268] (-1502.877) (-1487.055) (-1501.173) -- 0:03:20
270000 -- (-1477.136) (-1496.333) [-1482.502] (-1475.456) * [-1476.840] (-1504.193) (-1491.787) (-1482.303) -- 0:03:20
Average standard deviation of split frequencies: 0.013062
270500 -- (-1492.343) (-1488.808) (-1491.566) [-1484.350] * (-1485.273) (-1491.692) (-1479.462) [-1476.855] -- 0:03:19
271000 -- (-1479.318) (-1485.007) (-1477.192) [-1478.745] * (-1475.080) (-1483.961) [-1474.777] (-1499.959) -- 0:03:19
271500 -- (-1485.307) [-1480.752] (-1485.751) (-1474.045) * (-1496.964) (-1482.311) (-1480.076) [-1482.290] -- 0:03:21
272000 -- (-1478.268) (-1483.307) (-1496.623) [-1475.067] * (-1484.132) (-1499.915) [-1471.227] (-1486.704) -- 0:03:20
272500 -- (-1491.783) [-1484.207] (-1484.383) (-1480.433) * (-1486.119) (-1485.712) [-1469.663] (-1478.528) -- 0:03:20
273000 -- [-1478.493] (-1492.517) (-1501.816) (-1484.269) * (-1487.134) (-1493.842) (-1478.256) [-1485.656] -- 0:03:19
273500 -- (-1470.728) (-1478.194) [-1475.388] (-1494.366) * (-1482.044) (-1495.639) (-1473.421) [-1479.565] -- 0:03:19
274000 -- (-1491.977) (-1489.003) [-1475.535] (-1478.681) * (-1496.969) (-1487.656) [-1482.952] (-1483.858) -- 0:03:18
274500 -- (-1483.343) (-1500.209) (-1487.529) [-1477.932] * (-1490.089) (-1479.936) (-1479.849) [-1476.928] -- 0:03:18
275000 -- (-1487.148) [-1478.760] (-1478.445) (-1479.498) * (-1491.614) (-1488.643) (-1484.866) [-1483.325] -- 0:03:17
Average standard deviation of split frequencies: 0.012981
275500 -- (-1489.535) (-1481.164) (-1481.457) [-1479.122] * (-1482.790) (-1494.161) (-1484.835) [-1479.362] -- 0:03:19
276000 -- (-1480.808) (-1483.454) (-1486.072) [-1475.961] * (-1476.776) [-1482.408] (-1478.027) (-1484.454) -- 0:03:19
276500 -- (-1494.824) (-1488.581) [-1482.871] (-1475.558) * [-1474.329] (-1498.901) (-1485.795) (-1479.276) -- 0:03:18
277000 -- (-1495.463) (-1486.827) (-1477.345) [-1485.790] * (-1474.214) (-1490.629) [-1480.899] (-1486.298) -- 0:03:18
277500 -- (-1484.918) (-1477.780) (-1495.599) [-1479.156] * (-1475.443) [-1472.839] (-1485.645) (-1481.240) -- 0:03:17
278000 -- (-1480.255) [-1487.316] (-1480.528) (-1491.204) * [-1482.101] (-1491.784) (-1490.654) (-1483.557) -- 0:03:17
278500 -- (-1491.070) (-1483.564) [-1468.793] (-1486.443) * [-1478.256] (-1488.335) (-1479.026) (-1485.228) -- 0:03:16
279000 -- (-1473.405) (-1482.080) [-1480.965] (-1483.132) * (-1482.000) (-1480.235) (-1476.844) [-1482.440] -- 0:03:18
279500 -- (-1488.317) (-1478.165) [-1479.854] (-1482.257) * (-1475.011) [-1481.287] (-1495.528) (-1477.567) -- 0:03:18
280000 -- (-1480.351) (-1481.490) [-1477.986] (-1483.547) * (-1475.285) (-1479.245) (-1505.806) [-1478.989] -- 0:03:18
Average standard deviation of split frequencies: 0.013185
280500 -- (-1477.128) [-1476.938] (-1495.743) (-1486.568) * (-1488.451) (-1492.466) [-1484.352] (-1496.239) -- 0:03:17
281000 -- (-1484.131) [-1481.640] (-1484.391) (-1494.664) * (-1489.548) (-1504.391) [-1489.536] (-1485.546) -- 0:03:17
281500 -- (-1479.043) [-1478.741] (-1480.980) (-1486.902) * [-1489.392] (-1491.406) (-1472.352) (-1484.064) -- 0:03:16
282000 -- (-1498.052) (-1487.421) [-1484.410] (-1481.915) * [-1475.147] (-1487.812) (-1492.542) (-1487.026) -- 0:03:16
282500 -- (-1481.647) [-1489.848] (-1478.374) (-1477.740) * (-1495.817) (-1495.251) [-1488.757] (-1488.441) -- 0:03:15
283000 -- [-1490.982] (-1480.531) (-1494.902) (-1477.838) * [-1480.133] (-1488.444) (-1483.658) (-1507.379) -- 0:03:17
283500 -- (-1487.556) (-1486.619) (-1496.161) [-1481.100] * [-1485.537] (-1491.496) (-1489.139) (-1494.298) -- 0:03:17
284000 -- (-1494.329) (-1487.525) (-1477.635) [-1482.068] * (-1482.541) (-1488.322) [-1477.238] (-1518.632) -- 0:03:16
284500 -- [-1473.129] (-1484.535) (-1494.544) (-1479.914) * (-1493.007) (-1485.703) [-1470.314] (-1497.498) -- 0:03:16
285000 -- [-1477.538] (-1484.351) (-1485.662) (-1481.960) * [-1483.237] (-1481.993) (-1495.262) (-1491.874) -- 0:03:15
Average standard deviation of split frequencies: 0.013351
285500 -- [-1476.027] (-1494.051) (-1477.799) (-1484.487) * (-1475.850) [-1474.444] (-1479.236) (-1503.091) -- 0:03:15
286000 -- (-1482.911) (-1495.537) (-1478.700) [-1480.674] * [-1480.085] (-1491.096) (-1488.254) (-1492.924) -- 0:03:14
286500 -- (-1482.159) (-1490.483) [-1477.157] (-1472.713) * (-1486.213) (-1494.661) [-1476.495] (-1480.232) -- 0:03:14
287000 -- (-1477.626) (-1479.659) [-1484.813] (-1488.187) * (-1479.181) (-1487.239) (-1477.736) [-1476.124] -- 0:03:16
287500 -- (-1502.228) (-1488.591) (-1477.960) [-1476.980] * (-1498.589) (-1486.812) [-1485.167] (-1490.464) -- 0:03:15
288000 -- [-1481.603] (-1483.835) (-1486.646) (-1478.144) * (-1483.053) (-1501.355) [-1474.136] (-1484.256) -- 0:03:15
288500 -- [-1484.969] (-1477.190) (-1492.627) (-1480.483) * (-1482.613) [-1479.806] (-1497.051) (-1495.666) -- 0:03:14
289000 -- (-1478.845) (-1490.566) (-1481.684) [-1478.487] * (-1476.985) [-1474.934] (-1498.497) (-1488.549) -- 0:03:14
289500 -- (-1487.540) (-1482.189) (-1485.970) [-1475.589] * [-1473.154] (-1491.235) (-1496.741) (-1481.001) -- 0:03:13
290000 -- [-1483.891] (-1486.789) (-1485.972) (-1479.109) * (-1487.764) (-1479.051) (-1492.788) [-1481.617] -- 0:03:13
Average standard deviation of split frequencies: 0.014191
290500 -- (-1483.427) (-1479.651) [-1478.485] (-1488.035) * (-1487.839) [-1470.468] (-1481.995) (-1494.747) -- 0:03:15
291000 -- (-1479.712) (-1498.639) [-1481.774] (-1487.203) * [-1477.975] (-1476.487) (-1490.253) (-1497.094) -- 0:03:14
291500 -- (-1484.024) (-1490.968) [-1472.397] (-1479.480) * (-1483.610) [-1477.101] (-1488.512) (-1489.106) -- 0:03:14
292000 -- (-1494.179) (-1494.270) (-1472.010) [-1469.715] * [-1483.476] (-1478.131) (-1484.045) (-1498.251) -- 0:03:13
292500 -- (-1494.337) (-1482.954) (-1485.859) [-1469.211] * (-1499.277) [-1487.025] (-1488.907) (-1487.641) -- 0:03:13
293000 -- (-1500.866) (-1483.498) [-1484.552] (-1470.173) * (-1481.655) (-1480.807) (-1488.799) [-1486.258] -- 0:03:13
293500 -- (-1490.797) (-1484.279) [-1474.107] (-1484.236) * (-1478.969) (-1498.970) [-1470.842] (-1480.381) -- 0:03:12
294000 -- (-1487.554) (-1490.261) (-1481.333) [-1484.353] * (-1476.447) (-1495.362) [-1476.930] (-1495.002) -- 0:03:12
294500 -- (-1501.835) (-1480.472) [-1474.954] (-1476.184) * (-1491.795) [-1480.229] (-1489.190) (-1485.276) -- 0:03:14
295000 -- (-1487.360) [-1473.599] (-1482.222) (-1484.032) * (-1481.277) (-1484.003) (-1489.770) [-1481.753] -- 0:03:13
Average standard deviation of split frequencies: 0.013457
295500 -- [-1481.981] (-1478.770) (-1481.718) (-1482.724) * [-1471.890] (-1494.258) (-1494.870) (-1491.922) -- 0:03:13
296000 -- [-1484.133] (-1486.101) (-1498.515) (-1484.525) * (-1496.785) (-1488.524) (-1500.373) [-1476.840] -- 0:03:12
296500 -- (-1490.952) [-1482.737] (-1481.634) (-1477.620) * [-1481.735] (-1495.236) (-1489.661) (-1475.066) -- 0:03:12
297000 -- (-1484.075) (-1492.519) (-1482.911) [-1479.765] * (-1486.958) [-1479.533] (-1491.681) (-1490.699) -- 0:03:11
297500 -- (-1499.472) [-1475.067] (-1484.005) (-1480.243) * (-1490.614) (-1490.962) (-1495.896) [-1475.544] -- 0:03:11
298000 -- (-1492.448) [-1481.588] (-1483.150) (-1499.224) * [-1479.460] (-1495.512) (-1485.822) (-1479.028) -- 0:03:13
298500 -- [-1486.321] (-1493.115) (-1479.716) (-1478.563) * [-1482.318] (-1492.753) (-1498.902) (-1483.491) -- 0:03:12
299000 -- (-1480.313) (-1473.434) [-1485.978] (-1492.480) * [-1480.873] (-1481.988) (-1492.281) (-1491.218) -- 0:03:12
299500 -- (-1482.995) (-1489.463) (-1482.014) [-1477.379] * (-1484.843) (-1476.891) (-1484.049) [-1480.837] -- 0:03:11
300000 -- [-1471.178] (-1482.705) (-1476.941) (-1479.437) * (-1483.251) (-1480.268) (-1488.286) [-1491.849] -- 0:03:11
Average standard deviation of split frequencies: 0.011759
300500 -- (-1480.195) (-1481.180) (-1479.091) [-1477.611] * (-1495.675) (-1480.206) (-1492.406) [-1482.682] -- 0:03:10
301000 -- (-1478.407) [-1476.793] (-1487.268) (-1490.619) * [-1481.104] (-1493.099) (-1498.854) (-1475.391) -- 0:03:10
301500 -- [-1476.587] (-1494.461) (-1497.621) (-1484.640) * (-1482.920) [-1475.735] (-1494.750) (-1483.542) -- 0:03:12
302000 -- (-1483.175) (-1505.090) [-1479.980] (-1484.774) * (-1485.727) (-1473.613) (-1487.091) [-1480.728] -- 0:03:11
302500 -- (-1483.765) [-1482.194] (-1485.186) (-1496.465) * (-1496.458) (-1479.030) (-1480.616) [-1475.771] -- 0:03:11
303000 -- (-1480.966) (-1478.933) [-1485.683] (-1493.172) * (-1483.388) (-1484.229) (-1478.955) [-1479.358] -- 0:03:10
303500 -- (-1491.258) (-1486.320) (-1474.437) [-1475.266] * (-1488.792) (-1484.028) (-1491.019) [-1473.072] -- 0:03:10
304000 -- (-1481.730) (-1472.053) (-1485.354) [-1478.309] * (-1479.933) (-1484.900) (-1480.957) [-1479.266] -- 0:03:10
304500 -- [-1474.010] (-1494.108) (-1494.819) (-1481.724) * (-1483.882) (-1487.997) (-1482.245) [-1481.769] -- 0:03:09
305000 -- (-1498.162) (-1487.919) (-1483.060) [-1479.343] * [-1481.377] (-1500.435) (-1474.745) (-1488.052) -- 0:03:09
Average standard deviation of split frequencies: 0.012247
305500 -- [-1483.324] (-1489.287) (-1490.379) (-1483.863) * (-1489.112) (-1492.005) (-1491.564) [-1474.361] -- 0:03:10
306000 -- [-1479.182] (-1484.591) (-1478.929) (-1495.387) * (-1485.376) [-1472.445] (-1488.431) (-1481.323) -- 0:03:10
306500 -- [-1486.071] (-1498.402) (-1483.791) (-1486.884) * [-1484.610] (-1487.342) (-1487.955) (-1495.314) -- 0:03:10
307000 -- (-1478.462) (-1487.169) [-1479.139] (-1500.870) * [-1484.469] (-1482.109) (-1487.100) (-1480.398) -- 0:03:09
307500 -- (-1483.384) [-1485.241] (-1473.411) (-1509.624) * (-1493.852) (-1490.760) (-1491.813) [-1479.432] -- 0:03:09
308000 -- (-1488.306) (-1487.090) [-1476.254] (-1488.617) * (-1478.943) (-1488.771) [-1484.717] (-1478.028) -- 0:03:08
308500 -- (-1484.432) [-1487.451] (-1482.557) (-1482.945) * (-1485.653) (-1477.162) (-1483.666) [-1486.103] -- 0:03:08
309000 -- (-1492.103) (-1483.728) (-1479.094) [-1471.353] * (-1481.182) (-1482.887) (-1487.262) [-1477.327] -- 0:03:07
309500 -- (-1488.459) [-1488.664] (-1488.293) (-1478.618) * (-1488.605) (-1478.691) [-1466.128] (-1486.396) -- 0:03:09
310000 -- [-1483.341] (-1491.478) (-1484.377) (-1474.196) * [-1470.434] (-1480.436) (-1487.320) (-1483.401) -- 0:03:09
Average standard deviation of split frequencies: 0.011229
310500 -- (-1474.043) (-1488.627) (-1485.188) [-1474.914] * (-1487.630) (-1489.891) (-1479.748) [-1490.002] -- 0:03:08
311000 -- (-1495.505) [-1484.254] (-1476.823) (-1479.361) * [-1488.444] (-1489.279) (-1489.916) (-1482.587) -- 0:03:08
311500 -- [-1480.111] (-1488.073) (-1486.536) (-1472.881) * [-1488.723] (-1482.131) (-1488.351) (-1491.205) -- 0:03:07
312000 -- (-1481.648) (-1494.439) (-1484.521) [-1479.495] * (-1487.988) (-1489.076) [-1472.360] (-1480.862) -- 0:03:07
312500 -- [-1482.715] (-1495.467) (-1496.408) (-1485.840) * (-1490.023) [-1482.617] (-1489.806) (-1520.113) -- 0:03:07
313000 -- (-1481.754) (-1502.540) [-1473.314] (-1484.144) * (-1479.518) (-1480.834) [-1480.405] (-1509.039) -- 0:03:08
313500 -- (-1485.326) (-1491.050) (-1481.620) [-1481.681] * [-1480.703] (-1478.474) (-1494.858) (-1492.758) -- 0:03:08
314000 -- (-1486.371) (-1490.318) (-1489.532) [-1474.668] * (-1488.295) [-1481.340] (-1476.666) (-1474.690) -- 0:03:07
314500 -- [-1475.042] (-1481.543) (-1487.891) (-1488.943) * (-1481.486) (-1487.400) [-1476.820] (-1476.406) -- 0:03:07
315000 -- (-1476.843) (-1496.234) (-1493.131) [-1476.423] * (-1491.614) (-1477.655) (-1486.472) [-1482.806] -- 0:03:07
Average standard deviation of split frequencies: 0.011338
315500 -- [-1474.895] (-1486.520) (-1493.227) (-1471.683) * (-1494.668) (-1479.186) [-1481.918] (-1489.064) -- 0:03:06
316000 -- [-1486.023] (-1493.399) (-1475.472) (-1483.468) * (-1484.154) (-1486.936) [-1485.185] (-1480.947) -- 0:03:06
316500 -- (-1482.909) (-1488.404) [-1476.284] (-1483.742) * (-1488.999) [-1475.812] (-1485.774) (-1491.206) -- 0:03:05
317000 -- (-1473.262) [-1482.576] (-1478.792) (-1482.858) * (-1500.332) [-1471.098] (-1480.321) (-1491.350) -- 0:03:07
317500 -- (-1489.218) (-1479.246) [-1472.473] (-1496.037) * (-1497.060) (-1475.715) (-1479.275) [-1473.589] -- 0:03:07
318000 -- (-1483.204) (-1484.675) [-1479.183] (-1485.420) * (-1482.423) (-1482.355) (-1492.508) [-1476.119] -- 0:03:06
318500 -- [-1476.801] (-1483.796) (-1487.019) (-1484.828) * (-1471.593) (-1476.398) [-1495.886] (-1488.978) -- 0:03:06
319000 -- (-1482.305) (-1489.095) (-1470.850) [-1473.589] * [-1469.086] (-1479.119) (-1496.139) (-1485.560) -- 0:03:05
319500 -- [-1473.915] (-1489.006) (-1486.818) (-1478.229) * (-1482.371) [-1479.649] (-1476.885) (-1491.297) -- 0:03:05
320000 -- (-1477.459) (-1483.439) (-1489.065) [-1482.658] * (-1496.967) (-1486.204) [-1476.056] (-1479.599) -- 0:03:04
Average standard deviation of split frequencies: 0.010291
320500 -- [-1473.390] (-1484.611) (-1483.231) (-1484.589) * (-1483.949) (-1482.463) (-1489.012) [-1484.785] -- 0:03:06
321000 -- (-1476.946) [-1479.651] (-1482.398) (-1477.923) * (-1477.214) (-1487.950) [-1479.727] (-1489.286) -- 0:03:06
321500 -- (-1487.514) (-1484.340) (-1474.506) [-1475.759] * (-1500.066) [-1481.468] (-1493.919) (-1478.546) -- 0:03:05
322000 -- (-1495.059) [-1472.993] (-1489.713) (-1493.486) * (-1480.478) [-1475.449] (-1492.850) (-1487.377) -- 0:03:05
322500 -- (-1487.277) [-1478.896] (-1487.890) (-1490.678) * (-1477.605) (-1471.200) [-1467.823] (-1489.376) -- 0:03:04
323000 -- (-1481.221) (-1488.265) (-1495.704) [-1476.922] * (-1495.580) [-1484.124] (-1475.030) (-1481.814) -- 0:03:04
323500 -- [-1477.601] (-1484.397) (-1495.183) (-1496.307) * (-1495.042) (-1484.078) (-1483.693) [-1482.997] -- 0:03:04
324000 -- [-1475.753] (-1491.015) (-1478.479) (-1486.719) * (-1486.072) (-1490.867) [-1479.907] (-1475.043) -- 0:03:03
324500 -- (-1483.687) [-1484.037] (-1475.769) (-1477.602) * (-1485.539) [-1476.234] (-1499.947) (-1481.633) -- 0:03:05
325000 -- (-1498.540) (-1487.162) (-1478.055) [-1476.228] * (-1483.255) (-1473.949) (-1482.034) [-1487.442] -- 0:03:04
Average standard deviation of split frequencies: 0.010267
325500 -- (-1476.395) (-1494.164) (-1475.727) [-1472.583] * (-1489.379) (-1481.103) (-1487.690) [-1480.516] -- 0:03:04
326000 -- (-1482.520) (-1481.181) (-1482.936) [-1470.400] * [-1484.803] (-1492.919) (-1483.354) (-1487.367) -- 0:03:04
326500 -- (-1486.511) [-1478.807] (-1479.500) (-1494.134) * [-1473.662] (-1480.415) (-1485.384) (-1475.105) -- 0:03:03
327000 -- (-1488.163) (-1480.558) (-1475.498) [-1469.270] * (-1481.473) (-1478.641) [-1477.391] (-1482.938) -- 0:03:03
327500 -- (-1482.297) (-1473.850) (-1477.443) [-1485.482] * (-1479.364) (-1487.546) (-1487.236) [-1481.902] -- 0:03:02
328000 -- (-1499.359) (-1479.294) (-1475.261) [-1472.116] * (-1486.114) (-1481.274) (-1488.223) [-1475.994] -- 0:03:04
328500 -- (-1478.463) [-1476.363] (-1490.105) (-1478.068) * [-1483.312] (-1472.022) (-1494.156) (-1494.663) -- 0:03:03
329000 -- (-1491.317) [-1477.494] (-1483.599) (-1473.485) * (-1481.668) [-1480.748] (-1491.841) (-1480.180) -- 0:03:03
329500 -- (-1488.506) [-1470.548] (-1484.979) (-1488.252) * (-1480.193) (-1478.664) [-1484.665] (-1482.452) -- 0:03:03
330000 -- [-1477.089] (-1486.404) (-1480.138) (-1474.189) * [-1480.379] (-1484.521) (-1485.059) (-1495.677) -- 0:03:02
Average standard deviation of split frequencies: 0.010906
330500 -- (-1490.923) (-1475.332) (-1489.315) [-1478.272] * [-1485.383] (-1485.934) (-1477.912) (-1486.609) -- 0:03:02
331000 -- (-1477.714) (-1478.031) (-1477.818) [-1480.446] * (-1478.711) (-1477.167) (-1488.231) [-1479.025] -- 0:03:01
331500 -- (-1488.414) (-1480.952) [-1481.664] (-1485.948) * [-1482.897] (-1485.887) (-1486.183) (-1477.414) -- 0:03:01
332000 -- (-1495.085) (-1491.423) [-1478.393] (-1493.374) * (-1484.570) (-1486.973) (-1493.615) [-1477.496] -- 0:03:03
332500 -- [-1472.640] (-1483.305) (-1482.219) (-1479.173) * (-1490.999) [-1475.869] (-1484.845) (-1479.716) -- 0:03:02
333000 -- [-1472.175] (-1489.654) (-1490.882) (-1482.676) * (-1472.741) (-1484.900) (-1478.437) [-1481.740] -- 0:03:02
333500 -- (-1492.528) [-1488.224] (-1486.950) (-1480.577) * [-1480.980] (-1480.437) (-1489.525) (-1475.915) -- 0:03:01
334000 -- [-1479.916] (-1486.484) (-1490.028) (-1482.105) * (-1480.291) (-1485.969) [-1483.283] (-1484.408) -- 0:03:01
334500 -- (-1476.329) [-1470.598] (-1479.223) (-1487.057) * (-1490.985) (-1479.165) [-1481.976] (-1486.491) -- 0:03:01
335000 -- [-1477.581] (-1490.127) (-1491.540) (-1487.212) * (-1485.682) [-1479.147] (-1491.579) (-1478.358) -- 0:03:00
Average standard deviation of split frequencies: 0.010593
335500 -- (-1476.955) [-1481.465] (-1488.979) (-1480.427) * (-1489.150) [-1474.360] (-1493.910) (-1491.890) -- 0:03:02
336000 -- (-1490.481) [-1491.603] (-1496.796) (-1484.993) * (-1487.544) (-1481.416) (-1475.221) [-1475.192] -- 0:03:01
336500 -- (-1489.496) (-1484.023) (-1481.671) [-1482.119] * (-1496.352) (-1475.767) [-1481.262] (-1475.976) -- 0:03:01
337000 -- (-1484.748) (-1475.609) [-1472.365] (-1495.499) * [-1481.441] (-1493.031) (-1480.321) (-1476.969) -- 0:03:00
337500 -- (-1485.521) (-1485.520) [-1476.588] (-1489.699) * (-1499.522) [-1492.224] (-1489.712) (-1471.920) -- 0:03:00
338000 -- (-1488.489) (-1491.269) (-1486.432) [-1480.245] * (-1482.489) (-1495.601) (-1478.556) [-1465.199] -- 0:03:00
338500 -- (-1498.396) (-1480.665) (-1483.990) [-1478.101] * (-1489.952) (-1470.465) (-1482.934) [-1472.519] -- 0:02:59
339000 -- [-1483.171] (-1491.283) (-1482.460) (-1486.471) * (-1480.978) (-1483.131) (-1470.069) [-1482.828] -- 0:02:59
339500 -- (-1487.142) [-1473.581] (-1483.508) (-1489.888) * (-1485.442) (-1478.985) (-1496.887) [-1470.433] -- 0:03:00
340000 -- [-1467.404] (-1486.153) (-1476.436) (-1488.710) * (-1491.134) (-1485.411) (-1483.905) [-1472.064] -- 0:03:00
Average standard deviation of split frequencies: 0.010102
340500 -- (-1479.365) (-1482.255) (-1492.294) [-1481.561] * (-1483.149) (-1480.712) (-1497.188) [-1486.515] -- 0:03:00
341000 -- (-1488.457) [-1480.594] (-1489.741) (-1478.693) * (-1479.184) (-1487.984) [-1478.092] (-1482.651) -- 0:02:59
341500 -- (-1489.497) [-1476.719] (-1476.511) (-1486.171) * (-1482.496) (-1497.775) (-1483.380) [-1476.232] -- 0:02:59
342000 -- [-1475.671] (-1491.245) (-1499.350) (-1478.364) * (-1483.295) (-1490.817) [-1479.665] (-1493.252) -- 0:02:58
342500 -- (-1487.765) (-1484.366) [-1492.478] (-1484.403) * [-1475.219] (-1479.263) (-1488.474) (-1479.105) -- 0:02:58
343000 -- (-1485.448) (-1480.133) (-1502.399) [-1473.003] * [-1474.952] (-1477.136) (-1487.295) (-1483.740) -- 0:03:00
343500 -- (-1487.383) [-1473.791] (-1483.900) (-1482.589) * (-1487.500) [-1470.646] (-1480.274) (-1483.607) -- 0:02:59
344000 -- [-1481.477] (-1494.034) (-1493.216) (-1484.699) * [-1471.501] (-1482.882) (-1492.182) (-1474.572) -- 0:02:59
344500 -- (-1483.199) [-1486.946] (-1496.965) (-1476.156) * (-1488.747) [-1483.355] (-1483.704) (-1473.968) -- 0:02:58
345000 -- (-1484.412) [-1481.074] (-1495.916) (-1481.518) * (-1488.850) (-1469.381) [-1471.156] (-1488.784) -- 0:02:58
Average standard deviation of split frequencies: 0.009810
345500 -- [-1469.619] (-1488.345) (-1481.715) (-1483.788) * (-1475.699) (-1483.868) (-1488.788) [-1471.814] -- 0:02:58
346000 -- (-1471.663) (-1492.256) [-1477.239] (-1491.796) * [-1483.563] (-1482.030) (-1483.178) (-1485.141) -- 0:02:57
346500 -- (-1490.608) [-1483.801] (-1495.547) (-1491.470) * [-1475.783] (-1487.242) (-1478.740) (-1476.565) -- 0:02:57
347000 -- [-1473.286] (-1485.748) (-1482.058) (-1487.508) * (-1493.374) (-1485.265) [-1479.132] (-1492.997) -- 0:02:58
347500 -- [-1467.258] (-1494.687) (-1476.709) (-1493.423) * [-1477.984] (-1479.304) (-1496.012) (-1485.615) -- 0:02:58
348000 -- (-1478.622) [-1481.308] (-1488.679) (-1480.249) * (-1487.037) [-1469.824] (-1480.305) (-1496.865) -- 0:02:57
348500 -- [-1483.205] (-1493.023) (-1512.342) (-1478.192) * (-1475.519) [-1469.145] (-1482.362) (-1484.417) -- 0:02:57
349000 -- (-1483.280) [-1480.637] (-1494.016) (-1489.200) * (-1482.210) (-1477.928) [-1476.411] (-1476.806) -- 0:02:57
349500 -- [-1472.780] (-1481.733) (-1490.137) (-1487.448) * (-1477.361) (-1470.397) [-1485.421] (-1491.914) -- 0:02:56
350000 -- (-1476.192) [-1477.875] (-1490.514) (-1478.154) * [-1482.402] (-1481.826) (-1496.895) (-1493.617) -- 0:02:56
Average standard deviation of split frequencies: 0.008604
350500 -- (-1485.456) [-1481.972] (-1486.537) (-1481.372) * (-1479.306) (-1490.489) (-1500.009) [-1477.296] -- 0:02:57
351000 -- [-1474.259] (-1485.185) (-1489.454) (-1489.431) * (-1486.330) [-1482.860] (-1493.176) (-1488.473) -- 0:02:57
351500 -- [-1478.700] (-1475.851) (-1491.648) (-1496.514) * (-1480.653) [-1468.547] (-1481.466) (-1493.092) -- 0:02:57
352000 -- [-1479.861] (-1488.751) (-1511.057) (-1501.144) * (-1485.682) (-1478.839) [-1474.856] (-1484.063) -- 0:02:56
352500 -- (-1482.689) [-1486.638] (-1503.679) (-1503.911) * (-1492.767) (-1482.893) [-1481.349] (-1486.906) -- 0:02:56
353000 -- (-1476.516) [-1475.436] (-1489.670) (-1503.395) * (-1496.659) [-1480.603] (-1471.399) (-1486.590) -- 0:02:55
353500 -- (-1484.266) (-1495.006) [-1477.046] (-1482.424) * (-1494.280) (-1488.548) (-1481.554) [-1481.562] -- 0:02:55
354000 -- [-1485.984] (-1483.875) (-1491.415) (-1476.109) * [-1479.765] (-1469.866) (-1503.397) (-1485.220) -- 0:02:55
354500 -- (-1491.338) [-1482.907] (-1488.889) (-1483.256) * (-1496.266) [-1479.460] (-1494.459) (-1483.994) -- 0:02:56
355000 -- (-1481.111) (-1482.683) (-1478.411) [-1476.058] * (-1485.117) [-1490.259] (-1485.254) (-1478.053) -- 0:02:56
Average standard deviation of split frequencies: 0.008806
355500 -- (-1482.879) (-1489.469) (-1479.894) [-1479.555] * (-1483.107) (-1485.299) (-1486.643) [-1480.556] -- 0:02:55
356000 -- (-1481.608) (-1492.219) (-1480.156) [-1480.850] * (-1481.012) [-1479.607] (-1496.034) (-1478.965) -- 0:02:55
356500 -- (-1476.802) (-1479.822) (-1493.665) [-1486.188] * (-1481.513) [-1480.793] (-1484.813) (-1480.626) -- 0:02:55
357000 -- (-1473.632) [-1475.170] (-1482.347) (-1490.723) * (-1486.725) (-1480.341) [-1479.542] (-1487.589) -- 0:02:54
357500 -- (-1487.906) (-1482.872) (-1484.644) [-1472.970] * (-1476.561) [-1474.746] (-1485.060) (-1494.928) -- 0:02:54
358000 -- (-1494.727) (-1482.417) (-1492.790) [-1473.295] * (-1497.415) (-1477.243) (-1494.669) [-1480.936] -- 0:02:55
358500 -- (-1483.613) (-1483.799) [-1475.981] (-1490.251) * (-1480.071) (-1477.714) (-1482.659) [-1487.817] -- 0:02:55
359000 -- (-1481.024) [-1473.976] (-1482.498) (-1481.067) * [-1482.154] (-1486.581) (-1476.285) (-1477.000) -- 0:02:54
359500 -- (-1480.208) (-1484.109) [-1482.010] (-1479.824) * (-1486.096) [-1473.524] (-1488.839) (-1473.631) -- 0:02:54
360000 -- (-1482.260) (-1484.594) [-1487.222] (-1479.991) * (-1482.895) [-1480.957] (-1484.974) (-1483.404) -- 0:02:54
Average standard deviation of split frequencies: 0.009868
360500 -- (-1478.256) (-1479.159) (-1479.027) [-1486.095] * [-1476.931] (-1489.665) (-1493.454) (-1492.529) -- 0:02:53
361000 -- (-1484.398) [-1474.690] (-1487.175) (-1488.842) * (-1479.295) [-1482.455] (-1499.788) (-1518.709) -- 0:02:53
361500 -- (-1478.204) (-1499.407) (-1484.432) [-1497.127] * [-1479.653] (-1500.087) (-1491.241) (-1491.242) -- 0:02:53
362000 -- (-1497.146) [-1483.622] (-1481.155) (-1487.460) * (-1473.382) [-1477.854] (-1494.875) (-1492.447) -- 0:02:54
362500 -- (-1481.603) [-1485.521] (-1484.104) (-1490.692) * [-1470.864] (-1478.682) (-1490.291) (-1500.434) -- 0:02:54
363000 -- [-1475.060] (-1497.347) (-1485.169) (-1482.162) * [-1477.109] (-1493.446) (-1491.249) (-1482.523) -- 0:02:53
363500 -- (-1476.475) (-1483.742) (-1472.641) [-1474.816] * (-1479.132) [-1475.949] (-1488.238) (-1481.053) -- 0:02:53
364000 -- (-1484.711) (-1498.667) [-1474.848] (-1506.958) * [-1474.545] (-1503.437) (-1494.739) (-1481.057) -- 0:02:52
364500 -- [-1467.892] (-1492.290) (-1485.655) (-1480.427) * [-1474.377] (-1496.064) (-1491.642) (-1480.119) -- 0:02:52
365000 -- (-1491.224) (-1502.969) [-1485.519] (-1480.663) * (-1480.608) (-1505.235) (-1489.446) [-1484.261] -- 0:02:52
Average standard deviation of split frequencies: 0.009402
365500 -- (-1477.166) (-1502.938) (-1482.910) [-1479.163] * (-1478.351) [-1491.533] (-1491.407) (-1486.472) -- 0:02:53
366000 -- (-1483.470) [-1474.310] (-1491.158) (-1497.731) * (-1494.950) (-1491.007) [-1480.042] (-1489.309) -- 0:02:53
366500 -- (-1485.162) [-1470.769] (-1496.853) (-1493.341) * (-1482.441) (-1486.370) (-1488.587) [-1476.859] -- 0:02:52
367000 -- (-1478.491) (-1472.830) [-1487.764] (-1486.893) * (-1496.875) (-1480.746) [-1486.642] (-1483.736) -- 0:02:52
367500 -- (-1497.913) (-1482.780) [-1484.469] (-1474.742) * (-1484.511) (-1482.395) (-1506.951) [-1486.424] -- 0:02:52
368000 -- (-1480.461) (-1492.574) [-1476.145] (-1475.228) * (-1483.363) [-1486.310] (-1488.518) (-1481.681) -- 0:02:51
368500 -- (-1495.480) (-1470.049) (-1480.737) [-1479.457] * [-1485.316] (-1483.233) (-1486.141) (-1477.973) -- 0:02:51
369000 -- [-1482.137] (-1475.517) (-1489.467) (-1483.874) * (-1498.067) (-1485.467) (-1482.897) [-1478.768] -- 0:02:51
369500 -- [-1479.072] (-1480.628) (-1488.721) (-1482.538) * (-1478.556) (-1483.131) (-1491.601) [-1471.988] -- 0:02:52
370000 -- (-1490.511) (-1480.123) [-1473.188] (-1487.834) * [-1471.583] (-1487.001) (-1487.866) (-1486.443) -- 0:02:51
Average standard deviation of split frequencies: 0.009284
370500 -- (-1494.020) (-1475.947) [-1474.367] (-1487.155) * [-1475.590] (-1491.289) (-1487.426) (-1481.099) -- 0:02:51
371000 -- (-1479.634) (-1478.649) [-1482.080] (-1487.980) * (-1474.178) (-1475.408) (-1481.639) [-1478.619] -- 0:02:51
371500 -- (-1485.019) (-1501.727) (-1494.535) [-1482.666] * (-1482.519) (-1479.580) (-1499.898) [-1480.370] -- 0:02:50
372000 -- (-1489.718) (-1489.347) (-1496.166) [-1475.158] * (-1485.810) [-1487.480] (-1501.367) (-1481.773) -- 0:02:50
372500 -- (-1484.640) (-1497.687) (-1482.173) [-1478.786] * (-1484.849) [-1484.353] (-1478.418) (-1493.574) -- 0:02:50
373000 -- [-1476.329] (-1490.358) (-1492.505) (-1489.792) * [-1477.132] (-1504.787) (-1486.411) (-1488.968) -- 0:02:51
373500 -- [-1480.897] (-1483.023) (-1481.254) (-1483.415) * (-1480.444) (-1493.400) [-1476.826] (-1482.023) -- 0:02:51
374000 -- (-1482.936) (-1502.114) (-1505.802) [-1473.955] * (-1492.704) (-1506.078) [-1488.025] (-1509.986) -- 0:02:50
374500 -- [-1481.296] (-1496.036) (-1478.926) (-1493.730) * [-1489.434] (-1481.465) (-1476.987) (-1502.395) -- 0:02:50
375000 -- (-1485.261) (-1487.670) (-1482.101) [-1476.555] * [-1481.579] (-1485.703) (-1483.704) (-1480.899) -- 0:02:50
Average standard deviation of split frequencies: 0.009842
375500 -- [-1474.909] (-1478.159) (-1498.359) (-1476.053) * (-1489.867) (-1494.634) (-1476.425) [-1481.484] -- 0:02:49
376000 -- (-1486.536) (-1483.664) [-1483.811] (-1475.571) * (-1482.400) (-1469.482) [-1477.433] (-1479.981) -- 0:02:49
376500 -- (-1499.291) [-1478.363] (-1484.044) (-1491.371) * (-1483.545) (-1485.050) (-1484.016) [-1465.447] -- 0:02:50
377000 -- (-1496.932) [-1481.911] (-1481.354) (-1486.956) * (-1484.816) (-1487.824) [-1480.463] (-1484.483) -- 0:02:50
377500 -- (-1482.437) [-1480.406] (-1488.129) (-1485.682) * (-1485.258) (-1486.234) [-1477.485] (-1482.082) -- 0:02:49
378000 -- (-1485.423) [-1478.046] (-1488.616) (-1481.334) * [-1485.711] (-1483.164) (-1489.260) (-1489.226) -- 0:02:49
378500 -- (-1475.078) (-1483.999) [-1477.047] (-1485.159) * (-1482.529) (-1483.597) (-1485.908) [-1479.210] -- 0:02:49
379000 -- [-1468.991] (-1491.592) (-1486.752) (-1485.723) * (-1489.850) [-1477.511] (-1491.043) (-1481.745) -- 0:02:48
379500 -- (-1485.435) [-1487.237] (-1481.170) (-1488.757) * (-1480.148) (-1477.991) [-1475.459] (-1487.548) -- 0:02:48
380000 -- (-1490.158) (-1482.522) [-1486.597] (-1485.259) * (-1488.924) (-1477.385) (-1480.836) [-1477.534] -- 0:02:49
Average standard deviation of split frequencies: 0.009412
380500 -- (-1488.526) (-1478.390) [-1477.765] (-1481.726) * [-1487.186] (-1481.723) (-1501.115) (-1481.395) -- 0:02:49
381000 -- (-1484.838) [-1474.806] (-1478.572) (-1473.012) * (-1476.789) (-1482.628) [-1478.399] (-1493.300) -- 0:02:48
381500 -- (-1495.027) (-1486.250) [-1476.519] (-1481.634) * (-1482.551) (-1492.451) (-1488.945) [-1480.608] -- 0:02:48
382000 -- [-1474.009] (-1482.277) (-1479.211) (-1489.452) * [-1473.360] (-1479.270) (-1488.645) (-1472.861) -- 0:02:48
382500 -- (-1478.665) [-1494.651] (-1489.192) (-1477.538) * (-1482.929) [-1471.067] (-1488.936) (-1495.121) -- 0:02:47
383000 -- (-1479.783) (-1477.159) [-1489.728] (-1490.025) * (-1491.127) [-1480.830] (-1498.721) (-1477.013) -- 0:02:47
383500 -- (-1482.957) (-1478.743) [-1482.624] (-1485.944) * (-1484.946) [-1471.698] (-1496.321) (-1486.568) -- 0:02:47
384000 -- (-1491.453) [-1480.987] (-1490.578) (-1483.709) * (-1496.533) [-1472.221] (-1488.591) (-1471.402) -- 0:02:48
384500 -- (-1483.895) [-1486.656] (-1483.972) (-1500.624) * (-1487.384) (-1484.469) (-1495.946) [-1483.125] -- 0:02:48
385000 -- (-1483.916) (-1489.089) (-1475.269) [-1485.186] * (-1493.002) (-1493.399) (-1481.080) [-1486.633] -- 0:02:47
Average standard deviation of split frequencies: 0.010259
385500 -- [-1477.544] (-1486.022) (-1475.857) (-1474.517) * (-1474.847) (-1494.865) [-1482.293] (-1485.149) -- 0:02:47
386000 -- (-1484.862) (-1476.849) [-1475.170] (-1484.537) * [-1480.897] (-1499.281) (-1488.716) (-1484.332) -- 0:02:47
386500 -- [-1480.770] (-1495.173) (-1479.720) (-1481.639) * (-1480.390) (-1483.071) [-1481.710] (-1501.884) -- 0:02:46
387000 -- [-1471.465] (-1483.477) (-1479.331) (-1492.083) * [-1484.742] (-1482.648) (-1482.472) (-1494.624) -- 0:02:46
387500 -- (-1488.184) (-1483.414) [-1475.819] (-1478.143) * (-1475.230) (-1473.096) [-1482.330] (-1486.216) -- 0:02:47
388000 -- (-1495.527) [-1481.190] (-1478.439) (-1481.351) * (-1480.034) [-1467.108] (-1484.674) (-1492.713) -- 0:02:47
388500 -- (-1482.918) (-1474.533) [-1477.884] (-1487.397) * (-1488.006) (-1499.768) [-1483.279] (-1483.602) -- 0:02:46
389000 -- (-1487.489) (-1481.217) [-1477.987] (-1483.442) * (-1497.729) (-1493.286) [-1481.785] (-1492.366) -- 0:02:46
389500 -- (-1477.368) (-1475.180) (-1497.610) [-1475.304] * [-1477.195] (-1483.049) (-1471.945) (-1495.690) -- 0:02:46
390000 -- (-1476.160) (-1491.173) [-1478.399] (-1479.409) * (-1489.078) [-1476.541] (-1482.457) (-1484.326) -- 0:02:45
Average standard deviation of split frequencies: 0.009352
390500 -- (-1481.039) [-1485.688] (-1480.812) (-1483.486) * (-1479.475) (-1488.401) [-1484.333] (-1493.214) -- 0:02:45
391000 -- (-1503.029) (-1488.951) [-1471.754] (-1490.439) * (-1472.513) [-1475.380] (-1480.207) (-1482.162) -- 0:02:45
391500 -- [-1473.651] (-1487.983) (-1492.938) (-1479.715) * [-1476.714] (-1494.696) (-1478.186) (-1485.765) -- 0:02:46
392000 -- (-1474.504) (-1476.754) [-1475.790] (-1482.536) * [-1475.554] (-1493.308) (-1476.252) (-1483.010) -- 0:02:45
392500 -- [-1478.418] (-1477.388) (-1490.992) (-1494.128) * (-1476.850) [-1472.577] (-1493.842) (-1485.769) -- 0:02:45
393000 -- [-1482.983] (-1489.034) (-1482.868) (-1477.557) * (-1476.363) (-1486.886) [-1482.530] (-1476.834) -- 0:02:45
393500 -- [-1476.833] (-1493.311) (-1493.385) (-1484.721) * [-1474.449] (-1479.267) (-1482.918) (-1480.290) -- 0:02:44
394000 -- [-1480.613] (-1478.428) (-1485.849) (-1485.952) * (-1491.664) (-1475.172) [-1481.639] (-1488.295) -- 0:02:44
394500 -- (-1485.403) (-1477.507) (-1490.045) [-1473.136] * (-1477.168) (-1474.934) [-1475.847] (-1490.521) -- 0:02:44
395000 -- (-1497.878) [-1477.736] (-1489.636) (-1484.179) * [-1474.770] (-1475.280) (-1482.651) (-1504.887) -- 0:02:45
Average standard deviation of split frequencies: 0.009761
395500 -- (-1487.729) (-1490.394) [-1480.377] (-1471.274) * (-1478.770) [-1470.611] (-1484.444) (-1489.407) -- 0:02:45
396000 -- (-1495.077) (-1507.934) [-1474.664] (-1481.275) * (-1503.269) (-1473.626) [-1476.409] (-1485.468) -- 0:02:44
396500 -- (-1479.777) (-1485.050) (-1478.269) [-1473.264] * (-1488.658) (-1476.553) (-1485.702) [-1470.603] -- 0:02:44
397000 -- [-1473.756] (-1498.584) (-1488.506) (-1477.851) * (-1502.026) [-1478.670] (-1491.347) (-1479.631) -- 0:02:44
397500 -- (-1490.510) (-1487.280) (-1483.788) [-1484.587] * (-1495.694) [-1479.930] (-1470.344) (-1490.762) -- 0:02:43
398000 -- (-1485.242) (-1488.711) (-1488.651) [-1483.718] * (-1489.394) [-1492.559] (-1478.759) (-1489.958) -- 0:02:44
398500 -- (-1498.844) [-1473.819] (-1486.441) (-1476.119) * (-1491.669) (-1485.403) (-1482.793) [-1492.166] -- 0:02:44
399000 -- (-1483.324) (-1485.220) (-1481.033) [-1469.661] * (-1482.796) (-1485.984) (-1495.895) [-1478.795] -- 0:02:44
399500 -- (-1472.810) (-1488.305) (-1486.558) [-1476.266] * (-1489.962) (-1490.236) [-1476.937] (-1484.376) -- 0:02:43
400000 -- (-1476.810) (-1488.974) (-1490.446) [-1477.492] * (-1486.650) (-1489.273) [-1475.774] (-1467.325) -- 0:02:43
Average standard deviation of split frequencies: 0.010060
400500 -- (-1485.412) [-1485.616] (-1492.227) (-1474.278) * (-1486.062) (-1482.541) (-1479.479) [-1480.372] -- 0:02:43
401000 -- (-1496.016) (-1482.102) [-1480.841] (-1473.541) * (-1488.152) (-1495.299) [-1477.797] (-1487.042) -- 0:02:42
401500 -- [-1490.092] (-1491.084) (-1492.485) (-1480.422) * (-1477.080) (-1479.985) (-1486.797) [-1480.043] -- 0:02:42
402000 -- (-1489.621) (-1481.615) (-1496.179) [-1474.611] * (-1483.891) (-1486.640) (-1487.245) [-1477.071] -- 0:02:43
402500 -- [-1472.837] (-1483.925) (-1487.283) (-1487.278) * (-1480.519) [-1482.069] (-1484.339) (-1480.722) -- 0:02:43
403000 -- (-1485.672) [-1478.967] (-1488.018) (-1492.287) * (-1469.158) (-1475.532) (-1489.853) [-1488.956] -- 0:02:42
403500 -- (-1487.265) [-1475.794] (-1474.849) (-1477.617) * (-1482.320) (-1475.474) [-1486.531] (-1490.582) -- 0:02:42
404000 -- (-1491.847) [-1490.216] (-1473.258) (-1478.623) * (-1472.611) [-1475.438] (-1490.857) (-1478.411) -- 0:02:42
404500 -- (-1481.139) (-1481.559) [-1477.821] (-1496.466) * (-1489.726) [-1483.174] (-1483.977) (-1481.773) -- 0:02:41
405000 -- (-1475.826) (-1472.418) (-1501.490) [-1470.563] * (-1484.621) (-1483.411) [-1482.416] (-1489.871) -- 0:02:41
Average standard deviation of split frequencies: 0.009579
405500 -- (-1478.780) (-1484.713) (-1488.145) [-1480.752] * [-1486.240] (-1493.903) (-1493.697) (-1479.377) -- 0:02:42
406000 -- [-1484.653] (-1493.239) (-1499.676) (-1482.969) * [-1479.774] (-1495.213) (-1488.173) (-1478.114) -- 0:02:42
406500 -- (-1478.960) (-1483.092) [-1472.207] (-1474.315) * (-1485.700) [-1484.742] (-1497.232) (-1479.489) -- 0:02:42
407000 -- [-1481.263] (-1488.574) (-1481.078) (-1475.326) * (-1479.886) (-1481.396) (-1480.760) [-1473.674] -- 0:02:41
407500 -- (-1481.947) [-1480.060] (-1480.950) (-1490.540) * (-1493.809) (-1494.835) (-1485.790) [-1471.929] -- 0:02:41
408000 -- (-1479.368) (-1487.060) [-1479.549] (-1482.416) * (-1502.756) (-1487.115) [-1470.223] (-1471.283) -- 0:02:41
408500 -- (-1487.378) (-1492.433) [-1479.599] (-1488.322) * (-1484.262) (-1477.793) [-1476.847] (-1484.730) -- 0:02:40
409000 -- [-1474.366] (-1476.742) (-1488.319) (-1479.183) * [-1480.535] (-1494.674) (-1485.904) (-1490.289) -- 0:02:40
409500 -- (-1484.890) (-1490.807) [-1484.143] (-1477.971) * (-1485.602) [-1482.226] (-1474.812) (-1489.981) -- 0:02:41
410000 -- (-1487.203) (-1497.458) [-1477.530] (-1496.779) * (-1483.039) [-1478.911] (-1490.550) (-1496.754) -- 0:02:41
Average standard deviation of split frequencies: 0.010159
410500 -- (-1477.856) (-1480.385) (-1478.293) [-1479.997] * (-1481.316) (-1484.180) [-1478.733] (-1484.852) -- 0:02:40
411000 -- (-1484.450) (-1496.380) [-1476.123] (-1475.517) * (-1488.227) (-1482.373) [-1472.098] (-1493.388) -- 0:02:40
411500 -- (-1477.848) (-1474.900) (-1482.395) [-1484.462] * (-1480.705) (-1484.461) (-1481.970) [-1485.432] -- 0:02:40
412000 -- (-1486.369) (-1483.936) (-1493.225) [-1479.026] * [-1473.201] (-1487.697) (-1489.892) (-1485.252) -- 0:02:39
412500 -- [-1473.409] (-1486.067) (-1488.481) (-1488.494) * (-1483.564) (-1494.014) [-1476.205] (-1489.692) -- 0:02:39
413000 -- (-1474.015) (-1493.332) [-1481.152] (-1488.720) * (-1481.975) (-1493.728) [-1479.308] (-1489.184) -- 0:02:40
413500 -- (-1485.844) (-1489.244) (-1476.000) [-1481.357] * (-1484.943) (-1482.680) [-1481.602] (-1491.041) -- 0:02:40
414000 -- (-1487.268) (-1473.569) (-1499.595) [-1484.848] * (-1485.350) [-1478.940] (-1482.233) (-1480.423) -- 0:02:39
414500 -- [-1473.490] (-1507.228) (-1485.637) (-1479.143) * (-1480.547) (-1489.627) [-1475.611] (-1479.888) -- 0:02:39
415000 -- (-1492.602) (-1494.500) (-1484.353) [-1485.788] * [-1480.969] (-1481.907) (-1483.875) (-1485.584) -- 0:02:39
Average standard deviation of split frequencies: 0.009605
415500 -- (-1498.501) [-1484.065] (-1483.739) (-1488.584) * [-1474.713] (-1488.589) (-1489.298) (-1506.838) -- 0:02:38
416000 -- (-1491.658) (-1481.297) (-1496.473) [-1476.121] * (-1480.124) [-1478.994] (-1490.043) (-1489.508) -- 0:02:38
416500 -- (-1495.162) (-1491.253) (-1479.354) [-1481.945] * [-1471.981] (-1495.028) (-1507.040) (-1498.728) -- 0:02:38
417000 -- (-1504.289) (-1485.304) [-1471.995] (-1488.853) * [-1483.143] (-1488.185) (-1486.460) (-1489.109) -- 0:02:39
417500 -- (-1487.071) (-1494.167) [-1480.530] (-1493.004) * [-1482.824] (-1480.570) (-1483.182) (-1493.249) -- 0:02:39
418000 -- [-1481.176] (-1498.128) (-1478.429) (-1483.442) * (-1479.804) (-1480.429) (-1490.282) [-1487.886] -- 0:02:38
418500 -- (-1487.305) (-1492.293) [-1475.257] (-1496.222) * [-1491.537] (-1483.620) (-1486.983) (-1488.746) -- 0:02:38
419000 -- [-1478.785] (-1483.233) (-1507.311) (-1478.554) * (-1484.671) [-1478.484] (-1485.243) (-1509.213) -- 0:02:38
419500 -- (-1478.817) (-1502.048) [-1481.829] (-1486.316) * (-1478.320) (-1485.159) (-1489.102) [-1485.208] -- 0:02:37
420000 -- [-1491.141] (-1491.006) (-1476.017) (-1487.475) * (-1482.078) [-1476.023] (-1487.760) (-1487.442) -- 0:02:37
Average standard deviation of split frequencies: 0.010192
420500 -- (-1491.783) [-1483.569] (-1472.080) (-1493.073) * (-1490.738) [-1475.144] (-1478.106) (-1480.656) -- 0:02:38
421000 -- (-1478.463) (-1489.120) [-1485.988] (-1484.501) * (-1499.331) (-1484.836) [-1471.671] (-1489.359) -- 0:02:38
421500 -- [-1475.500] (-1479.042) (-1492.795) (-1489.887) * (-1497.009) (-1484.852) [-1476.658] (-1490.559) -- 0:02:37
422000 -- (-1474.371) [-1483.785] (-1487.997) (-1489.256) * (-1489.460) (-1483.802) [-1485.666] (-1478.221) -- 0:02:37
422500 -- (-1477.906) (-1478.854) (-1490.529) [-1489.810] * (-1486.700) (-1497.155) [-1485.450] (-1483.079) -- 0:02:37
423000 -- (-1491.540) (-1496.431) [-1475.342] (-1481.902) * (-1488.221) (-1487.976) (-1486.128) [-1481.084] -- 0:02:36
423500 -- (-1490.666) [-1482.903] (-1485.913) (-1493.589) * (-1483.761) (-1503.545) [-1492.944] (-1482.806) -- 0:02:36
424000 -- (-1484.043) [-1481.090] (-1480.993) (-1483.997) * (-1494.602) [-1482.836] (-1481.601) (-1481.136) -- 0:02:36
424500 -- [-1487.241] (-1495.134) (-1479.576) (-1486.971) * [-1479.475] (-1498.846) (-1488.454) (-1470.833) -- 0:02:37
425000 -- [-1482.590] (-1483.289) (-1481.464) (-1480.518) * (-1484.942) [-1479.807] (-1496.148) (-1501.813) -- 0:02:36
Average standard deviation of split frequencies: 0.011013
425500 -- (-1494.074) [-1477.624] (-1480.772) (-1491.831) * (-1498.159) (-1480.442) (-1491.092) [-1476.063] -- 0:02:36
426000 -- (-1479.464) [-1473.479] (-1488.071) (-1484.327) * (-1482.739) (-1480.981) (-1477.203) [-1482.163] -- 0:02:36
426500 -- (-1500.182) [-1478.536] (-1492.406) (-1484.843) * (-1485.948) (-1488.542) [-1478.019] (-1480.131) -- 0:02:35
427000 -- [-1476.610] (-1494.083) (-1478.607) (-1480.213) * [-1490.882] (-1474.061) (-1480.192) (-1480.806) -- 0:02:35
427500 -- [-1478.454] (-1482.799) (-1487.029) (-1494.415) * (-1479.639) (-1478.931) (-1490.053) [-1495.138] -- 0:02:35
428000 -- [-1478.523] (-1476.077) (-1487.157) (-1490.703) * (-1518.033) (-1481.015) (-1487.219) [-1476.884] -- 0:02:36
428500 -- [-1474.143] (-1477.923) (-1479.998) (-1495.768) * (-1496.129) (-1477.777) (-1500.336) [-1478.572] -- 0:02:36
429000 -- (-1473.374) [-1480.812] (-1478.353) (-1501.000) * (-1491.863) [-1475.055] (-1497.380) (-1475.696) -- 0:02:35
429500 -- [-1477.551] (-1483.793) (-1473.813) (-1498.802) * (-1494.678) (-1487.642) [-1485.888] (-1488.430) -- 0:02:35
430000 -- (-1476.682) (-1485.800) [-1485.443] (-1500.246) * (-1485.340) (-1483.043) (-1494.686) [-1480.474] -- 0:02:35
Average standard deviation of split frequencies: 0.010216
430500 -- (-1482.184) (-1486.746) (-1480.901) [-1469.689] * (-1481.725) (-1486.343) (-1488.796) [-1485.535] -- 0:02:34
431000 -- (-1472.359) [-1481.617] (-1470.155) (-1490.330) * [-1476.474] (-1493.517) (-1482.154) (-1480.775) -- 0:02:34
431500 -- (-1477.281) (-1487.775) (-1479.023) [-1483.302] * (-1493.031) (-1495.978) [-1475.934] (-1477.468) -- 0:02:34
432000 -- (-1477.795) (-1478.609) [-1480.641] (-1496.000) * (-1483.098) [-1489.295] (-1489.394) (-1474.453) -- 0:02:35
432500 -- (-1501.726) (-1491.912) [-1475.092] (-1484.771) * [-1477.947] (-1488.629) (-1490.578) (-1477.369) -- 0:02:34
433000 -- (-1474.496) [-1486.820] (-1493.232) (-1479.645) * [-1481.011] (-1486.020) (-1479.049) (-1476.613) -- 0:02:34
433500 -- (-1486.142) (-1482.844) [-1481.141] (-1481.311) * (-1483.361) (-1487.352) (-1485.719) [-1468.690] -- 0:02:34
434000 -- [-1475.215] (-1484.249) (-1478.029) (-1480.898) * (-1486.114) (-1495.407) (-1486.146) [-1478.744] -- 0:02:33
434500 -- (-1490.826) (-1482.332) [-1472.313] (-1487.786) * (-1480.564) (-1481.703) [-1473.737] (-1483.940) -- 0:02:33
435000 -- (-1479.539) [-1470.799] (-1485.945) (-1496.217) * (-1488.416) [-1480.836] (-1483.894) (-1496.058) -- 0:02:33
Average standard deviation of split frequencies: 0.010606
435500 -- (-1495.782) (-1488.484) [-1488.032] (-1496.906) * (-1483.605) [-1478.378] (-1497.530) (-1474.908) -- 0:02:34
436000 -- [-1483.729] (-1475.967) (-1487.749) (-1481.661) * [-1479.532] (-1475.759) (-1505.564) (-1486.917) -- 0:02:33
436500 -- [-1482.612] (-1481.439) (-1481.781) (-1480.420) * [-1473.502] (-1478.742) (-1496.302) (-1482.251) -- 0:02:33
437000 -- (-1486.982) (-1479.931) [-1473.763] (-1481.480) * [-1483.660] (-1479.543) (-1487.742) (-1490.320) -- 0:02:33
437500 -- [-1473.833] (-1487.745) (-1485.425) (-1483.361) * (-1478.474) (-1485.885) (-1484.679) [-1479.852] -- 0:02:33
438000 -- (-1471.806) (-1489.302) [-1494.806] (-1493.254) * (-1476.583) (-1477.366) (-1483.246) [-1478.921] -- 0:02:32
438500 -- [-1474.800] (-1486.000) (-1480.136) (-1490.770) * (-1488.187) [-1483.709] (-1491.686) (-1492.221) -- 0:02:32
439000 -- (-1479.294) [-1473.926] (-1480.774) (-1473.086) * [-1483.938] (-1493.984) (-1483.926) (-1483.067) -- 0:02:32
439500 -- (-1489.722) (-1485.630) [-1476.184] (-1472.394) * [-1473.256] (-1489.737) (-1481.648) (-1475.511) -- 0:02:33
440000 -- (-1488.740) [-1473.941] (-1477.828) (-1484.200) * (-1513.715) (-1479.615) [-1475.022] (-1487.480) -- 0:02:32
Average standard deviation of split frequencies: 0.010035
440500 -- (-1493.257) [-1476.396] (-1482.847) (-1497.442) * (-1488.757) (-1476.881) (-1487.988) [-1483.805] -- 0:02:32
441000 -- (-1476.954) [-1483.095] (-1473.398) (-1484.252) * (-1485.803) (-1473.571) (-1482.660) [-1475.364] -- 0:02:32
441500 -- (-1494.231) (-1482.620) (-1484.273) [-1484.426] * (-1478.046) [-1475.627] (-1483.894) (-1487.242) -- 0:02:31
442000 -- (-1491.467) (-1476.889) [-1472.063] (-1497.141) * (-1482.003) (-1481.343) [-1478.684] (-1483.230) -- 0:02:31
442500 -- (-1497.678) (-1482.013) (-1477.129) [-1477.601] * [-1474.741] (-1482.385) (-1491.311) (-1476.646) -- 0:02:31
443000 -- (-1487.400) (-1487.144) (-1480.638) [-1479.230] * (-1475.956) (-1491.857) (-1479.183) [-1480.711] -- 0:02:32
443500 -- (-1482.018) (-1498.881) [-1476.618] (-1493.378) * [-1470.640] (-1488.707) (-1489.011) (-1490.905) -- 0:02:31
444000 -- (-1475.130) (-1498.749) (-1497.328) [-1470.686] * [-1470.993] (-1479.852) (-1477.944) (-1474.172) -- 0:02:31
444500 -- [-1478.829] (-1488.357) (-1476.743) (-1489.992) * (-1484.092) (-1490.992) [-1475.987] (-1479.839) -- 0:02:31
445000 -- (-1490.023) (-1492.742) [-1472.195] (-1475.952) * (-1474.201) (-1488.448) (-1483.025) [-1482.064] -- 0:02:30
Average standard deviation of split frequencies: 0.010419
445500 -- (-1476.881) (-1485.927) (-1483.325) [-1478.477] * [-1476.209] (-1476.108) (-1487.120) (-1504.876) -- 0:02:30
446000 -- (-1480.023) (-1485.814) [-1481.957] (-1491.086) * (-1482.561) [-1478.731] (-1479.359) (-1486.750) -- 0:02:30
446500 -- (-1497.235) (-1492.405) [-1470.057] (-1481.808) * (-1494.356) (-1485.064) (-1478.885) [-1473.470] -- 0:02:29
447000 -- (-1481.838) (-1500.343) (-1473.329) [-1481.784] * (-1492.057) (-1499.030) (-1479.471) [-1476.261] -- 0:02:30
447500 -- (-1471.887) (-1477.762) (-1488.558) [-1484.438] * (-1479.830) (-1489.264) [-1475.857] (-1481.068) -- 0:02:30
448000 -- [-1488.762] (-1488.200) (-1483.752) (-1486.760) * [-1474.434] (-1487.986) (-1481.580) (-1482.804) -- 0:02:30
448500 -- (-1493.009) (-1498.266) [-1475.813] (-1491.091) * (-1487.726) (-1491.334) [-1484.734] (-1486.251) -- 0:02:30
449000 -- (-1476.824) [-1484.261] (-1481.207) (-1491.134) * (-1487.117) (-1491.416) [-1493.386] (-1478.455) -- 0:02:29
449500 -- (-1482.386) (-1490.487) [-1479.312] (-1476.263) * (-1483.714) [-1489.254] (-1490.356) (-1479.353) -- 0:02:29
450000 -- [-1474.372] (-1482.108) (-1491.766) (-1486.329) * [-1469.386] (-1493.834) (-1489.562) (-1485.096) -- 0:02:29
Average standard deviation of split frequencies: 0.010410
450500 -- (-1475.659) (-1499.771) [-1471.848] (-1475.383) * [-1480.865] (-1492.967) (-1481.887) (-1486.159) -- 0:02:28
451000 -- (-1492.166) (-1488.463) [-1486.046] (-1484.531) * (-1498.841) (-1503.710) (-1484.777) [-1475.578] -- 0:02:29
451500 -- [-1482.584] (-1485.663) (-1477.401) (-1495.028) * (-1478.502) (-1491.502) [-1482.907] (-1489.181) -- 0:02:29
452000 -- [-1475.739] (-1482.381) (-1480.785) (-1490.781) * [-1480.172] (-1513.242) (-1481.864) (-1481.098) -- 0:02:29
452500 -- [-1490.491] (-1476.300) (-1493.854) (-1499.564) * (-1479.234) (-1499.589) (-1479.348) [-1470.411] -- 0:02:28
453000 -- (-1486.404) [-1476.001] (-1482.550) (-1489.045) * [-1482.139] (-1483.016) (-1490.333) (-1484.835) -- 0:02:28
453500 -- (-1485.403) [-1479.127] (-1493.709) (-1474.874) * (-1482.398) (-1473.155) (-1513.913) [-1483.464] -- 0:02:28
454000 -- (-1485.747) (-1495.033) [-1476.155] (-1491.292) * (-1491.750) (-1489.551) (-1479.366) [-1476.664] -- 0:02:27
454500 -- (-1505.910) (-1481.055) [-1475.225] (-1485.130) * (-1485.224) [-1489.411] (-1493.033) (-1476.757) -- 0:02:28
455000 -- [-1480.279] (-1484.238) (-1487.127) (-1490.943) * (-1485.098) (-1490.733) [-1478.777] (-1475.631) -- 0:02:28
Average standard deviation of split frequencies: 0.010978
455500 -- (-1495.104) [-1489.477] (-1479.869) (-1492.089) * (-1478.456) (-1474.353) [-1489.361] (-1495.335) -- 0:02:28
456000 -- (-1484.699) (-1487.992) [-1478.740] (-1476.438) * (-1476.011) (-1483.088) [-1495.142] (-1483.256) -- 0:02:27
456500 -- (-1489.898) (-1495.233) [-1483.976] (-1488.763) * (-1481.431) [-1484.696] (-1481.629) (-1492.682) -- 0:02:27
457000 -- (-1477.119) (-1489.872) [-1481.398] (-1491.210) * (-1490.754) (-1499.816) (-1489.023) [-1473.549] -- 0:02:27
457500 -- [-1476.883] (-1491.861) (-1501.700) (-1475.400) * (-1488.893) (-1498.114) (-1491.768) [-1478.267] -- 0:02:27
458000 -- (-1485.759) (-1480.456) [-1492.508] (-1482.899) * (-1490.092) (-1494.388) (-1478.453) [-1483.087] -- 0:02:26
458500 -- (-1490.507) [-1477.790] (-1476.927) (-1481.884) * (-1480.794) (-1488.159) (-1480.431) [-1474.342] -- 0:02:27
459000 -- (-1481.018) [-1473.530] (-1486.686) (-1475.936) * (-1487.933) (-1478.743) [-1485.966] (-1493.728) -- 0:02:27
459500 -- (-1479.683) (-1491.497) [-1473.655] (-1476.989) * (-1498.541) (-1479.113) [-1474.606] (-1487.154) -- 0:02:27
460000 -- (-1471.993) (-1486.567) (-1487.400) [-1477.911] * (-1488.123) (-1484.065) [-1480.842] (-1505.205) -- 0:02:26
Average standard deviation of split frequencies: 0.011256
460500 -- [-1481.831] (-1497.580) (-1480.326) (-1490.982) * [-1479.431] (-1476.102) (-1478.990) (-1490.222) -- 0:02:26
461000 -- [-1480.012] (-1507.004) (-1481.163) (-1490.643) * (-1491.638) [-1475.732] (-1489.863) (-1495.669) -- 0:02:26
461500 -- [-1485.869] (-1507.399) (-1479.709) (-1487.767) * [-1482.322] (-1498.904) (-1485.539) (-1483.602) -- 0:02:25
462000 -- (-1497.590) (-1507.546) (-1485.755) [-1482.904] * [-1480.481] (-1485.560) (-1483.674) (-1479.267) -- 0:02:26
462500 -- [-1483.302] (-1496.991) (-1489.561) (-1487.797) * (-1498.466) (-1476.902) [-1482.738] (-1473.033) -- 0:02:26
463000 -- [-1475.486] (-1497.828) (-1481.000) (-1488.753) * (-1487.392) [-1475.786] (-1481.153) (-1486.772) -- 0:02:26
463500 -- [-1473.400] (-1503.362) (-1484.736) (-1480.704) * [-1481.954] (-1484.400) (-1489.107) (-1479.185) -- 0:02:25
464000 -- (-1477.960) (-1491.012) [-1487.330] (-1487.399) * [-1476.047] (-1501.392) (-1475.625) (-1480.176) -- 0:02:25
464500 -- (-1485.324) (-1482.411) [-1473.359] (-1480.871) * [-1473.644] (-1483.237) (-1494.188) (-1487.545) -- 0:02:25
465000 -- (-1485.225) [-1484.753] (-1483.308) (-1479.607) * [-1478.545] (-1477.173) (-1481.814) (-1480.895) -- 0:02:24
Average standard deviation of split frequencies: 0.011176
465500 -- (-1478.636) (-1478.897) (-1482.107) [-1471.099] * [-1482.915] (-1481.928) (-1490.995) (-1479.086) -- 0:02:24
466000 -- (-1474.416) (-1493.732) [-1479.179] (-1498.660) * [-1487.575] (-1483.639) (-1492.919) (-1495.437) -- 0:02:25
466500 -- (-1483.445) (-1485.633) [-1473.923] (-1495.875) * [-1473.259] (-1492.034) (-1489.926) (-1475.825) -- 0:02:25
467000 -- (-1491.141) [-1477.549] (-1483.591) (-1484.959) * [-1476.682] (-1496.483) (-1473.532) (-1493.697) -- 0:02:24
467500 -- (-1485.894) (-1483.597) [-1486.349] (-1487.682) * (-1493.180) [-1474.603] (-1487.427) (-1489.861) -- 0:02:24
468000 -- (-1473.319) (-1477.419) (-1500.871) [-1472.268] * (-1482.760) [-1479.750] (-1487.868) (-1494.660) -- 0:02:24
468500 -- (-1484.435) (-1480.394) (-1491.903) [-1479.168] * (-1479.452) [-1476.827] (-1485.296) (-1490.587) -- 0:02:24
469000 -- (-1491.841) (-1478.019) (-1491.121) [-1471.403] * (-1476.850) (-1496.123) (-1484.022) [-1473.846] -- 0:02:23
469500 -- (-1486.763) (-1476.948) (-1482.425) [-1477.399] * (-1480.562) [-1471.582] (-1485.283) (-1484.732) -- 0:02:24
470000 -- [-1481.518] (-1512.022) (-1485.090) (-1478.723) * (-1477.468) (-1478.009) [-1473.221] (-1482.931) -- 0:02:24
Average standard deviation of split frequencies: 0.011351
470500 -- (-1494.868) (-1486.480) (-1479.548) [-1479.907] * (-1491.594) (-1472.435) (-1490.624) [-1478.867] -- 0:02:24
471000 -- (-1491.865) [-1479.290] (-1476.075) (-1488.144) * (-1488.375) [-1478.327] (-1473.101) (-1499.223) -- 0:02:23
471500 -- (-1493.099) [-1474.069] (-1489.458) (-1469.490) * (-1479.733) (-1472.206) [-1484.701] (-1493.341) -- 0:02:23
472000 -- (-1484.564) (-1484.969) (-1481.607) [-1471.923] * [-1471.683] (-1479.429) (-1477.672) (-1492.395) -- 0:02:23
472500 -- (-1502.448) (-1501.055) [-1477.572] (-1486.652) * [-1491.927] (-1477.273) (-1483.818) (-1487.468) -- 0:02:22
473000 -- [-1475.911] (-1494.929) (-1484.042) (-1485.758) * (-1480.884) (-1495.582) [-1474.838] (-1492.156) -- 0:02:22
473500 -- (-1498.132) (-1487.556) (-1493.968) [-1482.289] * [-1479.237] (-1494.412) (-1474.828) (-1487.778) -- 0:02:23
474000 -- [-1483.502] (-1474.961) (-1487.463) (-1480.242) * [-1471.890] (-1485.511) (-1479.737) (-1490.775) -- 0:02:23
474500 -- (-1476.886) [-1481.450] (-1501.219) (-1483.274) * (-1485.064) [-1482.441] (-1491.813) (-1489.494) -- 0:02:22
475000 -- [-1480.026] (-1488.499) (-1487.133) (-1483.540) * [-1483.911] (-1489.704) (-1497.028) (-1482.382) -- 0:02:22
Average standard deviation of split frequencies: 0.011601
475500 -- (-1480.445) (-1485.816) (-1491.563) [-1482.577] * (-1479.844) (-1486.871) [-1484.432] (-1498.170) -- 0:02:22
476000 -- (-1484.089) (-1480.648) (-1488.256) [-1474.985] * (-1489.595) (-1484.631) [-1485.106] (-1483.769) -- 0:02:22
476500 -- (-1480.507) (-1474.321) [-1473.373] (-1497.358) * (-1484.521) (-1476.295) [-1501.827] (-1486.825) -- 0:02:21
477000 -- (-1480.589) (-1479.595) [-1478.681] (-1493.426) * (-1487.200) [-1472.117] (-1478.737) (-1490.603) -- 0:02:22
477500 -- (-1509.183) [-1483.070] (-1481.572) (-1494.502) * (-1481.585) (-1491.308) [-1475.031] (-1480.772) -- 0:02:22
478000 -- (-1496.217) [-1477.946] (-1474.700) (-1480.263) * [-1473.177] (-1492.093) (-1485.018) (-1479.993) -- 0:02:21
478500 -- (-1485.184) (-1486.878) [-1477.318] (-1491.198) * (-1498.118) [-1482.050] (-1479.536) (-1482.382) -- 0:02:21
479000 -- (-1489.010) (-1484.489) (-1483.038) [-1491.460] * (-1480.851) (-1477.756) [-1475.533] (-1498.551) -- 0:02:21
479500 -- (-1479.280) [-1479.651] (-1478.647) (-1488.227) * (-1482.239) (-1478.523) [-1469.539] (-1486.733) -- 0:02:21
480000 -- (-1483.757) [-1482.475] (-1488.188) (-1504.000) * (-1494.174) (-1485.976) (-1481.560) [-1483.879] -- 0:02:20
Average standard deviation of split frequencies: 0.012282
480500 -- (-1483.738) (-1480.566) [-1480.002] (-1481.980) * (-1483.491) (-1489.169) (-1492.034) [-1492.011] -- 0:02:20
481000 -- (-1483.338) (-1482.750) (-1494.666) [-1475.015] * (-1482.535) [-1480.572] (-1513.184) (-1491.560) -- 0:02:21
481500 -- [-1483.263] (-1484.676) (-1484.322) (-1489.883) * (-1494.152) (-1485.926) (-1490.063) [-1487.065] -- 0:02:21
482000 -- (-1504.968) (-1483.364) [-1477.918] (-1494.024) * (-1489.536) [-1480.486] (-1486.136) (-1477.965) -- 0:02:20
482500 -- (-1487.281) [-1477.255] (-1482.269) (-1486.087) * (-1486.520) (-1482.056) (-1484.145) [-1478.333] -- 0:02:20
483000 -- (-1503.260) (-1489.588) [-1477.524] (-1496.487) * [-1472.187] (-1483.656) (-1488.629) (-1500.374) -- 0:02:20
483500 -- [-1481.794] (-1477.689) (-1490.640) (-1493.926) * (-1479.285) (-1489.585) [-1483.431] (-1487.805) -- 0:02:19
484000 -- (-1495.775) (-1492.860) [-1478.954] (-1478.228) * [-1480.155] (-1488.546) (-1480.726) (-1502.303) -- 0:02:19
484500 -- (-1488.245) (-1478.956) [-1473.978] (-1478.524) * (-1492.324) [-1471.267] (-1495.418) (-1499.104) -- 0:02:20
485000 -- (-1479.066) (-1483.841) (-1483.037) [-1474.576] * (-1483.798) (-1483.060) [-1487.886] (-1503.397) -- 0:02:20
Average standard deviation of split frequencies: 0.012979
485500 -- [-1470.501] (-1490.615) (-1486.017) (-1497.449) * [-1480.107] (-1485.434) (-1480.731) (-1504.306) -- 0:02:19
486000 -- [-1475.331] (-1478.954) (-1489.636) (-1489.003) * [-1482.818] (-1497.414) (-1477.298) (-1491.897) -- 0:02:19
486500 -- [-1473.050] (-1483.748) (-1491.312) (-1485.030) * (-1485.129) [-1476.120] (-1481.874) (-1482.646) -- 0:02:19
487000 -- (-1485.466) (-1496.909) [-1485.545] (-1487.170) * (-1472.335) [-1488.397] (-1488.203) (-1495.319) -- 0:02:19
487500 -- (-1498.377) (-1487.273) [-1482.266] (-1475.509) * (-1476.098) [-1477.260] (-1492.076) (-1472.149) -- 0:02:18
488000 -- (-1474.276) (-1486.518) (-1492.839) [-1476.235] * (-1483.324) (-1489.436) (-1498.637) [-1484.615] -- 0:02:18
488500 -- [-1476.971] (-1495.303) (-1484.959) (-1476.710) * (-1484.424) [-1490.330] (-1498.028) (-1478.692) -- 0:02:19
489000 -- (-1479.555) [-1477.450] (-1482.513) (-1486.486) * (-1478.953) (-1483.961) [-1487.321] (-1478.078) -- 0:02:18
489500 -- [-1478.999] (-1483.499) (-1473.194) (-1493.374) * (-1478.647) (-1494.101) (-1497.105) [-1474.136] -- 0:02:18
490000 -- [-1478.173] (-1488.911) (-1480.972) (-1495.826) * (-1488.764) (-1480.243) [-1476.987] (-1485.622) -- 0:02:18
Average standard deviation of split frequencies: 0.013176
490500 -- (-1481.558) (-1488.125) (-1482.143) [-1485.550] * [-1473.122] (-1487.204) (-1486.035) (-1489.682) -- 0:02:18
491000 -- (-1487.898) (-1479.368) (-1490.678) [-1477.355] * (-1480.884) [-1487.148] (-1478.271) (-1501.875) -- 0:02:17
491500 -- [-1476.717] (-1477.715) (-1481.311) (-1482.100) * (-1480.939) (-1486.620) (-1485.424) [-1480.506] -- 0:02:17
492000 -- (-1489.595) (-1492.068) [-1484.117] (-1486.293) * (-1494.653) [-1483.920] (-1486.026) (-1482.415) -- 0:02:18
492500 -- (-1487.454) (-1484.604) (-1492.248) [-1488.991] * (-1485.491) (-1489.375) (-1480.888) [-1481.763] -- 0:02:18
493000 -- [-1482.385] (-1485.760) (-1481.020) (-1491.157) * (-1484.542) (-1479.321) (-1478.232) [-1496.780] -- 0:02:17
493500 -- [-1479.092] (-1500.583) (-1483.216) (-1481.200) * [-1477.931] (-1507.967) (-1479.653) (-1491.365) -- 0:02:17
494000 -- [-1480.059] (-1490.308) (-1477.513) (-1489.921) * [-1482.783] (-1489.681) (-1478.016) (-1486.758) -- 0:02:17
494500 -- (-1479.420) (-1487.173) [-1477.738] (-1487.239) * (-1484.052) (-1488.674) (-1479.588) [-1484.637] -- 0:02:16
495000 -- (-1490.682) (-1484.389) (-1482.913) [-1479.587] * (-1474.590) (-1490.712) (-1487.772) [-1478.006] -- 0:02:16
Average standard deviation of split frequencies: 0.012853
495500 -- (-1483.804) (-1480.067) [-1470.808] (-1483.779) * (-1490.020) (-1478.576) (-1483.011) [-1480.885] -- 0:02:16
496000 -- (-1483.486) (-1512.712) [-1474.271] (-1482.605) * [-1472.520] (-1485.527) (-1487.844) (-1479.712) -- 0:02:17
496500 -- (-1478.132) (-1484.144) [-1469.445] (-1480.703) * (-1475.936) (-1486.445) [-1474.749] (-1489.225) -- 0:02:16
497000 -- [-1476.373] (-1475.631) (-1493.574) (-1476.418) * (-1485.599) [-1478.724] (-1499.204) (-1483.259) -- 0:02:16
497500 -- (-1486.069) (-1492.976) [-1482.698] (-1474.512) * (-1475.024) (-1483.974) (-1500.961) [-1475.702] -- 0:02:16
498000 -- (-1473.956) (-1487.572) (-1482.823) [-1478.598] * [-1490.649] (-1498.428) (-1491.437) (-1487.536) -- 0:02:16
498500 -- (-1497.581) (-1489.313) [-1481.643] (-1480.187) * [-1480.743] (-1489.434) (-1492.879) (-1486.651) -- 0:02:15
499000 -- (-1498.701) [-1481.412] (-1485.810) (-1475.579) * (-1480.339) [-1479.208] (-1491.084) (-1481.666) -- 0:02:15
499500 -- (-1493.909) (-1483.124) [-1482.902] (-1486.032) * (-1486.318) (-1493.678) (-1480.326) [-1475.153] -- 0:02:16
500000 -- (-1483.874) [-1488.116] (-1478.798) (-1483.379) * [-1478.285] (-1491.455) (-1481.446) (-1480.621) -- 0:02:16
Average standard deviation of split frequencies: 0.012464
500500 -- (-1492.502) (-1483.119) (-1481.445) [-1478.697] * (-1474.448) (-1481.927) (-1498.727) [-1473.977] -- 0:02:15
501000 -- (-1472.303) (-1487.976) (-1478.436) [-1476.056] * (-1479.236) (-1491.223) (-1496.280) [-1479.923] -- 0:02:15
501500 -- (-1473.260) [-1476.616] (-1479.122) (-1482.080) * (-1483.818) [-1466.400] (-1480.737) (-1484.824) -- 0:02:15
502000 -- (-1477.741) (-1486.545) (-1481.134) [-1471.946] * [-1486.420] (-1474.491) (-1483.016) (-1488.150) -- 0:02:14
502500 -- (-1495.741) (-1482.850) (-1493.775) [-1476.228] * [-1479.527] (-1480.046) (-1499.312) (-1499.977) -- 0:02:14
503000 -- (-1478.289) (-1492.736) [-1482.551] (-1488.138) * [-1476.816] (-1472.401) (-1493.060) (-1471.430) -- 0:02:14
503500 -- (-1493.311) [-1482.114] (-1481.130) (-1478.684) * [-1475.856] (-1477.331) (-1490.951) (-1486.018) -- 0:02:15
504000 -- (-1494.023) [-1479.517] (-1480.881) (-1485.972) * [-1473.966] (-1475.639) (-1479.321) (-1485.025) -- 0:02:14
504500 -- (-1475.939) (-1489.807) (-1475.268) [-1481.853] * [-1479.774] (-1481.447) (-1492.703) (-1489.395) -- 0:02:14
505000 -- [-1476.551] (-1494.324) (-1493.138) (-1479.295) * (-1484.576) (-1491.557) [-1481.753] (-1502.169) -- 0:02:14
Average standard deviation of split frequencies: 0.011845
505500 -- (-1484.683) (-1489.469) (-1488.546) [-1476.120] * (-1473.747) (-1480.336) [-1480.916] (-1477.474) -- 0:02:14
506000 -- (-1481.156) [-1483.539] (-1482.273) (-1480.730) * [-1476.331] (-1493.544) (-1484.541) (-1480.917) -- 0:02:13
506500 -- (-1495.937) (-1474.508) (-1487.693) [-1473.321] * (-1483.950) [-1485.102] (-1480.852) (-1487.174) -- 0:02:14
507000 -- (-1489.321) [-1473.914] (-1498.531) (-1474.196) * (-1488.772) (-1484.778) [-1483.260] (-1495.895) -- 0:02:14
507500 -- (-1477.052) (-1478.251) (-1480.495) [-1472.303] * (-1472.805) (-1482.623) [-1479.702] (-1492.421) -- 0:02:13
508000 -- [-1484.518] (-1474.479) (-1486.425) (-1491.915) * [-1476.933] (-1470.511) (-1482.474) (-1497.934) -- 0:02:13
508500 -- [-1491.012] (-1476.815) (-1496.788) (-1496.083) * (-1472.631) (-1486.099) [-1474.540] (-1481.789) -- 0:02:13
509000 -- (-1482.307) [-1474.581] (-1482.038) (-1487.432) * (-1495.642) [-1475.416] (-1476.321) (-1481.838) -- 0:02:13
509500 -- (-1482.999) (-1479.557) (-1473.539) [-1483.837] * [-1471.864] (-1483.361) (-1479.267) (-1491.518) -- 0:02:12
510000 -- (-1480.912) (-1482.462) [-1475.416] (-1496.555) * (-1473.369) (-1479.402) [-1476.681] (-1493.246) -- 0:02:13
Average standard deviation of split frequencies: 0.011693
510500 -- (-1479.812) [-1486.423] (-1476.386) (-1482.085) * [-1478.680] (-1477.907) (-1491.190) (-1476.628) -- 0:02:13
511000 -- [-1478.677] (-1480.347) (-1478.204) (-1487.255) * (-1477.294) [-1472.271] (-1477.829) (-1485.769) -- 0:02:13
511500 -- (-1478.975) (-1476.439) [-1476.086] (-1482.986) * (-1480.447) (-1483.733) (-1481.545) [-1472.171] -- 0:02:12
512000 -- (-1493.179) (-1499.401) [-1478.489] (-1479.813) * (-1486.176) (-1478.832) (-1493.088) [-1477.646] -- 0:02:12
512500 -- (-1490.247) (-1475.787) (-1489.038) [-1481.495] * [-1473.320] (-1490.786) (-1484.606) (-1485.549) -- 0:02:12
513000 -- (-1495.946) (-1478.637) [-1482.436] (-1482.121) * [-1486.416] (-1482.539) (-1479.479) (-1495.818) -- 0:02:11
513500 -- (-1488.396) (-1487.928) [-1484.922] (-1499.485) * [-1480.014] (-1474.415) (-1470.971) (-1486.359) -- 0:02:11
514000 -- (-1488.795) (-1483.744) [-1478.510] (-1486.343) * (-1494.871) (-1483.893) [-1480.797] (-1492.841) -- 0:02:12
514500 -- (-1508.884) (-1481.070) [-1474.335] (-1477.064) * (-1483.752) [-1469.038] (-1482.813) (-1496.979) -- 0:02:12
515000 -- (-1493.467) (-1488.479) [-1478.414] (-1501.122) * (-1483.270) [-1474.544] (-1489.657) (-1493.970) -- 0:02:11
Average standard deviation of split frequencies: 0.011615
515500 -- [-1482.371] (-1492.422) (-1474.961) (-1487.634) * (-1474.244) (-1481.413) (-1488.085) [-1490.342] -- 0:02:11
516000 -- [-1468.795] (-1493.646) (-1483.685) (-1491.203) * (-1484.496) (-1481.370) [-1479.037] (-1498.550) -- 0:02:11
516500 -- (-1484.912) [-1477.772] (-1488.980) (-1483.660) * (-1495.475) (-1481.207) (-1492.494) [-1482.814] -- 0:02:11
517000 -- [-1472.267] (-1478.108) (-1490.783) (-1486.738) * (-1502.802) [-1470.465] (-1484.013) (-1493.296) -- 0:02:10
517500 -- [-1472.959] (-1490.027) (-1486.322) (-1500.580) * (-1484.066) (-1479.018) [-1480.362] (-1485.432) -- 0:02:11
518000 -- [-1482.316] (-1490.972) (-1473.694) (-1478.781) * (-1483.829) (-1491.586) (-1472.123) [-1476.445] -- 0:02:11
518500 -- (-1499.238) (-1481.414) [-1475.605] (-1479.279) * (-1493.934) (-1485.896) (-1478.078) [-1483.830] -- 0:02:10
519000 -- [-1486.565] (-1487.543) (-1489.093) (-1482.731) * (-1489.580) (-1490.049) (-1481.647) [-1474.239] -- 0:02:10
519500 -- (-1490.157) [-1479.113] (-1490.522) (-1499.138) * (-1483.941) (-1484.786) (-1505.621) [-1475.076] -- 0:02:10
520000 -- (-1495.513) (-1480.621) (-1475.803) [-1489.248] * (-1488.110) (-1484.290) [-1477.685] (-1480.687) -- 0:02:10
Average standard deviation of split frequencies: 0.010865
520500 -- (-1482.142) (-1489.106) (-1485.225) [-1476.201] * (-1478.352) (-1496.519) (-1475.406) [-1480.106] -- 0:02:09
521000 -- (-1494.032) [-1485.726] (-1477.495) (-1496.756) * (-1479.767) (-1483.067) (-1475.833) [-1481.033] -- 0:02:09
521500 -- (-1495.703) [-1473.314] (-1479.345) (-1486.867) * [-1480.857] (-1498.722) (-1486.729) (-1491.215) -- 0:02:10
522000 -- (-1488.124) (-1476.756) [-1478.058] (-1473.930) * (-1481.162) [-1490.901] (-1498.022) (-1487.938) -- 0:02:10
522500 -- (-1487.048) (-1478.286) [-1471.667] (-1482.942) * (-1501.816) (-1478.244) [-1479.553] (-1487.961) -- 0:02:09
523000 -- (-1489.379) [-1478.933] (-1484.503) (-1489.657) * (-1475.735) [-1476.689] (-1487.297) (-1476.016) -- 0:02:09
523500 -- [-1481.162] (-1481.959) (-1486.053) (-1487.418) * (-1475.297) (-1498.782) [-1483.387] (-1485.689) -- 0:02:09
524000 -- (-1483.437) (-1482.858) (-1475.260) [-1492.741] * (-1474.998) [-1486.075] (-1484.472) (-1496.388) -- 0:02:08
524500 -- (-1482.217) (-1486.323) [-1473.136] (-1479.702) * (-1477.378) (-1476.940) (-1487.878) [-1477.930] -- 0:02:08
525000 -- (-1486.056) (-1487.995) (-1493.015) [-1479.938] * (-1487.451) [-1478.022] (-1499.328) (-1478.648) -- 0:02:09
Average standard deviation of split frequencies: 0.010669
525500 -- [-1476.252] (-1495.973) (-1482.906) (-1477.985) * [-1481.458] (-1475.576) (-1488.031) (-1483.090) -- 0:02:09
526000 -- (-1485.968) (-1482.783) [-1484.228] (-1474.128) * (-1477.598) [-1477.869] (-1484.793) (-1484.841) -- 0:02:08
526500 -- (-1506.331) [-1481.020] (-1479.293) (-1483.579) * (-1494.157) (-1488.807) [-1484.550] (-1480.056) -- 0:02:08
527000 -- (-1489.824) (-1480.478) (-1479.432) [-1474.888] * (-1475.053) [-1485.788] (-1481.011) (-1481.598) -- 0:02:08
527500 -- (-1488.405) (-1477.666) (-1497.352) [-1487.700] * (-1496.881) [-1480.688] (-1488.936) (-1499.846) -- 0:02:08
528000 -- (-1493.585) (-1483.781) [-1469.341] (-1486.017) * (-1487.925) (-1489.709) [-1480.626] (-1484.214) -- 0:02:07
528500 -- (-1480.871) (-1482.123) [-1472.128] (-1478.714) * (-1492.082) (-1483.637) [-1486.175] (-1480.292) -- 0:02:08
529000 -- (-1483.175) (-1484.535) (-1487.681) [-1469.873] * (-1480.924) (-1490.640) (-1489.201) [-1478.875] -- 0:02:08
529500 -- (-1487.777) (-1484.528) (-1472.596) [-1478.115] * (-1495.935) (-1478.775) (-1492.158) [-1477.171] -- 0:02:07
530000 -- (-1492.039) [-1475.423] (-1494.964) (-1477.992) * (-1482.414) (-1480.401) (-1484.817) [-1484.381] -- 0:02:07
Average standard deviation of split frequencies: 0.010533
530500 -- (-1483.581) (-1480.858) (-1479.072) [-1475.384] * [-1472.781] (-1476.476) (-1487.990) (-1478.393) -- 0:02:07
531000 -- (-1485.108) (-1473.907) (-1488.845) [-1479.587] * (-1475.544) (-1495.967) [-1478.797] (-1495.828) -- 0:02:07
531500 -- [-1487.854] (-1482.932) (-1478.139) (-1483.923) * (-1486.473) (-1494.515) (-1487.130) [-1486.564] -- 0:02:06
532000 -- (-1489.225) (-1492.981) (-1485.884) [-1493.856] * (-1491.872) [-1475.420] (-1495.638) (-1484.529) -- 0:02:06
532500 -- [-1476.318] (-1487.841) (-1485.953) (-1480.678) * [-1484.545] (-1484.410) (-1493.984) (-1477.929) -- 0:02:07
533000 -- (-1481.165) [-1486.005] (-1482.529) (-1497.098) * [-1481.473] (-1481.868) (-1481.056) (-1484.142) -- 0:02:07
533500 -- [-1479.171] (-1498.196) (-1494.795) (-1494.671) * (-1474.108) [-1486.765] (-1487.196) (-1493.500) -- 0:02:06
534000 -- [-1476.465] (-1485.284) (-1478.582) (-1494.004) * (-1484.397) [-1480.582] (-1500.795) (-1490.924) -- 0:02:06
534500 -- [-1479.836] (-1482.851) (-1482.462) (-1486.511) * [-1478.345] (-1483.007) (-1479.390) (-1480.439) -- 0:02:06
535000 -- (-1486.361) (-1482.643) [-1478.294] (-1498.856) * [-1475.687] (-1493.646) (-1503.253) (-1482.161) -- 0:02:06
Average standard deviation of split frequencies: 0.010638
535500 -- (-1482.132) (-1488.903) (-1481.460) [-1493.329] * (-1487.440) [-1475.916] (-1479.967) (-1486.568) -- 0:02:05
536000 -- (-1476.622) (-1492.358) (-1486.183) [-1489.674] * (-1480.160) (-1473.557) [-1472.537] (-1482.163) -- 0:02:06
536500 -- (-1478.914) [-1481.189] (-1496.263) (-1502.471) * (-1493.076) [-1472.535] (-1492.136) (-1486.077) -- 0:02:06
537000 -- [-1469.919] (-1480.827) (-1478.599) (-1488.705) * [-1482.543] (-1475.141) (-1483.562) (-1488.837) -- 0:02:05
537500 -- (-1494.558) [-1477.535] (-1482.586) (-1496.009) * (-1484.091) [-1482.517] (-1477.491) (-1483.350) -- 0:02:05
538000 -- (-1491.286) (-1477.134) (-1490.205) [-1481.990] * (-1488.446) (-1488.244) [-1482.711] (-1487.245) -- 0:02:05
538500 -- (-1484.411) [-1479.483] (-1481.026) (-1487.374) * (-1493.762) [-1473.732] (-1484.258) (-1488.082) -- 0:02:05
539000 -- (-1485.228) (-1468.751) [-1476.828] (-1496.386) * [-1480.745] (-1485.767) (-1487.496) (-1487.412) -- 0:02:04
539500 -- (-1476.853) (-1482.580) (-1479.856) [-1477.825] * (-1487.761) (-1483.506) (-1486.749) [-1485.571] -- 0:02:04
540000 -- [-1481.804] (-1474.261) (-1476.816) (-1486.945) * (-1500.840) [-1473.568] (-1480.628) (-1475.594) -- 0:02:05
Average standard deviation of split frequencies: 0.010753
540500 -- [-1471.845] (-1473.899) (-1478.589) (-1486.092) * (-1478.042) [-1474.963] (-1482.764) (-1494.799) -- 0:02:04
541000 -- [-1484.510] (-1474.563) (-1485.775) (-1487.859) * (-1486.366) (-1484.573) (-1484.102) [-1481.891] -- 0:02:04
541500 -- (-1482.512) (-1501.818) [-1480.738] (-1486.229) * (-1479.416) (-1489.619) [-1477.570] (-1499.593) -- 0:02:04
542000 -- (-1482.481) [-1488.414] (-1478.721) (-1492.160) * (-1475.707) [-1492.782] (-1492.218) (-1493.675) -- 0:02:04
542500 -- [-1478.144] (-1490.668) (-1488.314) (-1492.221) * (-1487.938) [-1479.558] (-1480.834) (-1483.800) -- 0:02:03
543000 -- [-1479.955] (-1500.852) (-1489.349) (-1483.754) * (-1490.243) [-1476.851] (-1476.780) (-1487.916) -- 0:02:03
543500 -- (-1485.432) (-1487.859) [-1483.932] (-1474.712) * (-1494.542) (-1485.348) [-1483.947] (-1490.240) -- 0:02:04
544000 -- (-1482.521) (-1472.466) (-1478.149) [-1477.845] * (-1480.645) [-1484.179] (-1491.776) (-1482.282) -- 0:02:04
544500 -- (-1480.039) (-1486.719) (-1488.864) [-1475.711] * (-1474.633) (-1493.091) (-1477.888) [-1485.386] -- 0:02:03
545000 -- (-1487.844) (-1482.945) (-1480.824) [-1478.168] * [-1482.725] (-1480.472) (-1479.439) (-1497.451) -- 0:02:03
Average standard deviation of split frequencies: 0.010854
545500 -- [-1485.027] (-1489.714) (-1479.609) (-1478.081) * (-1490.809) [-1477.701] (-1479.728) (-1489.338) -- 0:02:03
546000 -- (-1490.239) [-1482.499] (-1479.259) (-1480.454) * (-1488.067) (-1476.850) [-1481.025] (-1478.977) -- 0:02:03
546500 -- (-1488.798) (-1476.224) [-1483.992] (-1491.304) * (-1487.797) [-1479.094] (-1490.858) (-1502.505) -- 0:02:02
547000 -- (-1468.495) (-1476.719) [-1480.240] (-1475.885) * (-1493.090) (-1481.005) [-1477.103] (-1487.410) -- 0:02:03
547500 -- [-1485.216] (-1477.924) (-1483.269) (-1477.616) * (-1494.641) (-1477.811) [-1478.853] (-1484.544) -- 0:02:03
548000 -- (-1491.085) (-1481.341) [-1477.769] (-1488.924) * (-1487.565) (-1482.886) [-1479.966] (-1486.853) -- 0:02:02
548500 -- (-1492.062) (-1473.028) (-1486.038) [-1475.128] * (-1495.575) [-1475.122] (-1480.292) (-1483.662) -- 0:02:02
549000 -- (-1484.160) (-1488.915) [-1476.483] (-1491.860) * (-1474.700) (-1495.541) [-1475.739] (-1482.405) -- 0:02:02
549500 -- (-1479.374) (-1484.764) (-1479.846) [-1479.840] * (-1481.391) (-1491.898) (-1476.505) [-1488.578] -- 0:02:02
550000 -- (-1484.744) [-1479.288] (-1481.297) (-1487.934) * (-1485.181) [-1475.932] (-1488.193) (-1478.766) -- 0:02:01
Average standard deviation of split frequencies: 0.011251
550500 -- (-1480.843) [-1482.594] (-1482.155) (-1478.999) * (-1479.708) [-1479.003] (-1488.619) (-1484.914) -- 0:02:01
551000 -- (-1477.776) (-1490.711) (-1472.236) [-1480.452] * (-1481.703) (-1483.570) [-1474.213] (-1480.366) -- 0:02:02
551500 -- (-1478.959) (-1484.969) [-1477.726] (-1477.530) * (-1478.605) [-1482.848] (-1468.979) (-1481.239) -- 0:02:01
552000 -- (-1510.719) (-1490.465) (-1473.725) [-1484.124] * (-1491.864) (-1487.837) [-1473.545] (-1488.218) -- 0:02:01
552500 -- (-1481.976) (-1485.378) (-1481.171) [-1492.973] * (-1490.928) (-1474.640) (-1480.143) [-1479.247] -- 0:02:01
553000 -- [-1484.473] (-1489.245) (-1492.533) (-1486.053) * [-1484.314] (-1480.625) (-1481.169) (-1492.195) -- 0:02:01
553500 -- (-1479.991) (-1488.486) [-1476.784] (-1487.988) * [-1475.090] (-1479.701) (-1486.755) (-1492.535) -- 0:02:01
554000 -- [-1472.149] (-1488.134) (-1478.756) (-1483.823) * (-1480.453) [-1474.569] (-1483.273) (-1486.818) -- 0:02:00
554500 -- (-1478.626) (-1487.609) (-1472.924) [-1479.360] * (-1473.263) [-1480.648] (-1492.043) (-1499.219) -- 0:02:01
555000 -- (-1483.471) (-1478.977) (-1475.273) [-1480.592] * [-1480.390] (-1476.840) (-1485.151) (-1489.219) -- 0:02:01
Average standard deviation of split frequencies: 0.010982
555500 -- (-1494.239) [-1481.038] (-1486.493) (-1490.775) * (-1487.318) [-1479.176] (-1487.930) (-1471.770) -- 0:02:00
556000 -- (-1494.346) [-1477.280] (-1483.255) (-1494.295) * [-1484.224] (-1486.485) (-1482.704) (-1481.268) -- 0:02:00
556500 -- (-1480.377) [-1478.373] (-1485.624) (-1488.856) * (-1488.300) (-1483.188) [-1480.627] (-1492.607) -- 0:02:00
557000 -- [-1477.837] (-1480.717) (-1473.750) (-1483.079) * [-1482.118] (-1489.255) (-1492.990) (-1489.291) -- 0:02:00
557500 -- [-1477.951] (-1481.965) (-1489.887) (-1493.022) * [-1479.811] (-1491.209) (-1470.511) (-1489.334) -- 0:01:59
558000 -- (-1493.464) [-1484.700] (-1473.441) (-1490.927) * (-1478.823) [-1481.403] (-1486.985) (-1496.519) -- 0:01:59
558500 -- (-1495.680) [-1483.330] (-1481.200) (-1481.883) * [-1474.211] (-1473.654) (-1480.155) (-1490.962) -- 0:02:00
559000 -- (-1486.477) (-1484.202) (-1478.840) [-1476.507] * (-1491.639) (-1490.278) (-1475.382) [-1491.796] -- 0:01:59
559500 -- (-1487.213) [-1477.691] (-1477.971) (-1476.783) * (-1490.974) (-1484.486) [-1477.313] (-1491.591) -- 0:01:59
560000 -- (-1479.950) (-1483.227) (-1493.472) [-1479.471] * [-1478.551] (-1483.886) (-1487.756) (-1485.182) -- 0:01:59
Average standard deviation of split frequencies: 0.010690
560500 -- (-1492.971) [-1476.829] (-1487.388) (-1475.512) * (-1482.981) (-1491.188) [-1481.453] (-1492.934) -- 0:01:59
561000 -- (-1484.410) [-1478.736] (-1485.137) (-1481.159) * (-1482.524) (-1483.145) [-1474.900] (-1481.886) -- 0:01:58
561500 -- (-1500.623) (-1482.540) (-1484.685) [-1474.937] * (-1485.373) [-1482.502] (-1478.435) (-1498.859) -- 0:01:58
562000 -- (-1491.050) (-1473.391) (-1480.666) [-1472.708] * (-1480.485) [-1474.678] (-1490.241) (-1485.683) -- 0:01:59
562500 -- [-1474.432] (-1503.695) (-1473.111) (-1482.273) * (-1494.988) [-1471.838] (-1485.823) (-1475.498) -- 0:01:59
563000 -- [-1471.987] (-1486.368) (-1485.804) (-1485.703) * (-1482.259) (-1482.039) [-1474.493] (-1474.206) -- 0:01:58
563500 -- (-1472.816) [-1482.449] (-1473.370) (-1486.793) * (-1490.448) (-1478.478) [-1477.117] (-1477.457) -- 0:01:58
564000 -- (-1470.187) (-1483.521) (-1487.092) [-1482.530] * (-1487.588) (-1480.005) [-1481.662] (-1481.532) -- 0:01:58
564500 -- [-1476.330] (-1490.896) (-1487.883) (-1482.130) * (-1477.333) (-1489.996) (-1487.623) [-1481.769] -- 0:01:58
565000 -- (-1471.152) (-1490.598) [-1482.321] (-1476.903) * (-1483.159) (-1484.280) (-1487.237) [-1491.284] -- 0:01:57
Average standard deviation of split frequencies: 0.010351
565500 -- [-1486.391] (-1489.206) (-1490.646) (-1491.817) * [-1478.943] (-1489.819) (-1480.136) (-1485.739) -- 0:01:58
566000 -- [-1489.144] (-1489.710) (-1492.281) (-1496.107) * (-1485.852) (-1474.661) (-1478.466) [-1478.160] -- 0:01:58
566500 -- (-1480.491) [-1473.543] (-1494.525) (-1490.764) * (-1491.116) (-1474.978) (-1490.229) [-1488.071] -- 0:01:57
567000 -- (-1476.653) (-1491.978) [-1481.966] (-1482.274) * (-1476.550) (-1483.745) [-1482.902] (-1478.574) -- 0:01:57
567500 -- [-1483.034] (-1488.173) (-1487.540) (-1479.995) * [-1479.805] (-1490.181) (-1489.801) (-1499.359) -- 0:01:57
568000 -- [-1482.170] (-1487.681) (-1501.187) (-1481.161) * (-1488.837) [-1475.209] (-1479.614) (-1488.757) -- 0:01:57
568500 -- [-1471.124] (-1474.803) (-1501.938) (-1474.879) * (-1475.185) (-1489.779) [-1472.432] (-1485.858) -- 0:01:56
569000 -- (-1476.963) [-1488.886] (-1483.934) (-1495.041) * (-1481.183) (-1490.230) [-1475.898] (-1485.258) -- 0:01:56
569500 -- (-1493.737) (-1486.841) [-1479.926] (-1492.217) * [-1483.731] (-1478.303) (-1491.104) (-1488.870) -- 0:01:57
570000 -- [-1472.141] (-1485.976) (-1486.186) (-1476.197) * (-1485.604) [-1471.576] (-1486.444) (-1488.114) -- 0:01:56
Average standard deviation of split frequencies: 0.010660
570500 -- (-1488.449) (-1490.353) (-1490.905) [-1476.780] * (-1477.938) (-1493.045) [-1476.509] (-1486.340) -- 0:01:56
571000 -- [-1488.090] (-1491.468) (-1481.124) (-1480.074) * [-1487.801] (-1481.133) (-1485.094) (-1487.829) -- 0:01:56
571500 -- (-1487.773) (-1486.505) [-1489.181] (-1480.098) * [-1473.996] (-1479.813) (-1479.063) (-1484.852) -- 0:01:56
572000 -- (-1480.603) [-1475.853] (-1483.194) (-1498.755) * [-1484.575] (-1481.203) (-1481.479) (-1490.526) -- 0:01:55
572500 -- (-1479.811) [-1482.145] (-1494.099) (-1491.011) * (-1482.206) (-1507.719) [-1468.165] (-1481.555) -- 0:01:55
573000 -- (-1485.182) (-1487.646) [-1481.959] (-1501.828) * (-1480.571) (-1494.907) [-1484.055] (-1484.394) -- 0:01:56
573500 -- (-1493.786) (-1480.234) [-1481.006] (-1474.956) * [-1468.404] (-1493.828) (-1484.967) (-1478.156) -- 0:01:56
574000 -- (-1486.521) [-1475.238] (-1483.954) (-1487.592) * (-1482.459) [-1484.705] (-1482.786) (-1483.970) -- 0:01:55
574500 -- [-1487.137] (-1483.346) (-1486.017) (-1475.869) * (-1479.347) (-1480.713) (-1487.424) [-1474.880] -- 0:01:55
575000 -- [-1471.786] (-1476.028) (-1471.506) (-1496.000) * (-1484.349) (-1483.588) [-1471.666] (-1491.266) -- 0:01:55
Average standard deviation of split frequencies: 0.011458
575500 -- (-1479.096) (-1474.972) [-1470.889] (-1492.673) * (-1479.476) (-1475.297) [-1478.577] (-1486.349) -- 0:01:55
576000 -- (-1482.659) [-1474.321] (-1486.894) (-1477.320) * (-1479.260) (-1476.411) (-1503.384) [-1489.826] -- 0:01:54
576500 -- (-1472.985) [-1474.715] (-1478.125) (-1479.468) * (-1485.281) (-1476.866) (-1487.379) [-1483.401] -- 0:01:54
577000 -- (-1482.303) (-1493.692) [-1478.356] (-1479.077) * (-1491.692) [-1476.848] (-1486.819) (-1484.258) -- 0:01:55
577500 -- (-1488.263) (-1488.846) [-1478.923] (-1472.555) * (-1484.962) (-1491.548) [-1477.807] (-1489.086) -- 0:01:54
578000 -- [-1485.076] (-1475.147) (-1486.190) (-1481.799) * (-1512.849) [-1475.243] (-1483.757) (-1484.969) -- 0:01:54
578500 -- (-1500.101) (-1484.784) [-1476.721] (-1486.327) * (-1494.003) (-1488.676) [-1483.151] (-1486.503) -- 0:01:54
579000 -- (-1489.680) (-1476.497) (-1479.818) [-1473.623] * (-1502.008) (-1483.619) [-1478.757] (-1488.720) -- 0:01:54
579500 -- (-1485.727) [-1476.005] (-1477.474) (-1473.688) * (-1502.509) [-1483.522] (-1477.285) (-1480.443) -- 0:01:53
580000 -- (-1485.285) (-1486.227) (-1482.826) [-1487.287] * (-1500.987) (-1490.617) [-1485.059] (-1491.690) -- 0:01:53
Average standard deviation of split frequencies: 0.011325
580500 -- (-1493.006) [-1482.414] (-1486.563) (-1484.696) * (-1487.560) (-1483.819) (-1480.693) [-1492.132] -- 0:01:54
581000 -- (-1486.706) (-1483.277) (-1482.839) [-1481.997] * [-1477.657] (-1485.849) (-1483.647) (-1488.509) -- 0:01:53
581500 -- (-1492.497) (-1483.298) [-1485.272] (-1480.720) * (-1488.361) (-1496.962) [-1487.092] (-1478.475) -- 0:01:53
582000 -- [-1477.407] (-1485.650) (-1496.688) (-1492.381) * (-1483.957) [-1484.998] (-1480.716) (-1470.350) -- 0:01:53
582500 -- (-1482.638) [-1480.433] (-1487.530) (-1483.645) * (-1480.266) [-1480.429] (-1482.604) (-1468.710) -- 0:01:53
583000 -- (-1483.784) [-1474.787] (-1489.889) (-1490.068) * (-1491.083) [-1477.361] (-1477.916) (-1480.027) -- 0:01:53
583500 -- (-1480.975) [-1485.000] (-1489.039) (-1497.734) * (-1493.657) [-1476.635] (-1479.783) (-1490.716) -- 0:01:52
584000 -- (-1479.204) (-1477.215) (-1479.618) [-1484.060] * (-1491.465) (-1484.653) (-1481.365) [-1481.936] -- 0:01:52
584500 -- (-1475.909) [-1477.863] (-1491.816) (-1487.251) * [-1492.250] (-1491.187) (-1488.312) (-1479.775) -- 0:01:53
585000 -- (-1491.581) [-1479.992] (-1485.628) (-1498.470) * (-1484.882) (-1479.490) [-1478.980] (-1488.653) -- 0:01:52
Average standard deviation of split frequencies: 0.011544
585500 -- [-1491.712] (-1478.980) (-1486.917) (-1486.889) * [-1473.731] (-1477.062) (-1494.241) (-1476.876) -- 0:01:52
586000 -- (-1502.627) (-1487.517) (-1499.958) [-1487.831] * (-1480.357) [-1493.762] (-1488.425) (-1472.980) -- 0:01:52
586500 -- [-1478.072] (-1489.692) (-1502.745) (-1482.821) * (-1481.973) (-1487.738) [-1485.118] (-1493.494) -- 0:01:52
587000 -- (-1474.559) (-1485.891) (-1494.916) [-1486.519] * (-1476.819) (-1485.170) (-1483.952) [-1479.098] -- 0:01:51
587500 -- [-1486.875] (-1480.928) (-1487.742) (-1485.162) * [-1477.380] (-1495.198) (-1484.866) (-1480.959) -- 0:01:51
588000 -- (-1487.188) [-1474.057] (-1485.206) (-1487.383) * (-1482.531) (-1485.769) (-1480.250) [-1473.302] -- 0:01:52
588500 -- (-1473.821) (-1490.333) [-1480.126] (-1492.433) * (-1482.024) (-1484.281) [-1478.299] (-1498.506) -- 0:01:51
589000 -- (-1489.885) (-1484.828) (-1483.074) [-1477.020] * (-1494.248) [-1476.984] (-1482.511) (-1480.065) -- 0:01:51
589500 -- (-1489.618) (-1484.722) [-1483.190] (-1480.225) * (-1479.828) (-1487.823) [-1478.442] (-1493.591) -- 0:01:51
590000 -- [-1481.555] (-1479.836) (-1483.137) (-1486.787) * (-1475.168) (-1486.669) [-1472.133] (-1477.832) -- 0:01:51
Average standard deviation of split frequencies: 0.011133
590500 -- (-1506.356) (-1481.456) [-1482.136] (-1484.168) * [-1477.634] (-1476.697) (-1477.430) (-1487.517) -- 0:01:50
591000 -- (-1476.074) [-1482.312] (-1480.967) (-1475.873) * (-1481.046) (-1482.923) (-1483.948) [-1482.083] -- 0:01:50
591500 -- [-1485.548] (-1479.924) (-1484.064) (-1481.405) * [-1477.624] (-1495.639) (-1481.918) (-1485.643) -- 0:01:50
592000 -- [-1483.176] (-1486.815) (-1491.676) (-1481.027) * (-1476.854) (-1501.365) [-1481.241] (-1483.728) -- 0:01:50
592500 -- (-1490.764) [-1475.850] (-1482.738) (-1480.478) * (-1493.886) (-1490.862) [-1475.710] (-1479.292) -- 0:01:50
593000 -- [-1470.959] (-1485.993) (-1483.218) (-1482.307) * (-1486.003) (-1492.377) [-1488.629] (-1482.417) -- 0:01:50
593500 -- (-1481.087) (-1507.544) [-1482.642] (-1477.840) * (-1490.690) (-1495.029) (-1471.778) [-1482.008] -- 0:01:50
594000 -- [-1479.352] (-1484.754) (-1496.644) (-1484.877) * (-1478.385) [-1481.948] (-1481.635) (-1476.906) -- 0:01:50
594500 -- (-1494.576) (-1478.828) (-1500.471) [-1474.714] * (-1485.421) (-1503.127) [-1483.630] (-1485.593) -- 0:01:49
595000 -- (-1483.362) [-1474.093] (-1492.923) (-1480.853) * (-1476.965) (-1485.850) [-1474.580] (-1499.855) -- 0:01:49
Average standard deviation of split frequencies: 0.011429
595500 -- (-1486.504) [-1477.450] (-1494.946) (-1483.764) * (-1478.495) (-1486.031) (-1488.942) [-1481.331] -- 0:01:50
596000 -- (-1481.322) [-1485.582] (-1498.617) (-1477.691) * (-1487.516) (-1490.851) (-1489.277) [-1488.285] -- 0:01:49
596500 -- (-1482.919) (-1495.757) (-1491.648) [-1485.108] * (-1477.353) (-1497.536) (-1480.986) [-1481.698] -- 0:01:49
597000 -- (-1486.707) [-1472.796] (-1479.663) (-1474.550) * [-1486.822] (-1493.391) (-1483.990) (-1474.150) -- 0:01:49
597500 -- [-1484.963] (-1481.630) (-1479.756) (-1490.355) * (-1482.262) [-1477.990] (-1488.648) (-1492.052) -- 0:01:49
598000 -- (-1491.286) (-1475.523) [-1487.419] (-1476.598) * (-1490.520) [-1486.966] (-1475.213) (-1490.416) -- 0:01:48
598500 -- (-1480.844) (-1491.583) (-1472.248) [-1480.248] * (-1490.755) (-1491.850) (-1482.567) [-1470.882] -- 0:01:48
599000 -- [-1481.407] (-1475.954) (-1485.674) (-1493.952) * (-1499.531) (-1491.357) [-1471.860] (-1480.687) -- 0:01:48
599500 -- (-1486.739) (-1483.320) [-1476.202] (-1487.821) * (-1477.314) (-1491.341) (-1479.079) [-1476.227] -- 0:01:48
600000 -- [-1477.384] (-1484.709) (-1473.739) (-1487.952) * (-1484.486) (-1493.679) (-1491.831) [-1469.917] -- 0:01:48
Average standard deviation of split frequencies: 0.012478
600500 -- (-1475.710) [-1484.791] (-1484.358) (-1488.571) * [-1471.652] (-1490.140) (-1477.788) (-1490.592) -- 0:01:48
601000 -- [-1477.620] (-1488.473) (-1486.275) (-1490.899) * (-1494.435) (-1481.422) (-1484.799) [-1472.852] -- 0:01:48
601500 -- (-1483.009) [-1483.286] (-1484.820) (-1485.320) * (-1476.400) [-1472.570] (-1480.380) (-1487.273) -- 0:01:47
602000 -- (-1480.131) (-1486.666) [-1471.845] (-1484.416) * (-1489.397) (-1477.135) (-1480.862) [-1479.045] -- 0:01:47
602500 -- (-1489.096) [-1481.196] (-1476.315) (-1480.436) * (-1491.514) (-1483.322) (-1487.728) [-1482.480] -- 0:01:47
603000 -- (-1485.701) (-1479.278) [-1474.891] (-1490.947) * (-1490.984) [-1473.186] (-1485.007) (-1478.705) -- 0:01:47
603500 -- (-1501.883) [-1479.898] (-1472.650) (-1492.562) * [-1485.061] (-1473.119) (-1494.621) (-1484.937) -- 0:01:47
604000 -- (-1494.976) [-1481.424] (-1497.611) (-1479.875) * [-1474.493] (-1502.799) (-1491.438) (-1475.049) -- 0:01:47
604500 -- [-1479.624] (-1483.869) (-1480.726) (-1483.906) * (-1481.625) (-1489.375) [-1477.765] (-1476.916) -- 0:01:47
605000 -- (-1498.254) [-1483.722] (-1485.537) (-1502.428) * (-1487.642) [-1477.915] (-1483.885) (-1483.039) -- 0:01:47
Average standard deviation of split frequencies: 0.012407
605500 -- [-1477.623] (-1498.270) (-1479.112) (-1487.045) * (-1489.878) (-1505.648) (-1477.040) [-1481.790] -- 0:01:46
606000 -- [-1479.987] (-1494.808) (-1486.606) (-1491.423) * [-1474.387] (-1482.178) (-1489.520) (-1484.194) -- 0:01:46
606500 -- [-1491.241] (-1482.092) (-1479.696) (-1472.497) * (-1486.176) (-1501.094) [-1478.809] (-1476.535) -- 0:01:47
607000 -- (-1496.455) (-1488.408) [-1476.076] (-1475.112) * [-1473.834] (-1479.703) (-1482.544) (-1487.766) -- 0:01:46
607500 -- (-1497.958) (-1484.736) (-1482.101) [-1477.189] * (-1476.232) [-1480.479] (-1478.618) (-1479.622) -- 0:01:46
608000 -- (-1491.359) [-1483.302] (-1485.747) (-1486.672) * (-1483.307) [-1482.906] (-1487.101) (-1482.817) -- 0:01:46
608500 -- (-1492.553) [-1475.205] (-1479.436) (-1470.831) * [-1477.659] (-1480.890) (-1488.711) (-1491.460) -- 0:01:46
609000 -- (-1475.035) (-1481.064) [-1479.318] (-1476.688) * [-1481.414] (-1485.601) (-1487.572) (-1492.392) -- 0:01:45
609500 -- (-1499.032) (-1500.710) (-1482.033) [-1487.358] * (-1495.789) [-1476.511] (-1479.108) (-1478.191) -- 0:01:45
610000 -- (-1496.033) [-1475.029] (-1490.350) (-1475.011) * (-1480.067) (-1492.624) (-1490.269) [-1480.921] -- 0:01:45
Average standard deviation of split frequencies: 0.012197
610500 -- (-1475.860) [-1483.737] (-1481.032) (-1494.491) * (-1482.986) (-1483.349) (-1489.459) [-1482.906] -- 0:01:45
611000 -- [-1478.828] (-1483.277) (-1476.525) (-1476.636) * (-1487.222) [-1478.701] (-1486.958) (-1484.357) -- 0:01:45
611500 -- (-1487.733) [-1478.342] (-1496.012) (-1485.146) * (-1478.614) [-1471.648] (-1486.453) (-1496.742) -- 0:01:45
612000 -- (-1499.861) [-1473.131] (-1491.451) (-1493.560) * (-1489.024) (-1476.945) (-1478.956) [-1480.776] -- 0:01:45
612500 -- [-1475.939] (-1478.725) (-1475.516) (-1482.263) * (-1484.136) (-1487.162) (-1504.466) [-1475.997] -- 0:01:45
613000 -- (-1476.836) (-1478.023) (-1492.491) [-1476.642] * (-1486.356) (-1489.090) (-1494.960) [-1472.109] -- 0:01:44
613500 -- (-1482.620) (-1499.559) (-1481.182) [-1470.860] * (-1491.521) (-1489.091) (-1490.719) [-1473.860] -- 0:01:44
614000 -- (-1480.705) (-1496.764) (-1489.421) [-1467.836] * (-1504.529) [-1463.999] (-1479.874) (-1489.839) -- 0:01:44
614500 -- (-1476.204) (-1489.666) [-1482.939] (-1485.708) * [-1473.072] (-1487.426) (-1491.326) (-1476.249) -- 0:01:44
615000 -- [-1476.074] (-1479.114) (-1490.458) (-1475.782) * [-1469.178] (-1479.773) (-1490.996) (-1487.840) -- 0:01:44
Average standard deviation of split frequencies: 0.012321
615500 -- (-1476.593) [-1475.464] (-1495.241) (-1492.698) * (-1483.251) (-1479.447) [-1478.214] (-1484.401) -- 0:01:44
616000 -- (-1513.657) [-1481.512] (-1483.588) (-1483.905) * [-1476.386] (-1481.632) (-1488.858) (-1492.437) -- 0:01:44
616500 -- (-1500.454) (-1487.203) [-1475.172] (-1496.597) * (-1482.906) (-1481.633) (-1486.663) [-1488.303] -- 0:01:43
617000 -- (-1488.667) (-1480.715) (-1483.607) [-1474.542] * (-1488.558) (-1479.163) [-1476.208] (-1492.141) -- 0:01:43
617500 -- (-1479.353) (-1482.115) (-1484.559) [-1483.555] * (-1487.935) [-1477.859] (-1474.644) (-1492.136) -- 0:01:43
618000 -- [-1478.804] (-1488.157) (-1484.368) (-1483.084) * (-1497.445) (-1486.408) [-1472.409] (-1493.960) -- 0:01:43
618500 -- (-1484.367) [-1471.449] (-1484.224) (-1482.199) * (-1485.911) (-1493.535) (-1466.760) [-1486.381] -- 0:01:43
619000 -- (-1488.648) [-1472.722] (-1473.910) (-1479.951) * (-1499.175) [-1471.098] (-1491.906) (-1483.143) -- 0:01:43
619500 -- (-1496.729) (-1485.884) (-1486.650) [-1473.598] * (-1482.556) (-1475.021) [-1468.436] (-1492.026) -- 0:01:43
620000 -- (-1485.079) [-1486.347] (-1486.351) (-1477.742) * [-1481.853] (-1481.370) (-1483.439) (-1479.555) -- 0:01:42
Average standard deviation of split frequencies: 0.012570
620500 -- (-1482.881) [-1481.486] (-1489.120) (-1483.278) * (-1492.926) [-1484.274] (-1476.612) (-1473.673) -- 0:01:42
621000 -- (-1481.438) (-1481.214) [-1479.852] (-1475.978) * (-1486.754) (-1478.465) [-1472.876] (-1476.542) -- 0:01:42
621500 -- (-1496.212) (-1486.437) [-1484.344] (-1479.072) * (-1476.994) (-1492.236) [-1468.360] (-1486.635) -- 0:01:42
622000 -- (-1488.798) (-1480.582) (-1477.599) [-1472.810] * (-1483.583) (-1486.947) [-1473.205] (-1489.064) -- 0:01:42
622500 -- (-1488.531) [-1484.279] (-1480.682) (-1480.068) * [-1476.496] (-1482.469) (-1491.226) (-1502.134) -- 0:01:42
623000 -- (-1480.618) (-1490.883) [-1485.886] (-1476.921) * (-1492.980) (-1480.873) (-1480.775) [-1469.980] -- 0:01:42
623500 -- (-1473.939) (-1494.495) [-1474.707] (-1485.807) * (-1492.686) (-1480.043) (-1487.868) [-1486.101] -- 0:01:42
624000 -- [-1481.860] (-1497.309) (-1479.809) (-1483.396) * [-1478.517] (-1489.396) (-1481.676) (-1485.663) -- 0:01:41
624500 -- [-1473.424] (-1484.568) (-1479.116) (-1486.936) * (-1477.627) (-1479.129) (-1493.965) [-1476.203] -- 0:01:41
625000 -- (-1484.998) (-1498.302) [-1472.737] (-1478.654) * (-1482.549) (-1480.190) (-1472.428) [-1472.176] -- 0:01:42
Average standard deviation of split frequencies: 0.012802
625500 -- (-1497.457) [-1478.929] (-1483.704) (-1473.822) * (-1485.726) [-1474.398] (-1489.905) (-1479.416) -- 0:01:41
626000 -- (-1480.591) (-1475.103) (-1496.628) [-1480.481] * [-1476.206] (-1476.659) (-1479.993) (-1489.181) -- 0:01:41
626500 -- (-1489.429) [-1477.551] (-1484.819) (-1486.732) * [-1480.434] (-1489.641) (-1492.788) (-1484.902) -- 0:01:41
627000 -- (-1490.509) (-1510.538) (-1489.847) [-1479.284] * [-1472.676] (-1492.940) (-1482.418) (-1481.669) -- 0:01:41
627500 -- (-1480.576) (-1487.229) [-1474.949] (-1479.857) * [-1472.359] (-1477.422) (-1487.196) (-1486.461) -- 0:01:40
628000 -- (-1488.763) (-1482.362) (-1477.969) [-1478.060] * (-1480.424) (-1475.301) [-1480.541] (-1498.964) -- 0:01:40
628500 -- (-1492.656) (-1504.109) (-1484.000) [-1478.613] * [-1475.993] (-1479.713) (-1495.551) (-1493.726) -- 0:01:40
629000 -- (-1492.093) [-1485.192] (-1483.566) (-1486.668) * (-1494.697) (-1482.640) [-1492.727] (-1489.433) -- 0:01:40
629500 -- (-1481.051) (-1496.577) [-1480.245] (-1482.555) * [-1475.923] (-1491.037) (-1490.706) (-1493.549) -- 0:01:40
630000 -- (-1490.687) (-1500.572) [-1477.455] (-1481.785) * (-1485.936) (-1495.223) [-1475.918] (-1480.978) -- 0:01:40
Average standard deviation of split frequencies: 0.013193
630500 -- (-1489.723) (-1487.555) [-1489.634] (-1489.988) * [-1477.071] (-1495.133) (-1485.485) (-1482.368) -- 0:01:40
631000 -- (-1478.347) (-1479.152) (-1495.151) [-1480.896] * (-1489.012) (-1484.284) (-1485.416) [-1488.194] -- 0:01:39
631500 -- [-1481.909] (-1486.557) (-1490.792) (-1482.896) * (-1481.968) (-1487.384) (-1490.368) [-1474.366] -- 0:01:39
632000 -- (-1491.372) (-1492.017) (-1488.371) [-1473.006] * (-1476.521) [-1488.541] (-1496.252) (-1481.645) -- 0:01:39
632500 -- (-1489.197) (-1486.229) (-1479.099) [-1482.543] * (-1479.177) (-1480.380) (-1482.081) [-1482.897] -- 0:01:39
633000 -- (-1483.749) (-1488.078) [-1475.199] (-1485.516) * [-1490.105] (-1483.501) (-1485.042) (-1482.855) -- 0:01:39
633500 -- [-1473.876] (-1493.090) (-1493.602) (-1483.567) * (-1491.426) (-1491.584) (-1489.057) [-1472.895] -- 0:01:39
634000 -- (-1482.035) (-1483.900) (-1487.359) [-1477.394] * [-1483.981] (-1482.222) (-1485.384) (-1480.654) -- 0:01:39
634500 -- (-1486.304) [-1479.273] (-1482.181) (-1500.882) * [-1481.486] (-1494.588) (-1480.751) (-1485.558) -- 0:01:39
635000 -- [-1478.806] (-1489.247) (-1486.761) (-1494.949) * (-1488.602) [-1477.281] (-1476.371) (-1514.652) -- 0:01:38
Average standard deviation of split frequencies: 0.012637
635500 -- (-1474.453) [-1478.129] (-1482.842) (-1491.687) * [-1482.673] (-1493.414) (-1491.959) (-1484.096) -- 0:01:38
636000 -- (-1483.719) (-1473.695) [-1483.876] (-1484.574) * [-1477.057] (-1486.484) (-1477.799) (-1478.003) -- 0:01:38
636500 -- (-1482.399) (-1485.056) [-1474.439] (-1486.759) * (-1486.340) (-1491.764) [-1477.791] (-1490.665) -- 0:01:38
637000 -- (-1496.828) [-1478.486] (-1488.952) (-1483.308) * (-1487.586) (-1477.023) [-1474.792] (-1479.898) -- 0:01:38
637500 -- (-1490.895) [-1483.720] (-1480.117) (-1486.260) * [-1471.453] (-1480.041) (-1478.344) (-1491.500) -- 0:01:38
638000 -- (-1491.339) [-1481.847] (-1484.063) (-1474.228) * (-1480.754) [-1479.109] (-1493.360) (-1487.213) -- 0:01:38
638500 -- (-1487.069) (-1486.065) [-1481.737] (-1498.128) * (-1486.663) [-1482.633] (-1480.231) (-1500.229) -- 0:01:37
639000 -- (-1505.074) [-1484.940] (-1483.484) (-1493.836) * (-1483.981) [-1473.723] (-1478.494) (-1493.386) -- 0:01:37
639500 -- (-1491.295) [-1472.928] (-1479.526) (-1491.746) * [-1472.012] (-1478.182) (-1480.376) (-1504.088) -- 0:01:37
640000 -- (-1480.187) (-1485.250) (-1496.215) [-1484.691] * (-1480.753) (-1491.335) (-1476.035) [-1473.610] -- 0:01:37
Average standard deviation of split frequencies: 0.013061
640500 -- [-1476.403] (-1475.343) (-1482.993) (-1492.938) * (-1481.466) (-1491.854) [-1478.175] (-1488.178) -- 0:01:37
641000 -- (-1472.623) [-1485.761] (-1475.722) (-1485.958) * (-1479.566) (-1491.738) [-1471.326] (-1483.566) -- 0:01:37
641500 -- [-1475.482] (-1483.882) (-1483.379) (-1495.708) * (-1484.440) [-1484.330] (-1478.672) (-1482.395) -- 0:01:37
642000 -- (-1484.332) (-1486.762) [-1478.518] (-1482.967) * (-1472.658) (-1478.635) (-1483.295) [-1471.576] -- 0:01:37
642500 -- (-1486.211) (-1481.013) [-1479.728] (-1480.361) * [-1481.281] (-1485.345) (-1485.069) (-1486.007) -- 0:01:36
643000 -- [-1479.108] (-1481.907) (-1483.074) (-1512.296) * (-1482.524) [-1483.280] (-1477.750) (-1501.758) -- 0:01:36
643500 -- [-1478.278] (-1491.477) (-1481.533) (-1484.099) * (-1476.386) (-1488.400) [-1471.466] (-1495.894) -- 0:01:36
644000 -- (-1488.980) (-1484.841) [-1479.423] (-1486.354) * (-1487.279) [-1482.540] (-1491.853) (-1496.947) -- 0:01:36
644500 -- [-1481.415] (-1493.037) (-1489.858) (-1479.936) * (-1487.475) [-1481.815] (-1487.621) (-1478.979) -- 0:01:36
645000 -- (-1480.986) (-1478.768) (-1482.997) [-1474.929] * [-1478.686] (-1493.947) (-1487.549) (-1476.731) -- 0:01:36
Average standard deviation of split frequencies: 0.013865
645500 -- (-1485.067) (-1484.935) (-1483.677) [-1473.841] * (-1471.036) (-1503.288) [-1477.623] (-1482.581) -- 0:01:36
646000 -- (-1484.677) (-1478.910) [-1474.290] (-1485.709) * (-1479.721) (-1476.914) [-1484.875] (-1483.498) -- 0:01:35
646500 -- (-1478.727) (-1495.141) (-1478.371) [-1474.491] * (-1483.673) (-1486.568) [-1487.328] (-1494.093) -- 0:01:35
647000 -- (-1488.206) [-1483.651] (-1483.450) (-1483.133) * [-1481.314] (-1496.170) (-1492.150) (-1487.588) -- 0:01:35
647500 -- (-1483.975) (-1496.075) (-1474.783) [-1490.565] * (-1472.336) [-1485.719] (-1501.083) (-1488.042) -- 0:01:35
648000 -- (-1479.951) (-1483.905) (-1486.238) [-1481.827] * (-1491.501) [-1479.655] (-1493.273) (-1491.079) -- 0:01:35
648500 -- [-1486.084] (-1482.025) (-1481.364) (-1489.293) * (-1491.529) (-1493.501) (-1490.001) [-1485.416] -- 0:01:35
649000 -- [-1487.554] (-1480.793) (-1478.074) (-1483.005) * (-1493.174) (-1486.767) [-1476.461] (-1482.373) -- 0:01:35
649500 -- (-1500.564) (-1497.855) (-1481.011) [-1476.923] * [-1480.677] (-1492.472) (-1490.852) (-1487.497) -- 0:01:34
650000 -- (-1497.997) (-1487.571) [-1477.015] (-1481.529) * [-1480.739] (-1485.450) (-1482.442) (-1485.751) -- 0:01:34
Average standard deviation of split frequencies: 0.013005
650500 -- (-1480.253) (-1471.743) [-1476.446] (-1487.323) * (-1486.951) [-1483.985] (-1484.077) (-1489.166) -- 0:01:34
651000 -- (-1482.896) [-1487.947] (-1479.539) (-1496.201) * (-1499.869) [-1481.312] (-1472.437) (-1483.837) -- 0:01:34
651500 -- (-1481.767) [-1481.635] (-1485.513) (-1488.251) * (-1473.471) (-1496.518) [-1475.196] (-1485.189) -- 0:01:34
652000 -- (-1489.033) (-1482.997) (-1483.160) [-1477.876] * (-1484.196) [-1473.449] (-1485.112) (-1486.332) -- 0:01:34
652500 -- (-1493.036) (-1490.620) [-1477.886] (-1494.144) * (-1486.247) [-1471.221] (-1475.182) (-1491.280) -- 0:01:34
653000 -- (-1483.948) [-1476.076] (-1479.322) (-1510.195) * (-1478.897) [-1471.943] (-1488.652) (-1474.292) -- 0:01:34
653500 -- (-1488.614) (-1482.778) (-1484.665) [-1489.440] * (-1484.693) [-1478.798] (-1496.843) (-1473.985) -- 0:01:33
654000 -- (-1495.345) (-1489.358) [-1484.787] (-1494.985) * (-1480.805) (-1474.847) [-1477.384] (-1485.688) -- 0:01:33
654500 -- (-1489.138) (-1506.489) (-1481.017) [-1478.625] * [-1480.997] (-1484.323) (-1487.693) (-1487.175) -- 0:01:33
655000 -- (-1481.850) (-1500.089) (-1479.348) [-1483.486] * (-1495.597) [-1474.845] (-1480.039) (-1489.399) -- 0:01:33
Average standard deviation of split frequencies: 0.012863
655500 -- (-1487.460) (-1494.746) [-1477.317] (-1488.078) * (-1479.211) [-1483.916] (-1482.066) (-1494.662) -- 0:01:33
656000 -- (-1479.616) (-1487.667) [-1469.493] (-1484.469) * (-1483.911) (-1482.931) (-1477.346) [-1475.641] -- 0:01:33
656500 -- (-1484.197) (-1486.148) [-1477.792] (-1491.251) * (-1479.408) (-1484.552) (-1488.595) [-1481.397] -- 0:01:33
657000 -- (-1491.325) (-1481.390) (-1492.738) [-1476.086] * [-1486.526] (-1488.101) (-1487.396) (-1496.376) -- 0:01:32
657500 -- (-1474.219) [-1482.277] (-1492.622) (-1491.888) * (-1502.473) [-1473.904] (-1478.717) (-1490.840) -- 0:01:32
658000 -- [-1473.907] (-1489.351) (-1489.929) (-1485.040) * (-1482.309) (-1482.350) [-1476.963] (-1506.911) -- 0:01:32
658500 -- (-1478.639) [-1477.534] (-1500.722) (-1483.146) * (-1494.588) (-1480.507) (-1487.328) [-1481.346] -- 0:01:32
659000 -- (-1485.125) [-1476.083] (-1509.089) (-1493.297) * (-1485.813) [-1485.963] (-1503.287) (-1474.943) -- 0:01:32
659500 -- (-1481.403) (-1472.906) (-1487.641) [-1473.747] * (-1498.180) (-1480.253) (-1505.567) [-1473.601] -- 0:01:32
660000 -- (-1487.174) (-1484.065) (-1485.020) [-1474.547] * (-1492.167) (-1487.835) [-1493.165] (-1485.541) -- 0:01:32
Average standard deviation of split frequencies: 0.012487
660500 -- [-1485.592] (-1479.145) (-1484.746) (-1489.641) * (-1494.253) [-1476.725] (-1496.307) (-1479.588) -- 0:01:32
661000 -- (-1487.202) (-1491.290) (-1492.146) [-1485.925] * (-1491.572) (-1492.169) (-1472.129) [-1476.841] -- 0:01:31
661500 -- [-1492.295] (-1488.800) (-1504.513) (-1478.352) * (-1490.186) [-1476.093] (-1493.102) (-1479.949) -- 0:01:31
662000 -- (-1481.160) [-1470.858] (-1501.982) (-1474.133) * (-1496.090) (-1486.803) [-1487.813] (-1479.885) -- 0:01:31
662500 -- (-1486.179) (-1501.232) (-1485.678) [-1491.033] * (-1477.546) [-1478.465] (-1504.158) (-1486.449) -- 0:01:31
663000 -- [-1469.743] (-1494.661) (-1475.190) (-1491.622) * [-1484.620] (-1480.784) (-1483.749) (-1493.108) -- 0:01:31
663500 -- (-1478.920) (-1483.203) (-1473.269) [-1472.811] * (-1494.703) (-1490.689) (-1477.837) [-1482.976] -- 0:01:31
664000 -- (-1491.259) (-1490.253) [-1475.822] (-1477.944) * (-1483.640) (-1483.502) [-1471.713] (-1478.809) -- 0:01:31
664500 -- (-1481.830) (-1481.225) (-1481.815) [-1483.396] * (-1490.194) (-1476.539) [-1481.461] (-1487.130) -- 0:01:30
665000 -- (-1482.659) (-1498.084) (-1487.616) [-1489.499] * (-1489.117) [-1483.147] (-1474.193) (-1474.390) -- 0:01:30
Average standard deviation of split frequencies: 0.012988
665500 -- (-1491.019) (-1485.774) (-1481.331) [-1477.799] * (-1484.841) (-1471.303) (-1480.556) [-1479.964] -- 0:01:30
666000 -- (-1480.180) (-1500.312) (-1483.258) [-1470.844] * (-1488.245) [-1481.083] (-1478.482) (-1487.532) -- 0:01:30
666500 -- [-1474.835] (-1491.897) (-1487.207) (-1484.679) * (-1484.046) (-1472.519) [-1473.896] (-1477.307) -- 0:01:30
667000 -- (-1492.275) [-1477.158] (-1499.644) (-1493.406) * (-1482.177) (-1489.222) [-1482.976] (-1471.436) -- 0:01:30
667500 -- (-1488.479) (-1478.231) (-1490.040) [-1478.317] * [-1475.031] (-1473.715) (-1490.729) (-1481.879) -- 0:01:30
668000 -- [-1474.701] (-1487.375) (-1482.753) (-1472.828) * (-1489.489) [-1476.083] (-1483.556) (-1492.797) -- 0:01:29
668500 -- (-1476.776) (-1486.685) (-1486.460) [-1470.897] * (-1483.843) (-1481.946) [-1486.005] (-1478.323) -- 0:01:29
669000 -- (-1485.824) [-1484.355] (-1485.150) (-1490.560) * (-1485.134) (-1477.811) (-1476.439) [-1484.002] -- 0:01:29
669500 -- (-1481.929) (-1481.438) [-1470.459] (-1476.889) * [-1481.002] (-1490.624) (-1486.937) (-1482.896) -- 0:01:29
670000 -- [-1481.517] (-1483.020) (-1480.730) (-1487.913) * (-1481.984) (-1493.255) (-1483.845) [-1474.737] -- 0:01:29
Average standard deviation of split frequencies: 0.012511
670500 -- (-1486.438) [-1475.604] (-1481.023) (-1478.350) * [-1468.416] (-1475.578) (-1514.829) (-1481.466) -- 0:01:29
671000 -- (-1483.937) (-1482.578) [-1479.343] (-1475.797) * [-1479.076] (-1473.392) (-1488.810) (-1491.905) -- 0:01:29
671500 -- [-1484.071] (-1486.019) (-1505.778) (-1489.060) * [-1476.517] (-1493.301) (-1485.031) (-1497.339) -- 0:01:29
672000 -- (-1479.646) [-1469.136] (-1502.191) (-1481.950) * [-1478.146] (-1482.600) (-1496.870) (-1489.654) -- 0:01:28
672500 -- [-1476.283] (-1488.369) (-1483.307) (-1487.689) * (-1485.168) [-1474.206] (-1494.108) (-1499.736) -- 0:01:28
673000 -- [-1475.835] (-1508.057) (-1486.802) (-1484.245) * [-1480.668] (-1482.521) (-1472.145) (-1483.442) -- 0:01:28
673500 -- (-1493.369) (-1498.908) (-1492.368) [-1473.560] * (-1484.990) [-1474.835] (-1484.560) (-1488.607) -- 0:01:28
674000 -- (-1488.594) (-1495.990) [-1472.838] (-1487.485) * (-1482.717) (-1481.478) (-1480.508) [-1486.627] -- 0:01:28
674500 -- (-1500.143) [-1476.114] (-1487.564) (-1483.441) * (-1488.684) (-1492.790) [-1474.341] (-1495.415) -- 0:01:28
675000 -- [-1480.216] (-1484.605) (-1491.192) (-1483.527) * (-1479.583) (-1489.592) (-1490.379) [-1478.710] -- 0:01:28
Average standard deviation of split frequencies: 0.012517
675500 -- (-1483.574) (-1482.825) (-1493.959) [-1483.668] * (-1491.040) (-1478.080) [-1472.729] (-1476.812) -- 0:01:27
676000 -- [-1481.450] (-1486.894) (-1480.955) (-1477.676) * (-1486.213) [-1476.735] (-1483.894) (-1479.338) -- 0:01:27
676500 -- (-1481.085) (-1477.609) [-1480.334] (-1475.357) * (-1482.674) [-1475.116] (-1487.988) (-1495.230) -- 0:01:27
677000 -- (-1488.095) (-1472.317) [-1477.088] (-1477.521) * (-1478.332) (-1488.746) [-1486.775] (-1486.465) -- 0:01:27
677500 -- [-1471.918] (-1483.490) (-1495.489) (-1477.413) * (-1492.643) [-1488.455] (-1492.031) (-1486.006) -- 0:01:27
678000 -- (-1481.686) (-1495.187) [-1489.612] (-1481.324) * (-1480.490) [-1486.819] (-1482.927) (-1482.811) -- 0:01:27
678500 -- (-1480.082) [-1481.055] (-1492.272) (-1478.835) * (-1477.491) [-1478.243] (-1486.682) (-1481.788) -- 0:01:27
679000 -- (-1479.735) (-1477.155) (-1475.870) [-1470.431] * (-1498.401) (-1479.967) [-1487.923] (-1487.633) -- 0:01:26
679500 -- (-1496.415) [-1476.241] (-1476.691) (-1482.982) * (-1479.684) (-1495.630) (-1483.619) [-1478.008] -- 0:01:26
680000 -- (-1484.521) [-1473.079] (-1476.632) (-1483.970) * (-1489.529) (-1485.379) [-1469.169] (-1484.159) -- 0:01:26
Average standard deviation of split frequencies: 0.012328
680500 -- [-1468.730] (-1481.937) (-1481.098) (-1475.067) * (-1490.484) (-1482.222) (-1480.277) [-1478.163] -- 0:01:26
681000 -- [-1481.267] (-1476.831) (-1479.099) (-1503.407) * (-1492.555) [-1491.630] (-1475.702) (-1485.121) -- 0:01:26
681500 -- (-1481.656) (-1493.877) (-1486.084) [-1478.349] * (-1481.222) (-1489.294) [-1481.045] (-1480.126) -- 0:01:26
682000 -- (-1484.009) (-1513.596) (-1489.594) [-1472.751] * (-1485.628) [-1478.739] (-1475.998) (-1477.217) -- 0:01:26
682500 -- (-1481.134) (-1510.057) [-1490.487] (-1480.182) * (-1494.663) (-1484.780) [-1474.298] (-1490.252) -- 0:01:26
683000 -- (-1484.388) (-1494.101) (-1492.439) [-1476.113] * (-1485.483) (-1478.698) [-1479.285] (-1486.104) -- 0:01:25
683500 -- (-1480.252) (-1492.715) (-1489.121) [-1475.217] * [-1477.345] (-1493.795) (-1489.657) (-1484.556) -- 0:01:25
684000 -- (-1480.970) (-1499.965) [-1490.320] (-1482.101) * (-1481.817) (-1486.060) [-1471.204] (-1481.607) -- 0:01:25
684500 -- [-1483.270] (-1492.595) (-1483.710) (-1477.483) * (-1493.435) (-1479.899) [-1482.114] (-1476.109) -- 0:01:25
685000 -- (-1476.626) (-1493.777) (-1494.002) [-1472.068] * (-1483.118) (-1484.857) (-1483.142) [-1466.324] -- 0:01:25
Average standard deviation of split frequencies: 0.012404
685500 -- [-1481.387] (-1501.512) (-1492.335) (-1483.724) * (-1485.533) (-1497.803) [-1479.238] (-1494.578) -- 0:01:25
686000 -- (-1485.027) (-1503.582) [-1483.144] (-1488.354) * (-1488.358) (-1484.413) (-1480.790) [-1488.950] -- 0:01:25
686500 -- (-1489.616) (-1489.227) (-1482.045) [-1482.310] * (-1482.949) [-1484.815] (-1483.197) (-1491.369) -- 0:01:24
687000 -- [-1491.002] (-1478.137) (-1500.070) (-1484.997) * (-1482.517) (-1471.691) (-1484.247) [-1481.853] -- 0:01:24
687500 -- (-1518.943) [-1482.403] (-1480.094) (-1484.093) * (-1478.814) (-1481.206) (-1494.435) [-1491.311] -- 0:01:25
688000 -- (-1499.646) (-1486.320) [-1478.517] (-1493.528) * (-1481.894) (-1483.386) (-1483.088) [-1476.267] -- 0:01:24
688500 -- (-1480.104) (-1493.963) (-1479.965) [-1491.309] * (-1476.585) (-1499.477) (-1497.531) [-1476.043] -- 0:01:24
689000 -- (-1486.182) (-1497.108) (-1480.749) [-1491.964] * (-1478.132) (-1492.090) [-1482.644] (-1488.224) -- 0:01:24
689500 -- (-1481.591) (-1488.236) [-1476.554] (-1477.423) * [-1475.696] (-1482.806) (-1477.663) (-1488.336) -- 0:01:24
690000 -- (-1484.904) (-1488.568) (-1485.569) [-1480.330] * (-1480.090) [-1483.048] (-1481.690) (-1480.111) -- 0:01:24
Average standard deviation of split frequencies: 0.012934
690500 -- [-1478.763] (-1484.344) (-1486.100) (-1490.704) * (-1487.609) (-1496.783) (-1487.162) [-1488.602] -- 0:01:23
691000 -- (-1490.217) (-1494.026) (-1489.947) [-1478.970] * (-1485.007) (-1508.425) (-1474.855) [-1472.612] -- 0:01:24
691500 -- [-1478.571] (-1492.496) (-1477.553) (-1473.526) * (-1482.399) (-1504.730) (-1495.766) [-1483.610] -- 0:01:23
692000 -- (-1508.116) [-1476.087] (-1492.071) (-1494.199) * [-1478.423] (-1498.441) (-1473.361) (-1480.586) -- 0:01:23
692500 -- (-1492.083) (-1481.028) (-1488.692) [-1484.519] * (-1480.353) (-1486.729) [-1479.242] (-1489.293) -- 0:01:23
693000 -- (-1486.119) (-1478.815) [-1474.666] (-1478.435) * (-1483.391) (-1496.707) (-1483.502) [-1476.019] -- 0:01:23
693500 -- [-1473.789] (-1486.313) (-1476.462) (-1485.187) * [-1480.008] (-1499.763) (-1491.942) (-1477.623) -- 0:01:23
694000 -- [-1477.933] (-1486.152) (-1485.767) (-1483.302) * (-1482.017) (-1488.856) [-1478.642] (-1475.354) -- 0:01:22
694500 -- [-1473.474] (-1490.400) (-1488.802) (-1482.943) * (-1500.166) (-1482.501) (-1493.043) [-1481.658] -- 0:01:22
695000 -- [-1481.357] (-1472.240) (-1485.553) (-1484.544) * (-1481.897) (-1478.397) [-1471.668] (-1501.422) -- 0:01:22
Average standard deviation of split frequencies: 0.013072
695500 -- (-1486.316) (-1478.608) [-1491.329] (-1507.001) * (-1480.846) (-1482.017) [-1469.678] (-1498.350) -- 0:01:22
696000 -- (-1487.493) [-1473.573] (-1483.149) (-1502.493) * (-1490.474) (-1484.453) (-1489.742) [-1491.766] -- 0:01:22
696500 -- (-1486.010) [-1472.431] (-1496.336) (-1501.871) * [-1485.158] (-1487.899) (-1482.076) (-1496.616) -- 0:01:22
697000 -- (-1486.008) (-1475.262) (-1486.632) [-1481.932] * (-1479.314) (-1500.582) [-1478.471] (-1489.112) -- 0:01:22
697500 -- [-1479.626] (-1480.173) (-1508.616) (-1477.225) * (-1486.681) [-1476.084] (-1484.918) (-1488.357) -- 0:01:21
698000 -- (-1485.459) [-1478.401] (-1499.703) (-1475.804) * [-1476.339] (-1477.101) (-1475.670) (-1482.523) -- 0:01:21
698500 -- (-1483.362) (-1491.646) (-1489.585) [-1481.417] * (-1477.387) (-1481.329) [-1482.238] (-1475.104) -- 0:01:22
699000 -- (-1486.963) [-1472.752] (-1480.413) (-1491.352) * (-1483.535) [-1481.550] (-1480.503) (-1488.438) -- 0:01:21
699500 -- (-1487.336) [-1472.345] (-1483.492) (-1480.266) * (-1477.589) (-1478.352) [-1482.619] (-1495.956) -- 0:01:21
700000 -- (-1493.601) (-1485.042) (-1488.532) [-1475.308] * [-1479.338] (-1484.917) (-1481.051) (-1493.924) -- 0:01:21
Average standard deviation of split frequencies: 0.013019
700500 -- (-1487.407) [-1473.986] (-1491.070) (-1485.903) * (-1487.287) (-1472.194) [-1478.245] (-1478.859) -- 0:01:21
701000 -- [-1485.377] (-1475.834) (-1501.249) (-1482.781) * (-1494.415) (-1477.603) [-1476.002] (-1494.450) -- 0:01:21
701500 -- (-1500.621) (-1484.513) [-1487.216] (-1489.493) * (-1488.633) [-1484.927] (-1471.125) (-1482.781) -- 0:01:20
702000 -- (-1482.922) (-1480.659) [-1488.518] (-1478.824) * (-1494.105) (-1479.399) [-1480.147] (-1482.765) -- 0:01:21
702500 -- (-1478.442) [-1476.851] (-1489.952) (-1479.180) * (-1494.206) (-1467.061) (-1487.499) [-1479.359] -- 0:01:20
703000 -- (-1483.201) [-1484.538] (-1480.333) (-1487.607) * [-1478.996] (-1475.491) (-1487.971) (-1483.174) -- 0:01:20
703500 -- (-1472.021) (-1483.782) (-1509.858) [-1492.415] * (-1507.391) [-1477.198] (-1487.757) (-1489.341) -- 0:01:20
704000 -- [-1475.298] (-1477.623) (-1485.288) (-1493.367) * (-1488.212) (-1491.960) (-1473.817) [-1473.838] -- 0:01:20
704500 -- [-1482.481] (-1481.380) (-1487.395) (-1497.857) * (-1481.762) (-1487.570) (-1486.624) [-1477.593] -- 0:01:20
705000 -- (-1478.334) (-1483.000) [-1477.963] (-1481.690) * (-1482.718) (-1487.373) [-1481.452] (-1480.866) -- 0:01:19
Average standard deviation of split frequencies: 0.012586
705500 -- [-1478.675] (-1474.082) (-1474.706) (-1478.508) * (-1492.578) (-1469.833) (-1490.523) [-1487.039] -- 0:01:20
706000 -- [-1481.349] (-1471.788) (-1484.874) (-1478.865) * (-1501.617) (-1479.639) (-1480.052) [-1474.051] -- 0:01:19
706500 -- [-1479.915] (-1484.571) (-1491.211) (-1487.986) * (-1489.901) [-1476.981] (-1483.928) (-1487.215) -- 0:01:19
707000 -- (-1481.747) [-1483.540] (-1483.800) (-1483.726) * (-1494.823) [-1477.494] (-1496.297) (-1484.957) -- 0:01:19
707500 -- [-1486.085] (-1484.347) (-1483.188) (-1484.864) * (-1479.595) (-1491.157) (-1489.504) [-1483.195] -- 0:01:19
708000 -- (-1488.890) [-1482.098] (-1477.655) (-1479.059) * [-1474.216] (-1480.711) (-1502.193) (-1478.243) -- 0:01:19
708500 -- (-1487.793) (-1476.876) (-1489.197) [-1473.127] * (-1486.791) [-1475.382] (-1484.738) (-1485.050) -- 0:01:18
709000 -- (-1480.440) [-1478.681] (-1488.695) (-1474.259) * (-1482.932) [-1476.144] (-1490.715) (-1490.412) -- 0:01:18
709500 -- (-1497.369) [-1472.869] (-1484.090) (-1480.561) * (-1481.671) (-1487.526) (-1481.463) [-1478.653] -- 0:01:19
710000 -- (-1495.452) (-1476.694) (-1477.320) [-1482.002] * (-1486.252) (-1476.072) (-1476.123) [-1474.981] -- 0:01:18
Average standard deviation of split frequencies: 0.012902
710500 -- (-1486.249) [-1488.815] (-1486.707) (-1480.221) * [-1472.715] (-1477.378) (-1481.235) (-1491.540) -- 0:01:18
711000 -- [-1489.119] (-1493.574) (-1487.766) (-1485.385) * (-1490.481) [-1475.843] (-1486.682) (-1490.982) -- 0:01:18
711500 -- (-1511.059) (-1486.495) [-1473.933] (-1473.037) * [-1480.019] (-1495.749) (-1473.757) (-1483.248) -- 0:01:18
712000 -- (-1496.411) (-1483.544) (-1484.212) [-1479.686] * (-1488.894) (-1486.621) [-1473.023] (-1475.494) -- 0:01:18
712500 -- (-1483.315) (-1484.867) (-1490.535) [-1478.282] * (-1491.054) [-1488.831] (-1489.893) (-1489.107) -- 0:01:17
713000 -- (-1488.368) [-1481.143] (-1488.831) (-1481.112) * (-1475.096) (-1495.481) (-1476.798) [-1484.614] -- 0:01:18
713500 -- (-1483.437) (-1501.015) (-1482.947) [-1474.920] * (-1488.297) (-1484.395) [-1485.744] (-1492.242) -- 0:01:17
714000 -- (-1495.286) [-1475.498] (-1481.915) (-1486.887) * (-1495.566) [-1477.623] (-1486.563) (-1498.117) -- 0:01:17
714500 -- (-1493.615) [-1481.805] (-1484.636) (-1483.602) * (-1486.795) (-1481.805) (-1484.955) [-1478.647] -- 0:01:17
715000 -- [-1481.891] (-1486.634) (-1481.488) (-1489.778) * (-1478.484) (-1480.282) (-1486.341) [-1475.489] -- 0:01:17
Average standard deviation of split frequencies: 0.012608
715500 -- (-1485.654) [-1472.721] (-1475.006) (-1484.593) * (-1490.126) (-1489.629) (-1505.132) [-1478.700] -- 0:01:17
716000 -- [-1477.828] (-1494.201) (-1469.870) (-1475.061) * (-1483.055) (-1493.405) (-1474.031) [-1479.742] -- 0:01:16
716500 -- (-1491.035) (-1483.714) [-1471.418] (-1476.558) * [-1479.950] (-1490.602) (-1491.716) (-1479.072) -- 0:01:16
717000 -- (-1476.440) [-1493.741] (-1483.453) (-1477.987) * (-1482.537) (-1485.575) (-1488.379) [-1478.649] -- 0:01:16
717500 -- [-1471.942] (-1492.893) (-1491.625) (-1485.983) * (-1489.929) (-1485.909) (-1481.115) [-1470.962] -- 0:01:16
718000 -- (-1485.853) (-1498.108) (-1488.353) [-1478.992] * (-1492.967) (-1489.258) (-1483.623) [-1477.148] -- 0:01:16
718500 -- (-1480.935) (-1499.128) [-1489.904] (-1485.677) * (-1495.649) [-1474.882] (-1482.513) (-1480.074) -- 0:01:16
719000 -- [-1478.754] (-1492.474) (-1493.098) (-1481.866) * (-1490.241) (-1498.705) [-1477.989] (-1503.275) -- 0:01:16
719500 -- (-1482.513) (-1501.069) [-1485.170] (-1483.748) * (-1484.276) [-1483.765] (-1487.394) (-1482.887) -- 0:01:16
720000 -- (-1488.702) (-1495.616) [-1479.794] (-1479.539) * [-1476.624] (-1477.448) (-1486.343) (-1498.486) -- 0:01:15
Average standard deviation of split frequencies: 0.012559
720500 -- (-1484.489) (-1480.599) [-1478.556] (-1488.088) * (-1474.320) [-1481.108] (-1480.591) (-1483.393) -- 0:01:16
721000 -- (-1493.770) (-1491.278) (-1485.166) [-1473.675] * [-1468.458] (-1478.398) (-1480.359) (-1486.507) -- 0:01:15
721500 -- (-1486.352) (-1490.529) [-1474.421] (-1490.383) * (-1477.307) [-1477.859] (-1483.549) (-1490.678) -- 0:01:15
722000 -- (-1495.605) (-1495.540) [-1482.290] (-1481.978) * (-1484.199) (-1481.132) (-1483.659) [-1477.009] -- 0:01:15
722500 -- (-1490.941) (-1479.704) (-1482.319) [-1479.491] * (-1478.606) (-1483.325) (-1484.474) [-1474.295] -- 0:01:15
723000 -- (-1491.237) (-1488.438) [-1479.911] (-1489.696) * (-1489.260) (-1491.079) [-1478.753] (-1502.837) -- 0:01:15
723500 -- (-1491.614) [-1488.123] (-1478.517) (-1490.452) * (-1483.126) (-1485.177) (-1474.266) [-1474.577] -- 0:01:14
724000 -- [-1478.488] (-1484.991) (-1477.506) (-1479.727) * (-1478.801) (-1484.224) [-1475.498] (-1496.713) -- 0:01:14
724500 -- (-1499.069) (-1478.482) (-1487.963) [-1480.011] * (-1498.515) [-1490.545] (-1487.931) (-1478.032) -- 0:01:14
725000 -- (-1488.526) (-1490.325) (-1498.511) [-1473.716] * [-1478.369] (-1494.137) (-1487.859) (-1484.576) -- 0:01:14
Average standard deviation of split frequencies: 0.012921
725500 -- (-1492.008) (-1494.624) (-1478.858) [-1479.816] * (-1494.134) (-1479.727) (-1485.349) [-1484.711] -- 0:01:14
726000 -- (-1484.848) (-1501.435) (-1481.382) [-1479.313] * (-1482.446) (-1493.671) [-1473.288] (-1479.789) -- 0:01:14
726500 -- (-1483.110) [-1476.467] (-1473.511) (-1492.779) * (-1473.127) (-1506.265) [-1477.213] (-1478.679) -- 0:01:14
727000 -- (-1487.460) (-1483.933) (-1483.808) [-1473.307] * [-1482.483] (-1506.544) (-1481.871) (-1481.392) -- 0:01:13
727500 -- (-1477.702) (-1503.982) (-1482.172) [-1476.497] * [-1472.504] (-1487.203) (-1480.912) (-1503.647) -- 0:01:13
728000 -- [-1483.247] (-1478.231) (-1486.509) (-1485.873) * [-1482.152] (-1493.014) (-1476.802) (-1497.760) -- 0:01:13
728500 -- (-1499.422) [-1475.360] (-1491.197) (-1483.053) * [-1482.516] (-1508.413) (-1480.187) (-1472.496) -- 0:01:13
729000 -- (-1476.252) (-1499.866) [-1478.755] (-1485.055) * [-1483.009] (-1486.582) (-1480.899) (-1491.838) -- 0:01:13
729500 -- (-1489.383) (-1480.510) [-1474.349] (-1487.890) * (-1481.260) (-1493.818) [-1479.769] (-1518.247) -- 0:01:13
730000 -- (-1483.366) [-1479.419] (-1479.139) (-1477.964) * (-1491.999) (-1501.113) [-1483.167] (-1477.155) -- 0:01:13
Average standard deviation of split frequencies: 0.013387
730500 -- [-1477.110] (-1479.724) (-1476.298) (-1482.153) * (-1494.588) (-1485.899) (-1482.110) [-1489.995] -- 0:01:13
731000 -- (-1487.880) [-1474.824] (-1503.152) (-1481.172) * (-1491.105) (-1489.416) (-1481.092) [-1481.559] -- 0:01:12
731500 -- (-1494.768) (-1470.391) (-1494.721) [-1473.123] * (-1489.835) [-1485.437] (-1486.073) (-1477.770) -- 0:01:12
732000 -- (-1485.618) (-1493.083) [-1480.087] (-1487.616) * (-1481.499) (-1484.522) (-1493.821) [-1478.660] -- 0:01:12
732500 -- (-1490.243) (-1490.041) (-1488.354) [-1483.925] * [-1479.742] (-1485.845) (-1474.224) (-1491.021) -- 0:01:12
733000 -- (-1491.068) (-1481.654) (-1483.894) [-1477.496] * [-1477.209] (-1484.831) (-1489.847) (-1490.856) -- 0:01:12
733500 -- (-1493.848) (-1485.862) (-1487.082) [-1475.380] * (-1486.908) [-1485.937] (-1478.819) (-1483.395) -- 0:01:12
734000 -- (-1480.838) (-1496.295) [-1475.880] (-1478.825) * (-1481.979) (-1485.945) [-1479.894] (-1479.522) -- 0:01:12
734500 -- (-1473.267) (-1486.208) [-1473.462] (-1481.142) * [-1480.466] (-1486.111) (-1477.108) (-1479.111) -- 0:01:11
735000 -- (-1484.986) [-1482.882] (-1493.687) (-1478.170) * (-1485.111) (-1490.846) (-1484.399) [-1477.919] -- 0:01:11
Average standard deviation of split frequencies: 0.013098
735500 -- (-1486.647) (-1479.919) (-1490.850) [-1478.474] * (-1492.590) (-1491.116) [-1484.096] (-1493.712) -- 0:01:11
736000 -- (-1486.242) (-1484.856) (-1482.592) [-1477.909] * (-1492.356) (-1491.494) (-1483.003) [-1485.374] -- 0:01:11
736500 -- (-1478.085) [-1479.479] (-1480.033) (-1477.560) * (-1485.172) (-1491.728) (-1494.141) [-1476.664] -- 0:01:11
737000 -- (-1478.823) (-1475.272) [-1474.452] (-1480.622) * (-1483.009) (-1481.547) (-1482.291) [-1473.795] -- 0:01:11
737500 -- (-1486.358) [-1485.891] (-1473.388) (-1499.027) * [-1483.405] (-1489.579) (-1486.426) (-1487.591) -- 0:01:11
738000 -- (-1481.331) [-1483.357] (-1485.993) (-1493.876) * (-1495.377) [-1471.010] (-1479.969) (-1485.699) -- 0:01:11
738500 -- (-1491.932) [-1482.063] (-1491.108) (-1474.271) * [-1489.553] (-1494.297) (-1478.189) (-1496.122) -- 0:01:10
739000 -- (-1491.620) (-1481.772) (-1490.095) [-1477.915] * (-1486.674) (-1494.538) (-1479.405) [-1476.407] -- 0:01:10
739500 -- (-1498.121) (-1485.429) [-1474.416] (-1473.243) * (-1483.158) (-1480.727) [-1471.525] (-1477.734) -- 0:01:10
740000 -- (-1493.705) (-1479.823) (-1488.169) [-1477.760] * (-1485.560) [-1488.492] (-1483.616) (-1487.166) -- 0:01:10
Average standard deviation of split frequencies: 0.013016
740500 -- (-1496.569) (-1474.663) (-1482.480) [-1471.423] * (-1485.066) (-1483.756) [-1481.678] (-1484.203) -- 0:01:10
741000 -- (-1485.943) [-1473.940] (-1483.126) (-1473.238) * (-1481.565) (-1486.529) [-1481.853] (-1483.876) -- 0:01:10
741500 -- (-1494.102) (-1479.322) (-1481.083) [-1488.072] * [-1481.897] (-1477.422) (-1489.197) (-1496.785) -- 0:01:10
742000 -- [-1477.576] (-1484.481) (-1488.123) (-1480.915) * (-1479.870) [-1470.202] (-1474.448) (-1482.971) -- 0:01:09
742500 -- [-1477.011] (-1489.115) (-1484.845) (-1486.907) * [-1475.653] (-1475.791) (-1500.774) (-1485.586) -- 0:01:09
743000 -- (-1487.919) [-1481.598] (-1489.189) (-1479.813) * (-1496.359) (-1481.812) [-1486.023] (-1484.464) -- 0:01:09
743500 -- (-1492.504) (-1481.812) (-1497.080) [-1477.913] * (-1485.040) (-1497.229) [-1475.615] (-1475.426) -- 0:01:09
744000 -- (-1499.573) [-1484.282] (-1486.183) (-1484.535) * [-1474.586] (-1478.643) (-1481.038) (-1485.722) -- 0:01:09
744500 -- [-1482.415] (-1490.004) (-1488.326) (-1478.334) * [-1471.983] (-1484.205) (-1496.383) (-1484.658) -- 0:01:09
745000 -- (-1478.590) (-1481.902) [-1474.470] (-1482.164) * [-1473.665] (-1481.453) (-1502.879) (-1502.944) -- 0:01:09
Average standard deviation of split frequencies: 0.012575
745500 -- (-1482.232) [-1483.769] (-1495.210) (-1480.779) * (-1482.319) (-1481.441) [-1480.065] (-1500.764) -- 0:01:08
746000 -- (-1493.642) (-1482.570) (-1501.878) [-1475.627] * (-1480.731) (-1480.697) [-1472.391] (-1491.833) -- 0:01:08
746500 -- (-1483.427) [-1474.341] (-1491.630) (-1473.800) * (-1490.288) [-1472.489] (-1478.566) (-1498.221) -- 0:01:08
747000 -- (-1494.261) (-1478.778) (-1493.841) [-1473.809] * (-1484.965) (-1474.707) [-1476.648] (-1499.826) -- 0:01:08
747500 -- (-1481.126) [-1479.488] (-1501.263) (-1480.580) * (-1495.331) [-1477.781] (-1481.813) (-1494.587) -- 0:01:08
748000 -- (-1487.011) [-1486.231] (-1474.088) (-1484.412) * [-1474.560] (-1479.797) (-1477.920) (-1486.309) -- 0:01:08
748500 -- [-1479.721] (-1488.514) (-1471.946) (-1496.366) * [-1476.941] (-1489.383) (-1491.091) (-1495.947) -- 0:01:08
749000 -- (-1490.418) (-1483.560) (-1483.356) [-1479.034] * [-1480.408] (-1490.943) (-1487.701) (-1470.404) -- 0:01:08
749500 -- (-1476.025) (-1493.793) (-1489.961) [-1472.758] * (-1481.813) (-1479.122) [-1477.589] (-1491.511) -- 0:01:07
750000 -- (-1484.606) (-1512.638) (-1494.108) [-1478.811] * (-1484.979) (-1500.631) (-1490.378) [-1479.705] -- 0:01:07
Average standard deviation of split frequencies: 0.012842
750500 -- (-1498.254) (-1501.980) (-1482.426) [-1484.913] * [-1482.952] (-1479.137) (-1501.885) (-1478.822) -- 0:01:07
751000 -- [-1478.580] (-1491.078) (-1468.476) (-1483.314) * (-1476.557) (-1482.690) (-1486.021) [-1474.233] -- 0:01:07
751500 -- (-1479.783) [-1478.582] (-1489.593) (-1481.932) * (-1479.607) (-1494.549) (-1485.768) [-1468.572] -- 0:01:07
752000 -- (-1484.590) (-1483.011) (-1474.306) [-1471.457] * [-1475.835] (-1477.693) (-1491.649) (-1490.956) -- 0:01:07
752500 -- (-1495.667) (-1480.319) (-1484.136) [-1474.371] * (-1475.108) (-1471.980) (-1493.243) [-1483.395] -- 0:01:07
753000 -- (-1482.197) [-1482.061] (-1504.420) (-1498.373) * [-1477.944] (-1486.222) (-1485.413) (-1488.149) -- 0:01:06
753500 -- (-1478.627) (-1489.067) (-1506.412) [-1477.772] * [-1480.562] (-1483.436) (-1492.108) (-1477.338) -- 0:01:06
754000 -- [-1486.475] (-1488.520) (-1483.944) (-1485.942) * (-1485.562) [-1479.182] (-1483.046) (-1476.893) -- 0:01:06
754500 -- (-1494.705) (-1486.691) [-1470.381] (-1493.375) * [-1483.223] (-1492.651) (-1480.126) (-1474.791) -- 0:01:06
755000 -- (-1482.761) [-1480.979] (-1483.194) (-1481.921) * [-1489.234] (-1475.810) (-1476.972) (-1490.905) -- 0:01:06
Average standard deviation of split frequencies: 0.012565
755500 -- (-1482.135) [-1477.541] (-1476.374) (-1485.265) * [-1488.875] (-1477.485) (-1482.422) (-1480.616) -- 0:01:06
756000 -- [-1478.838] (-1478.922) (-1479.043) (-1486.348) * (-1484.233) [-1485.005] (-1486.431) (-1489.139) -- 0:01:06
756500 -- (-1492.728) [-1478.990] (-1473.853) (-1476.302) * (-1479.081) [-1489.586] (-1498.146) (-1486.729) -- 0:01:05
757000 -- (-1482.494) (-1486.113) (-1477.923) [-1483.760] * (-1489.070) [-1474.305] (-1472.958) (-1484.307) -- 0:01:05
757500 -- (-1487.657) (-1485.536) (-1474.313) [-1476.694] * (-1483.838) (-1478.581) [-1475.943] (-1492.966) -- 0:01:05
758000 -- (-1505.497) (-1486.823) [-1478.322] (-1483.723) * (-1490.250) (-1492.358) [-1476.190] (-1486.776) -- 0:01:05
758500 -- (-1502.291) [-1484.904] (-1475.279) (-1482.349) * [-1473.666] (-1478.757) (-1473.392) (-1476.315) -- 0:01:05
759000 -- (-1506.831) (-1487.429) (-1485.681) [-1478.006] * (-1497.802) (-1478.306) (-1482.150) [-1477.404] -- 0:01:05
759500 -- (-1482.366) (-1472.020) (-1500.375) [-1480.287] * (-1488.925) (-1489.233) [-1483.216] (-1489.004) -- 0:01:05
760000 -- (-1502.724) (-1481.575) [-1478.817] (-1474.000) * (-1485.723) [-1475.918] (-1492.300) (-1486.399) -- 0:01:05
Average standard deviation of split frequencies: 0.011713
760500 -- (-1514.164) [-1475.463] (-1483.109) (-1479.865) * (-1482.519) (-1473.647) (-1495.995) [-1476.349] -- 0:01:04
761000 -- (-1492.439) (-1482.868) [-1475.667] (-1496.765) * (-1480.628) (-1494.021) (-1491.191) [-1481.793] -- 0:01:05
761500 -- (-1492.940) (-1489.197) (-1469.434) [-1478.962] * [-1478.355] (-1473.719) (-1499.100) (-1478.476) -- 0:01:04
762000 -- (-1479.109) (-1495.746) (-1484.454) [-1493.463] * (-1480.595) [-1485.815] (-1494.283) (-1483.244) -- 0:01:04
762500 -- [-1482.571] (-1485.428) (-1484.347) (-1494.134) * (-1485.939) (-1497.848) [-1480.493] (-1468.845) -- 0:01:04
763000 -- (-1483.417) (-1493.570) [-1485.237] (-1481.801) * (-1488.130) (-1492.086) (-1481.639) [-1473.206] -- 0:01:04
763500 -- [-1477.106] (-1485.864) (-1483.787) (-1478.957) * (-1488.417) (-1492.669) (-1480.797) [-1474.267] -- 0:01:04
764000 -- (-1482.743) (-1483.731) [-1478.912] (-1487.624) * (-1495.127) (-1496.602) [-1475.343] (-1483.723) -- 0:01:03
764500 -- (-1475.074) [-1491.707] (-1478.590) (-1494.988) * (-1493.633) [-1476.655] (-1475.740) (-1482.087) -- 0:01:04
765000 -- (-1494.663) (-1490.730) [-1480.323] (-1496.854) * (-1502.867) [-1490.707] (-1477.076) (-1475.903) -- 0:01:03
Average standard deviation of split frequencies: 0.011693
765500 -- (-1492.854) (-1497.685) [-1482.259] (-1479.474) * (-1485.783) [-1482.160] (-1502.214) (-1481.108) -- 0:01:03
766000 -- [-1482.475] (-1494.239) (-1473.973) (-1473.417) * [-1474.890] (-1483.800) (-1504.170) (-1473.179) -- 0:01:03
766500 -- (-1483.661) [-1483.942] (-1482.766) (-1482.632) * (-1479.288) (-1494.681) [-1493.581] (-1479.914) -- 0:01:03
767000 -- (-1490.844) (-1488.679) [-1466.344] (-1489.613) * [-1482.515] (-1484.373) (-1482.208) (-1486.653) -- 0:01:03
767500 -- [-1481.446] (-1493.887) (-1484.658) (-1491.389) * (-1480.555) [-1485.896] (-1481.556) (-1470.970) -- 0:01:03
768000 -- [-1482.717] (-1486.466) (-1491.672) (-1480.987) * (-1489.039) (-1475.931) (-1475.887) [-1480.068] -- 0:01:02
768500 -- (-1481.669) (-1493.949) (-1492.926) [-1486.871] * (-1490.330) [-1478.668] (-1470.261) (-1488.335) -- 0:01:02
769000 -- (-1490.707) (-1485.587) [-1476.369] (-1473.786) * [-1480.456] (-1489.669) (-1471.630) (-1478.141) -- 0:01:02
769500 -- (-1490.896) (-1477.948) (-1493.558) [-1482.411] * (-1476.273) (-1486.895) (-1484.899) [-1476.396] -- 0:01:02
770000 -- [-1480.626] (-1494.886) (-1487.895) (-1488.791) * (-1490.306) [-1484.723] (-1491.789) (-1483.721) -- 0:01:02
Average standard deviation of split frequencies: 0.011530
770500 -- [-1479.498] (-1474.206) (-1473.842) (-1490.213) * (-1491.415) (-1482.677) [-1483.723] (-1485.477) -- 0:01:02
771000 -- [-1473.771] (-1475.850) (-1483.787) (-1482.924) * (-1489.674) (-1473.206) [-1477.567] (-1490.661) -- 0:01:02
771500 -- (-1479.322) (-1483.063) [-1470.575] (-1485.969) * (-1487.583) [-1486.701] (-1476.319) (-1486.700) -- 0:01:01
772000 -- (-1489.827) (-1489.807) (-1487.739) [-1474.771] * (-1489.194) (-1488.658) (-1485.906) [-1472.482] -- 0:01:02
772500 -- (-1489.212) (-1492.846) (-1477.300) [-1474.702] * [-1483.396] (-1483.295) (-1481.630) (-1474.467) -- 0:01:01
773000 -- (-1496.940) (-1488.195) (-1481.955) [-1493.134] * (-1490.911) [-1477.053] (-1484.336) (-1472.872) -- 0:01:01
773500 -- [-1493.275] (-1490.978) (-1480.053) (-1487.710) * (-1499.347) (-1481.946) [-1478.953] (-1481.705) -- 0:01:01
774000 -- (-1485.223) (-1499.291) (-1484.874) [-1483.603] * (-1489.279) (-1488.081) [-1477.664] (-1490.031) -- 0:01:01
774500 -- (-1501.041) [-1491.882] (-1487.416) (-1491.837) * (-1486.512) (-1488.285) [-1477.861] (-1470.116) -- 0:01:01
775000 -- (-1502.102) (-1485.195) (-1483.345) [-1481.878] * [-1486.891] (-1498.845) (-1480.705) (-1478.684) -- 0:01:00
Average standard deviation of split frequencies: 0.011238
775500 -- (-1483.315) (-1488.773) [-1478.741] (-1490.197) * (-1484.062) (-1478.242) [-1478.601] (-1482.952) -- 0:01:00
776000 -- [-1488.519] (-1475.726) (-1485.015) (-1494.541) * [-1481.057] (-1494.843) (-1500.907) (-1496.525) -- 0:01:00
776500 -- (-1482.364) (-1478.301) [-1470.383] (-1488.216) * (-1477.287) [-1474.886] (-1491.037) (-1503.220) -- 0:01:00
777000 -- (-1490.302) (-1477.541) [-1480.940] (-1488.465) * [-1485.437] (-1476.098) (-1499.966) (-1482.770) -- 0:01:00
777500 -- (-1485.743) (-1490.038) [-1486.604] (-1491.072) * (-1485.964) (-1486.028) (-1499.817) [-1475.701] -- 0:01:00
778000 -- [-1475.499] (-1490.243) (-1492.986) (-1484.908) * (-1476.073) (-1495.947) [-1482.372] (-1480.601) -- 0:01:00
778500 -- (-1493.822) (-1487.786) [-1475.331] (-1475.261) * [-1481.324] (-1491.482) (-1475.746) (-1481.215) -- 0:01:00
779000 -- (-1496.755) (-1475.660) [-1478.208] (-1480.486) * (-1475.280) (-1498.660) [-1475.714] (-1485.314) -- 0:00:59
779500 -- (-1487.120) (-1479.766) [-1482.565] (-1494.281) * (-1493.211) [-1486.246] (-1489.211) (-1480.148) -- 0:00:59
780000 -- (-1472.697) (-1471.224) (-1473.440) [-1484.852] * (-1488.192) (-1490.595) [-1485.107] (-1499.523) -- 0:00:59
Average standard deviation of split frequencies: 0.010899
780500 -- (-1479.019) [-1480.485] (-1490.163) (-1482.846) * (-1488.013) (-1492.537) (-1481.979) [-1476.172] -- 0:00:59
781000 -- (-1508.733) (-1495.826) [-1470.817] (-1478.853) * (-1474.849) (-1476.219) (-1476.306) [-1490.147] -- 0:00:59
781500 -- [-1478.357] (-1489.825) (-1476.348) (-1484.710) * (-1485.853) (-1482.070) [-1479.096] (-1478.279) -- 0:00:59
782000 -- (-1489.209) (-1480.349) (-1493.685) [-1480.196] * [-1481.417] (-1491.881) (-1481.612) (-1486.767) -- 0:00:59
782500 -- (-1484.899) [-1483.288] (-1498.728) (-1492.479) * (-1492.903) (-1480.082) [-1479.239] (-1487.003) -- 0:00:58
783000 -- (-1491.252) [-1475.575] (-1496.956) (-1505.720) * (-1496.309) (-1481.080) (-1488.567) [-1480.027] -- 0:00:58
783500 -- (-1481.957) [-1483.040] (-1481.523) (-1476.872) * (-1480.901) (-1488.131) [-1485.693] (-1473.108) -- 0:00:58
784000 -- (-1489.091) (-1474.902) (-1488.168) [-1484.540] * (-1484.286) [-1478.460] (-1487.918) (-1485.458) -- 0:00:58
784500 -- [-1490.149] (-1484.227) (-1485.316) (-1480.532) * [-1476.050] (-1493.839) (-1498.439) (-1483.449) -- 0:00:58
785000 -- (-1489.606) (-1484.583) (-1479.240) [-1475.173] * [-1473.983] (-1492.605) (-1482.253) (-1486.102) -- 0:00:58
Average standard deviation of split frequencies: 0.010139
785500 -- (-1489.692) (-1479.729) (-1488.443) [-1476.113] * [-1485.220] (-1483.043) (-1482.444) (-1495.397) -- 0:00:58
786000 -- (-1478.772) (-1493.594) [-1483.098] (-1476.306) * (-1482.708) [-1474.371] (-1500.970) (-1479.419) -- 0:00:57
786500 -- (-1489.572) [-1474.636] (-1479.549) (-1492.616) * (-1485.360) [-1471.054] (-1484.605) (-1491.948) -- 0:00:57
787000 -- (-1484.492) [-1476.037] (-1483.485) (-1485.329) * (-1473.050) [-1486.442] (-1491.309) (-1486.061) -- 0:00:57
787500 -- (-1485.460) (-1494.010) (-1495.970) [-1478.783] * (-1474.719) (-1511.897) [-1480.570] (-1499.661) -- 0:00:57
788000 -- (-1488.873) (-1487.025) (-1497.829) [-1470.965] * (-1479.935) (-1498.348) (-1504.269) [-1482.229] -- 0:00:57
788500 -- [-1473.959] (-1477.746) (-1498.195) (-1487.833) * (-1478.396) [-1479.294] (-1493.321) (-1492.203) -- 0:00:57
789000 -- [-1474.967] (-1489.201) (-1491.475) (-1476.179) * (-1486.277) (-1490.239) (-1479.508) [-1478.033] -- 0:00:57
789500 -- (-1493.778) [-1482.289] (-1490.352) (-1483.856) * (-1492.371) [-1477.438] (-1495.721) (-1482.548) -- 0:00:57
790000 -- (-1484.583) (-1479.309) [-1479.969] (-1482.021) * (-1494.924) (-1472.485) (-1487.242) [-1474.064] -- 0:00:56
Average standard deviation of split frequencies: 0.009795
790500 -- [-1479.657] (-1489.619) (-1487.804) (-1476.996) * (-1474.239) (-1486.847) [-1481.675] (-1477.184) -- 0:00:56
791000 -- (-1498.186) (-1480.207) [-1484.158] (-1489.008) * [-1476.107] (-1480.085) (-1476.633) (-1481.017) -- 0:00:56
791500 -- (-1484.982) [-1474.899] (-1477.316) (-1486.287) * (-1485.611) [-1471.932] (-1480.366) (-1491.172) -- 0:00:56
792000 -- (-1502.268) (-1475.531) [-1476.218] (-1486.104) * (-1482.668) (-1505.419) [-1482.634] (-1482.301) -- 0:00:56
792500 -- (-1479.258) [-1473.321] (-1479.483) (-1482.984) * (-1483.322) (-1490.158) [-1472.878] (-1486.733) -- 0:00:56
793000 -- (-1485.543) (-1484.621) (-1485.344) [-1471.632] * (-1475.418) (-1488.094) [-1491.301] (-1492.599) -- 0:00:56
793500 -- (-1485.386) (-1473.972) [-1476.967] (-1485.682) * (-1476.312) (-1486.582) (-1485.508) [-1480.000] -- 0:00:55
794000 -- (-1472.538) [-1469.014] (-1483.618) (-1480.651) * [-1480.709] (-1484.997) (-1497.297) (-1486.271) -- 0:00:55
794500 -- (-1479.678) (-1484.814) [-1478.849] (-1486.130) * (-1471.345) [-1494.501] (-1479.675) (-1491.208) -- 0:00:55
795000 -- (-1482.324) (-1483.323) (-1486.140) [-1473.186] * (-1490.471) [-1478.553] (-1480.458) (-1490.560) -- 0:00:55
Average standard deviation of split frequencies: 0.009898
795500 -- (-1485.832) (-1470.011) [-1479.206] (-1477.910) * [-1474.235] (-1484.510) (-1485.267) (-1484.652) -- 0:00:55
796000 -- (-1481.479) (-1479.590) (-1485.794) [-1480.615] * [-1477.964] (-1481.965) (-1480.713) (-1484.998) -- 0:00:55
796500 -- (-1495.473) (-1479.745) [-1476.593] (-1476.238) * [-1472.087] (-1485.924) (-1496.847) (-1499.307) -- 0:00:55
797000 -- (-1490.425) [-1478.979] (-1491.750) (-1478.623) * (-1490.551) (-1488.986) [-1480.330] (-1493.347) -- 0:00:55
797500 -- (-1485.076) [-1476.306] (-1488.551) (-1478.285) * [-1480.668] (-1483.379) (-1482.210) (-1492.126) -- 0:00:54
798000 -- (-1478.142) (-1474.710) [-1478.348] (-1495.256) * (-1480.256) (-1491.912) [-1477.062] (-1501.184) -- 0:00:54
798500 -- (-1498.409) [-1470.060] (-1495.175) (-1489.586) * (-1496.552) [-1473.956] (-1488.718) (-1480.623) -- 0:00:54
799000 -- [-1483.149] (-1477.940) (-1482.966) (-1479.876) * [-1470.846] (-1490.266) (-1491.438) (-1483.270) -- 0:00:54
799500 -- (-1483.741) [-1481.413] (-1483.749) (-1490.100) * (-1495.144) [-1480.402] (-1491.289) (-1485.387) -- 0:00:54
800000 -- (-1484.733) (-1493.316) [-1474.541] (-1487.004) * (-1493.282) [-1490.778] (-1479.079) (-1489.071) -- 0:00:54
Average standard deviation of split frequencies: 0.010421
800500 -- [-1481.645] (-1481.270) (-1481.052) (-1502.692) * (-1478.367) (-1479.999) (-1490.335) [-1470.752] -- 0:00:54
801000 -- [-1477.007] (-1478.973) (-1481.043) (-1482.222) * (-1477.950) [-1489.855] (-1484.300) (-1497.887) -- 0:00:53
801500 -- (-1486.366) (-1483.818) [-1486.472] (-1489.981) * (-1487.803) (-1482.528) [-1493.877] (-1474.721) -- 0:00:53
802000 -- (-1486.573) [-1480.309] (-1479.611) (-1484.987) * (-1482.627) (-1475.899) (-1484.324) [-1475.259] -- 0:00:53
802500 -- (-1490.010) (-1483.057) [-1475.118] (-1484.353) * (-1483.888) [-1477.533] (-1482.494) (-1480.994) -- 0:00:53
803000 -- (-1474.639) (-1474.008) [-1475.841] (-1484.070) * (-1475.660) [-1475.268] (-1491.065) (-1488.014) -- 0:00:53
803500 -- (-1478.541) (-1474.349) [-1477.469] (-1487.334) * (-1477.093) [-1482.678] (-1480.581) (-1496.874) -- 0:00:53
804000 -- (-1483.773) [-1490.788] (-1510.202) (-1486.606) * (-1485.789) (-1490.119) (-1487.890) [-1482.830] -- 0:00:53
804500 -- (-1477.837) (-1486.341) [-1483.952] (-1489.021) * (-1480.438) (-1482.227) (-1483.671) [-1474.464] -- 0:00:52
805000 -- (-1491.983) [-1479.634] (-1487.245) (-1483.572) * [-1482.141] (-1485.201) (-1486.439) (-1502.696) -- 0:00:52
Average standard deviation of split frequencies: 0.010193
805500 -- (-1513.063) (-1476.607) (-1479.361) [-1482.922] * (-1482.925) (-1503.425) [-1480.593] (-1483.753) -- 0:00:52
806000 -- (-1512.399) [-1483.117] (-1488.488) (-1479.880) * (-1472.710) (-1502.242) [-1478.216] (-1475.754) -- 0:00:52
806500 -- (-1494.998) (-1486.766) [-1476.774] (-1486.759) * (-1481.176) (-1501.408) [-1483.310] (-1477.443) -- 0:00:52
807000 -- (-1481.842) (-1486.141) (-1481.272) [-1473.194] * (-1477.210) (-1501.831) [-1486.384] (-1490.291) -- 0:00:52
807500 -- [-1471.681] (-1481.198) (-1487.297) (-1481.572) * (-1493.105) (-1489.646) [-1482.996] (-1470.522) -- 0:00:52
808000 -- [-1474.711] (-1474.937) (-1491.086) (-1488.612) * (-1486.717) (-1483.575) (-1493.119) [-1470.061] -- 0:00:52
808500 -- (-1492.253) [-1484.730] (-1475.250) (-1504.338) * [-1481.324] (-1480.591) (-1485.286) (-1495.246) -- 0:00:51
809000 -- [-1483.884] (-1476.487) (-1484.816) (-1490.233) * (-1477.410) [-1488.244] (-1476.775) (-1500.901) -- 0:00:51
809500 -- (-1483.417) (-1491.114) (-1477.669) [-1473.118] * (-1481.128) [-1475.096] (-1490.362) (-1480.076) -- 0:00:51
810000 -- [-1470.477] (-1511.153) (-1487.644) (-1475.925) * (-1477.531) [-1476.459] (-1487.152) (-1482.849) -- 0:00:51
Average standard deviation of split frequencies: 0.010522
810500 -- [-1475.290] (-1497.732) (-1488.629) (-1474.923) * (-1502.242) (-1482.910) (-1484.389) [-1476.058] -- 0:00:51
811000 -- (-1486.701) (-1489.338) (-1490.612) [-1486.303] * (-1489.850) (-1485.023) (-1495.046) [-1482.302] -- 0:00:51
811500 -- [-1473.959] (-1475.364) (-1485.284) (-1478.110) * (-1490.869) [-1481.878] (-1476.532) (-1480.368) -- 0:00:51
812000 -- (-1479.030) [-1477.468] (-1483.899) (-1478.571) * (-1482.079) (-1473.281) (-1497.019) [-1485.964] -- 0:00:50
812500 -- [-1483.608] (-1482.614) (-1491.079) (-1493.263) * (-1496.173) (-1476.348) (-1497.007) [-1478.270] -- 0:00:50
813000 -- (-1484.816) [-1480.377] (-1494.578) (-1478.111) * (-1484.021) [-1477.771] (-1488.420) (-1479.358) -- 0:00:50
813500 -- (-1493.043) [-1493.103] (-1483.339) (-1476.309) * (-1492.598) (-1479.923) (-1485.241) [-1473.502] -- 0:00:50
814000 -- [-1480.161] (-1480.458) (-1496.641) (-1484.640) * [-1480.962] (-1489.519) (-1472.568) (-1479.504) -- 0:00:50
814500 -- [-1472.290] (-1485.609) (-1484.366) (-1492.098) * [-1470.009] (-1483.806) (-1494.233) (-1472.977) -- 0:00:50
815000 -- (-1476.038) (-1496.852) (-1476.808) [-1475.673] * (-1484.908) (-1484.542) (-1485.048) [-1482.937] -- 0:00:50
Average standard deviation of split frequencies: 0.010866
815500 -- (-1483.739) (-1484.099) [-1481.298] (-1489.348) * [-1474.939] (-1482.743) (-1486.571) (-1502.325) -- 0:00:49
816000 -- (-1476.618) (-1486.643) (-1490.441) [-1482.588] * (-1476.983) [-1500.424] (-1482.927) (-1485.922) -- 0:00:49
816500 -- [-1474.087] (-1490.077) (-1486.867) (-1480.329) * (-1487.814) (-1483.944) [-1478.067] (-1482.141) -- 0:00:49
817000 -- [-1470.144] (-1487.084) (-1495.150) (-1493.656) * [-1479.680] (-1481.386) (-1499.574) (-1472.675) -- 0:00:49
817500 -- (-1496.359) (-1481.026) (-1481.599) [-1477.606] * [-1493.443] (-1500.038) (-1495.926) (-1488.538) -- 0:00:49
818000 -- (-1482.884) (-1486.758) (-1482.965) [-1475.990] * (-1493.142) (-1478.907) (-1480.735) [-1477.447] -- 0:00:49
818500 -- (-1476.685) (-1482.428) (-1485.195) [-1473.679] * (-1486.333) [-1475.049] (-1477.309) (-1485.881) -- 0:00:49
819000 -- (-1483.839) [-1476.760] (-1480.933) (-1480.035) * (-1480.796) (-1480.649) (-1496.636) [-1485.395] -- 0:00:49
819500 -- (-1486.217) [-1486.001] (-1491.784) (-1484.814) * (-1486.800) [-1466.741] (-1483.425) (-1476.227) -- 0:00:48
820000 -- (-1484.257) [-1473.647] (-1488.307) (-1482.213) * (-1485.754) [-1479.662] (-1487.732) (-1494.939) -- 0:00:48
Average standard deviation of split frequencies: 0.010832
820500 -- (-1487.071) (-1487.936) [-1478.907] (-1484.625) * (-1484.035) (-1476.867) [-1484.268] (-1497.358) -- 0:00:48
821000 -- (-1493.239) (-1483.861) [-1490.060] (-1494.263) * [-1469.212] (-1486.470) (-1487.766) (-1488.507) -- 0:00:48
821500 -- (-1494.647) [-1474.568] (-1488.104) (-1483.111) * (-1485.365) [-1487.193] (-1493.267) (-1479.254) -- 0:00:48
822000 -- (-1487.608) (-1477.621) (-1478.911) [-1479.642] * (-1486.490) (-1474.644) (-1481.588) [-1470.330] -- 0:00:48
822500 -- [-1484.508] (-1478.840) (-1477.037) (-1479.064) * (-1478.979) (-1482.124) (-1479.418) [-1494.410] -- 0:00:48
823000 -- (-1496.734) (-1483.957) (-1493.270) [-1477.119] * (-1482.099) (-1482.572) [-1471.962] (-1493.926) -- 0:00:47
823500 -- (-1488.943) (-1476.137) (-1480.037) [-1473.457] * (-1474.021) (-1478.949) [-1470.526] (-1478.287) -- 0:00:47
824000 -- (-1491.706) [-1472.436] (-1483.574) (-1487.802) * (-1478.556) (-1474.588) [-1479.322] (-1478.393) -- 0:00:47
824500 -- (-1490.617) [-1474.462] (-1478.165) (-1489.463) * (-1477.230) (-1490.556) [-1476.712] (-1493.416) -- 0:00:47
825000 -- (-1497.129) [-1494.136] (-1490.554) (-1508.743) * [-1480.382] (-1482.688) (-1483.570) (-1494.580) -- 0:00:47
Average standard deviation of split frequencies: 0.010572
825500 -- (-1490.689) (-1487.115) [-1476.654] (-1497.606) * [-1488.490] (-1491.712) (-1491.941) (-1492.754) -- 0:00:47
826000 -- (-1488.166) [-1484.253] (-1480.585) (-1487.939) * (-1492.923) (-1496.844) (-1478.274) [-1479.805] -- 0:00:47
826500 -- (-1497.721) [-1481.013] (-1486.273) (-1481.035) * (-1475.635) [-1490.073] (-1492.015) (-1492.886) -- 0:00:47
827000 -- [-1481.662] (-1476.150) (-1508.899) (-1475.301) * [-1480.533] (-1498.401) (-1475.805) (-1475.499) -- 0:00:46
827500 -- (-1479.339) (-1488.833) [-1482.960] (-1488.830) * [-1480.448] (-1496.245) (-1493.923) (-1474.321) -- 0:00:46
828000 -- (-1476.162) [-1478.820] (-1529.476) (-1483.506) * (-1479.644) (-1486.674) (-1483.476) [-1475.499] -- 0:00:46
828500 -- [-1478.425] (-1485.705) (-1517.632) (-1481.096) * (-1478.899) (-1489.929) [-1475.780] (-1480.782) -- 0:00:46
829000 -- (-1488.318) [-1484.197] (-1498.565) (-1487.181) * (-1480.372) (-1474.987) [-1479.838] (-1481.808) -- 0:00:46
829500 -- (-1487.177) (-1491.744) [-1489.784] (-1490.168) * (-1484.354) (-1489.864) (-1479.744) [-1479.752] -- 0:00:46
830000 -- (-1489.939) (-1493.407) (-1481.077) [-1482.590] * (-1476.929) (-1487.989) (-1483.408) [-1483.267] -- 0:00:46
Average standard deviation of split frequencies: 0.010404
830500 -- (-1483.738) (-1478.197) (-1485.378) [-1479.065] * (-1498.180) (-1488.430) (-1479.201) [-1481.860] -- 0:00:45
831000 -- (-1482.019) [-1477.412] (-1500.142) (-1494.591) * (-1497.699) (-1476.504) [-1485.299] (-1490.772) -- 0:00:45
831500 -- [-1480.723] (-1477.963) (-1488.610) (-1494.477) * (-1479.398) (-1490.087) (-1484.329) [-1472.105] -- 0:00:45
832000 -- (-1495.642) (-1478.847) (-1494.334) [-1475.741] * (-1496.884) [-1475.123] (-1478.789) (-1485.636) -- 0:00:45
832500 -- [-1480.605] (-1481.980) (-1496.871) (-1486.186) * (-1483.867) (-1493.065) [-1486.349] (-1480.499) -- 0:00:45
833000 -- (-1467.838) [-1488.612] (-1491.078) (-1483.298) * (-1481.604) (-1475.259) [-1482.011] (-1483.256) -- 0:00:45
833500 -- [-1464.567] (-1483.510) (-1488.074) (-1476.448) * [-1482.345] (-1482.970) (-1491.873) (-1482.456) -- 0:00:45
834000 -- [-1477.607] (-1491.312) (-1491.329) (-1487.432) * (-1496.569) (-1479.447) [-1494.657] (-1479.172) -- 0:00:44
834500 -- (-1483.939) [-1483.502] (-1471.326) (-1490.336) * [-1483.911] (-1493.699) (-1491.532) (-1484.610) -- 0:00:45
835000 -- (-1487.416) [-1491.616] (-1490.000) (-1473.897) * (-1492.874) (-1476.970) (-1480.312) [-1485.421] -- 0:00:44
Average standard deviation of split frequencies: 0.010016
835500 -- (-1477.385) [-1479.353] (-1475.955) (-1481.175) * (-1482.959) [-1479.276] (-1477.959) (-1480.361) -- 0:00:44
836000 -- [-1488.498] (-1487.148) (-1484.653) (-1474.566) * (-1476.244) [-1483.687] (-1491.115) (-1482.624) -- 0:00:44
836500 -- [-1478.438] (-1491.567) (-1482.145) (-1478.648) * (-1488.811) [-1483.469] (-1480.610) (-1486.781) -- 0:00:44
837000 -- (-1491.498) (-1483.262) (-1495.425) [-1476.635] * (-1486.783) (-1480.777) [-1479.967] (-1472.194) -- 0:00:44
837500 -- (-1478.370) [-1483.440] (-1479.304) (-1504.171) * (-1493.118) (-1482.242) [-1481.130] (-1478.274) -- 0:00:44
838000 -- (-1485.222) [-1478.517] (-1485.510) (-1486.343) * (-1487.437) (-1498.369) [-1472.928] (-1474.138) -- 0:00:44
838500 -- (-1489.408) [-1477.482] (-1480.058) (-1472.191) * (-1486.622) [-1488.242] (-1474.498) (-1481.814) -- 0:00:43
839000 -- (-1493.209) (-1486.349) [-1479.013] (-1488.052) * [-1484.561] (-1482.057) (-1477.532) (-1478.339) -- 0:00:43
839500 -- [-1479.659] (-1483.231) (-1492.449) (-1506.206) * (-1476.202) [-1475.739] (-1483.194) (-1472.721) -- 0:00:43
840000 -- [-1476.548] (-1484.787) (-1486.983) (-1491.972) * [-1476.495] (-1471.413) (-1486.499) (-1479.541) -- 0:00:43
Average standard deviation of split frequencies: 0.010414
840500 -- (-1484.614) (-1491.341) [-1479.837] (-1483.076) * (-1479.688) [-1485.517] (-1480.651) (-1479.386) -- 0:00:43
841000 -- (-1483.832) (-1491.286) (-1488.183) [-1480.314] * (-1485.994) (-1489.445) [-1491.594] (-1485.520) -- 0:00:43
841500 -- (-1483.282) [-1473.855] (-1479.994) (-1489.235) * [-1474.401] (-1478.212) (-1476.923) (-1484.361) -- 0:00:42
842000 -- (-1482.189) (-1480.883) (-1477.624) [-1472.499] * (-1480.121) (-1486.096) [-1490.672] (-1488.282) -- 0:00:42
842500 -- [-1484.568] (-1497.393) (-1492.365) (-1483.738) * (-1475.750) (-1481.887) [-1478.354] (-1490.842) -- 0:00:42
843000 -- (-1491.416) (-1495.307) [-1475.697] (-1503.462) * (-1478.050) [-1479.262] (-1484.496) (-1480.691) -- 0:00:42
843500 -- (-1498.385) (-1489.787) (-1492.625) [-1481.313] * (-1480.063) (-1498.676) (-1477.512) [-1472.875] -- 0:00:42
844000 -- (-1494.100) (-1500.718) (-1495.376) [-1484.952] * (-1489.445) (-1497.699) (-1475.932) [-1480.336] -- 0:00:42
844500 -- (-1501.226) (-1491.901) [-1479.855] (-1481.877) * (-1478.136) [-1484.314] (-1477.123) (-1481.651) -- 0:00:42
845000 -- (-1481.295) (-1498.262) (-1478.083) [-1478.553] * (-1478.895) (-1485.985) [-1482.163] (-1482.159) -- 0:00:42
Average standard deviation of split frequencies: 0.010216
845500 -- (-1487.828) (-1473.135) (-1494.819) [-1476.567] * [-1471.467] (-1484.397) (-1481.615) (-1489.792) -- 0:00:42
846000 -- (-1481.000) (-1495.001) (-1482.794) [-1479.339] * [-1484.723] (-1501.052) (-1482.233) (-1493.473) -- 0:00:41
846500 -- [-1480.549] (-1486.687) (-1473.034) (-1488.355) * [-1484.490] (-1480.532) (-1486.268) (-1482.355) -- 0:00:41
847000 -- (-1497.769) (-1489.609) (-1483.237) [-1477.670] * (-1490.025) (-1493.760) (-1482.461) [-1484.830] -- 0:00:41
847500 -- (-1501.651) (-1483.249) (-1484.838) [-1487.637] * (-1480.706) (-1480.464) (-1489.419) [-1477.428] -- 0:00:41
848000 -- (-1480.590) (-1496.644) (-1484.013) [-1483.426] * [-1476.235] (-1496.453) (-1484.287) (-1481.636) -- 0:00:41
848500 -- [-1476.901] (-1490.878) (-1482.493) (-1476.966) * [-1475.613] (-1475.237) (-1506.958) (-1479.528) -- 0:00:41
849000 -- [-1485.708] (-1488.357) (-1481.039) (-1478.523) * (-1490.867) (-1482.044) [-1471.868] (-1482.302) -- 0:00:40
849500 -- [-1484.135] (-1489.669) (-1487.512) (-1482.958) * (-1490.469) (-1481.967) [-1474.584] (-1477.840) -- 0:00:40
850000 -- (-1477.699) (-1494.995) (-1489.134) [-1479.648] * (-1475.914) (-1496.261) [-1484.043] (-1480.287) -- 0:00:40
Average standard deviation of split frequencies: 0.010582
850500 -- (-1478.587) (-1487.899) (-1488.436) [-1474.893] * [-1487.454] (-1496.565) (-1482.923) (-1490.757) -- 0:00:40
851000 -- (-1486.640) [-1482.318] (-1479.941) (-1490.603) * (-1478.553) (-1487.916) (-1476.512) [-1481.024] -- 0:00:40
851500 -- (-1482.848) (-1485.562) [-1475.604] (-1485.893) * (-1480.097) [-1477.881] (-1487.101) (-1483.742) -- 0:00:40
852000 -- (-1495.510) [-1483.618] (-1484.191) (-1482.098) * [-1480.258] (-1486.238) (-1473.218) (-1493.471) -- 0:00:40
852500 -- (-1484.386) (-1495.247) (-1488.938) [-1473.721] * [-1481.803] (-1485.272) (-1478.012) (-1493.070) -- 0:00:39
853000 -- (-1495.417) [-1476.500] (-1474.409) (-1483.510) * (-1478.621) (-1489.671) [-1477.036] (-1488.361) -- 0:00:39
853500 -- (-1480.381) [-1480.363] (-1489.458) (-1479.149) * [-1483.964] (-1484.501) (-1493.391) (-1488.994) -- 0:00:39
854000 -- (-1474.879) (-1490.469) [-1477.185] (-1482.500) * (-1480.691) [-1482.726] (-1489.206) (-1487.356) -- 0:00:39
854500 -- (-1489.431) (-1478.352) [-1480.922] (-1493.978) * [-1482.845] (-1474.471) (-1480.428) (-1485.575) -- 0:00:39
855000 -- (-1501.207) (-1495.276) [-1479.161] (-1486.661) * (-1483.547) [-1491.527] (-1480.534) (-1475.729) -- 0:00:39
Average standard deviation of split frequencies: 0.010883
855500 -- (-1489.867) (-1482.691) (-1480.881) [-1472.942] * (-1482.546) (-1474.230) [-1483.468] (-1483.365) -- 0:00:39
856000 -- [-1481.826] (-1491.650) (-1496.319) (-1495.579) * (-1484.437) (-1484.413) (-1482.324) [-1473.616] -- 0:00:39
856500 -- (-1479.510) (-1495.149) (-1480.613) [-1486.810] * (-1483.769) [-1479.194] (-1478.246) (-1481.333) -- 0:00:38
857000 -- [-1479.719] (-1492.234) (-1485.901) (-1479.366) * (-1494.338) (-1478.620) [-1481.972] (-1481.600) -- 0:00:38
857500 -- (-1509.062) (-1485.282) (-1493.741) [-1466.167] * (-1486.302) (-1485.736) [-1478.204] (-1478.286) -- 0:00:38
858000 -- [-1482.918] (-1487.467) (-1484.307) (-1473.333) * (-1478.131) (-1491.505) [-1478.895] (-1497.750) -- 0:00:38
858500 -- (-1475.713) [-1478.081] (-1503.121) (-1489.626) * (-1483.359) (-1475.903) [-1482.069] (-1487.110) -- 0:00:38
859000 -- (-1498.346) (-1478.141) (-1486.744) [-1476.757] * (-1483.325) (-1491.539) [-1468.182] (-1471.932) -- 0:00:38
859500 -- (-1493.695) [-1480.282] (-1493.882) (-1475.435) * (-1490.939) [-1473.199] (-1476.833) (-1484.712) -- 0:00:38
860000 -- [-1485.204] (-1480.837) (-1479.146) (-1479.043) * (-1474.493) (-1489.251) [-1473.863] (-1483.559) -- 0:00:37
Average standard deviation of split frequencies: 0.010902
860500 -- (-1497.450) (-1494.820) (-1491.847) [-1479.291] * (-1487.904) [-1480.860] (-1489.099) (-1493.454) -- 0:00:37
861000 -- [-1479.703] (-1492.876) (-1477.949) (-1479.967) * (-1487.863) (-1477.418) [-1469.259] (-1497.616) -- 0:00:37
861500 -- [-1490.934] (-1479.365) (-1482.538) (-1475.574) * [-1478.868] (-1481.553) (-1484.293) (-1485.998) -- 0:00:37
862000 -- (-1483.894) [-1476.279] (-1486.022) (-1486.272) * (-1490.467) (-1490.471) [-1476.870] (-1483.826) -- 0:00:37
862500 -- (-1486.670) (-1480.359) [-1477.496] (-1489.779) * (-1479.842) (-1485.200) [-1478.114] (-1479.223) -- 0:00:37
863000 -- (-1477.549) [-1477.108] (-1479.389) (-1488.729) * (-1481.368) (-1481.073) [-1483.004] (-1484.513) -- 0:00:37
863500 -- (-1491.820) (-1476.713) (-1485.631) [-1480.467] * (-1489.623) (-1491.093) [-1479.662] (-1486.828) -- 0:00:36
864000 -- (-1488.462) (-1480.678) [-1479.991] (-1486.557) * [-1475.050] (-1475.621) (-1483.983) (-1480.030) -- 0:00:36
864500 -- (-1489.700) (-1487.480) [-1471.888] (-1495.652) * [-1488.342] (-1484.430) (-1479.202) (-1478.287) -- 0:00:36
865000 -- [-1485.133] (-1485.713) (-1486.313) (-1480.031) * (-1486.852) (-1479.940) [-1478.022] (-1482.179) -- 0:00:36
Average standard deviation of split frequencies: 0.011094
865500 -- (-1477.982) [-1480.399] (-1485.410) (-1478.380) * (-1480.712) (-1483.876) [-1479.159] (-1488.930) -- 0:00:36
866000 -- [-1480.016] (-1497.106) (-1470.975) (-1474.523) * (-1492.896) [-1470.076] (-1495.761) (-1479.338) -- 0:00:36
866500 -- (-1496.760) (-1487.582) (-1476.894) [-1480.599] * (-1488.414) (-1481.522) (-1476.222) [-1481.945] -- 0:00:36
867000 -- [-1484.351] (-1480.963) (-1483.221) (-1478.691) * (-1498.379) [-1484.849] (-1481.055) (-1478.444) -- 0:00:36
867500 -- (-1487.249) [-1478.528] (-1493.386) (-1481.108) * (-1481.690) [-1475.949] (-1484.803) (-1476.324) -- 0:00:35
868000 -- [-1486.660] (-1480.645) (-1484.653) (-1483.834) * [-1484.913] (-1483.083) (-1485.751) (-1477.874) -- 0:00:35
868500 -- [-1474.107] (-1497.820) (-1476.582) (-1494.742) * (-1484.516) (-1497.274) [-1475.361] (-1480.653) -- 0:00:35
869000 -- (-1479.058) [-1484.499] (-1477.262) (-1492.083) * [-1476.964] (-1484.917) (-1475.253) (-1493.320) -- 0:00:35
869500 -- (-1490.354) (-1486.374) [-1486.813] (-1491.459) * (-1494.564) (-1483.371) (-1486.392) [-1491.137] -- 0:00:35
870000 -- (-1483.725) (-1478.307) (-1486.562) [-1476.569] * (-1489.896) [-1485.336] (-1483.724) (-1490.275) -- 0:00:35
Average standard deviation of split frequencies: 0.011190
870500 -- [-1474.225] (-1476.227) (-1481.773) (-1488.897) * (-1498.620) (-1486.070) (-1491.081) [-1485.497] -- 0:00:35
871000 -- [-1484.243] (-1471.969) (-1491.127) (-1497.636) * [-1482.597] (-1496.647) (-1490.297) (-1487.295) -- 0:00:34
871500 -- (-1496.822) [-1473.035] (-1491.763) (-1480.805) * (-1491.402) (-1502.349) (-1498.221) [-1484.236] -- 0:00:34
872000 -- (-1489.591) [-1474.884] (-1479.667) (-1479.851) * (-1495.261) (-1505.158) (-1480.452) [-1473.476] -- 0:00:34
872500 -- (-1474.634) [-1483.818] (-1488.518) (-1484.184) * (-1478.813) (-1497.657) (-1472.848) [-1476.503] -- 0:00:34
873000 -- (-1476.503) (-1483.394) (-1489.733) [-1482.462] * (-1483.130) (-1482.404) [-1481.825] (-1487.432) -- 0:00:34
873500 -- (-1482.002) [-1474.020] (-1489.085) (-1492.503) * (-1499.148) [-1478.009] (-1479.583) (-1485.466) -- 0:00:34
874000 -- (-1485.354) [-1468.160] (-1499.544) (-1488.396) * (-1504.332) (-1478.947) (-1481.327) [-1473.468] -- 0:00:34
874500 -- (-1477.998) (-1485.899) (-1495.947) [-1484.100] * (-1486.651) (-1477.954) (-1485.007) [-1487.076] -- 0:00:34
875000 -- (-1487.323) [-1488.159] (-1480.218) (-1489.457) * (-1497.275) (-1485.616) (-1486.839) [-1486.847] -- 0:00:33
Average standard deviation of split frequencies: 0.011198
875500 -- [-1479.379] (-1491.867) (-1491.468) (-1487.647) * (-1489.349) (-1491.476) (-1474.509) [-1474.942] -- 0:00:33
876000 -- (-1481.116) (-1487.654) (-1489.640) [-1485.565] * [-1477.171] (-1474.844) (-1476.310) (-1482.853) -- 0:00:33
876500 -- [-1475.140] (-1494.633) (-1492.097) (-1486.688) * (-1481.626) [-1488.972] (-1484.077) (-1477.870) -- 0:00:33
877000 -- (-1490.960) [-1486.592] (-1478.448) (-1485.222) * (-1475.770) (-1487.266) (-1491.996) [-1481.666] -- 0:00:33
877500 -- (-1476.989) (-1484.632) (-1490.958) [-1475.593] * (-1477.542) (-1486.704) [-1477.458] (-1484.350) -- 0:00:33
878000 -- (-1481.925) (-1488.647) (-1489.606) [-1476.971] * (-1480.045) [-1485.621] (-1489.785) (-1490.010) -- 0:00:33
878500 -- [-1482.506] (-1479.544) (-1482.537) (-1487.309) * (-1481.753) (-1488.119) (-1475.092) [-1479.751] -- 0:00:32
879000 -- (-1484.554) (-1476.537) (-1491.874) [-1475.155] * (-1491.799) (-1489.714) (-1484.232) [-1476.725] -- 0:00:32
879500 -- (-1491.451) [-1475.670] (-1488.500) (-1483.001) * [-1479.380] (-1487.116) (-1488.678) (-1484.052) -- 0:00:32
880000 -- (-1480.661) (-1493.909) [-1486.920] (-1480.625) * (-1502.395) (-1493.039) (-1475.221) [-1473.043] -- 0:00:32
Average standard deviation of split frequencies: 0.010986
880500 -- (-1489.546) [-1478.409] (-1481.307) (-1476.435) * (-1488.735) (-1490.994) [-1477.662] (-1479.823) -- 0:00:32
881000 -- (-1485.628) [-1484.251] (-1477.985) (-1480.468) * (-1489.001) (-1494.704) [-1479.506] (-1477.387) -- 0:00:32
881500 -- (-1486.547) [-1480.602] (-1495.975) (-1494.915) * (-1484.228) (-1478.217) [-1475.464] (-1479.396) -- 0:00:32
882000 -- (-1496.751) [-1471.107] (-1484.493) (-1490.959) * (-1486.765) (-1477.186) (-1490.163) [-1472.855] -- 0:00:31
882500 -- (-1485.900) [-1473.579] (-1487.095) (-1480.496) * (-1485.897) (-1493.939) (-1478.016) [-1480.959] -- 0:00:31
883000 -- (-1500.118) [-1476.087] (-1495.053) (-1486.620) * (-1493.726) (-1488.490) [-1480.244] (-1484.811) -- 0:00:31
883500 -- (-1487.169) [-1477.486] (-1486.726) (-1475.713) * (-1480.797) (-1482.498) (-1469.600) [-1477.144] -- 0:00:31
884000 -- (-1492.183) (-1474.816) (-1495.944) [-1481.349] * [-1479.002] (-1477.631) (-1479.423) (-1478.959) -- 0:00:31
884500 -- (-1499.911) (-1499.532) [-1485.152] (-1482.464) * (-1473.941) [-1474.599] (-1486.840) (-1480.984) -- 0:00:31
885000 -- (-1489.020) (-1484.596) [-1473.784] (-1485.465) * (-1477.669) [-1481.906] (-1476.626) (-1482.124) -- 0:00:31
Average standard deviation of split frequencies: 0.010793
885500 -- (-1476.299) (-1480.524) (-1482.725) [-1488.190] * [-1480.409] (-1479.125) (-1485.183) (-1488.766) -- 0:00:31
886000 -- [-1476.652] (-1483.837) (-1470.524) (-1484.378) * [-1482.977] (-1475.491) (-1483.583) (-1492.436) -- 0:00:30
886500 -- (-1490.672) (-1487.458) [-1470.769] (-1488.028) * (-1479.066) [-1481.713] (-1487.756) (-1489.351) -- 0:00:30
887000 -- [-1482.278] (-1502.628) (-1474.953) (-1489.497) * [-1480.605] (-1489.625) (-1485.853) (-1488.138) -- 0:00:30
887500 -- (-1477.416) [-1479.184] (-1489.682) (-1479.604) * (-1478.095) (-1487.907) [-1476.077] (-1487.752) -- 0:00:30
888000 -- (-1499.876) (-1482.620) (-1498.196) [-1481.083] * (-1495.776) (-1474.137) [-1481.122] (-1486.466) -- 0:00:30
888500 -- (-1512.500) (-1480.036) [-1488.593] (-1482.500) * (-1491.368) (-1467.062) [-1476.106] (-1485.980) -- 0:00:30
889000 -- (-1495.856) [-1478.546] (-1492.330) (-1474.269) * [-1483.835] (-1480.481) (-1489.193) (-1494.497) -- 0:00:30
889500 -- (-1486.840) [-1468.353] (-1487.183) (-1486.070) * (-1472.744) (-1476.169) [-1475.570] (-1492.908) -- 0:00:29
890000 -- (-1498.492) (-1494.294) [-1487.528] (-1480.573) * [-1480.043] (-1477.484) (-1477.971) (-1497.388) -- 0:00:29
Average standard deviation of split frequencies: 0.011014
890500 -- (-1489.403) (-1483.905) (-1486.833) [-1472.999] * [-1484.329] (-1486.314) (-1496.895) (-1492.254) -- 0:00:29
891000 -- [-1475.542] (-1476.034) (-1483.297) (-1480.674) * [-1476.356] (-1491.380) (-1496.756) (-1478.565) -- 0:00:29
891500 -- (-1486.071) (-1473.801) [-1480.197] (-1489.293) * (-1489.955) (-1508.705) [-1482.635] (-1487.226) -- 0:00:29
892000 -- (-1474.960) (-1490.296) [-1482.477] (-1484.056) * (-1487.164) (-1492.747) [-1480.028] (-1474.942) -- 0:00:29
892500 -- (-1477.154) (-1486.959) [-1489.612] (-1483.754) * (-1478.667) (-1473.506) (-1494.373) [-1473.361] -- 0:00:29
893000 -- [-1481.266] (-1483.868) (-1482.775) (-1474.773) * (-1486.466) (-1475.383) [-1473.056] (-1481.782) -- 0:00:28
893500 -- (-1481.934) (-1490.484) (-1488.915) [-1482.221] * [-1491.959] (-1490.815) (-1476.325) (-1489.930) -- 0:00:28
894000 -- (-1474.958) (-1478.243) [-1483.550] (-1483.026) * (-1500.411) (-1489.540) (-1499.900) [-1478.184] -- 0:00:28
894500 -- (-1489.089) (-1477.410) (-1490.545) [-1476.628] * (-1475.167) (-1496.566) [-1483.594] (-1483.524) -- 0:00:28
895000 -- (-1497.147) (-1488.593) (-1488.013) [-1477.203] * (-1481.582) (-1485.478) [-1486.769] (-1478.504) -- 0:00:28
Average standard deviation of split frequencies: 0.010447
895500 -- (-1482.324) (-1492.667) [-1481.251] (-1483.633) * (-1489.641) [-1473.853] (-1486.789) (-1483.358) -- 0:00:28
896000 -- (-1493.100) (-1482.300) (-1484.868) [-1483.104] * (-1492.262) [-1480.081] (-1479.296) (-1477.319) -- 0:00:28
896500 -- (-1487.766) (-1486.081) [-1473.867] (-1499.924) * (-1499.046) (-1490.826) (-1481.124) [-1476.312] -- 0:00:28
897000 -- (-1488.451) [-1480.228] (-1481.131) (-1476.012) * (-1487.369) (-1492.215) (-1486.095) [-1473.632] -- 0:00:27
897500 -- [-1480.252] (-1486.494) (-1479.326) (-1487.441) * (-1484.325) (-1482.168) [-1474.108] (-1490.250) -- 0:00:27
898000 -- (-1499.469) (-1486.965) [-1476.821] (-1494.193) * (-1490.669) [-1474.287] (-1471.745) (-1481.147) -- 0:00:27
898500 -- (-1488.419) (-1491.431) (-1479.784) [-1477.948] * (-1492.989) (-1495.418) (-1471.563) [-1480.514] -- 0:00:27
899000 -- (-1490.227) (-1484.301) [-1475.939] (-1479.860) * (-1479.059) (-1487.114) (-1481.383) [-1480.609] -- 0:00:27
899500 -- [-1469.380] (-1488.207) (-1475.909) (-1487.576) * [-1494.025] (-1477.895) (-1481.179) (-1476.826) -- 0:00:27
900000 -- (-1479.790) [-1476.426] (-1488.333) (-1492.855) * [-1473.581] (-1479.558) (-1479.632) (-1483.124) -- 0:00:27
Average standard deviation of split frequencies: 0.010119
900500 -- (-1487.564) (-1483.826) [-1485.547] (-1489.627) * (-1481.901) (-1483.187) (-1506.093) [-1480.450] -- 0:00:26
901000 -- (-1491.449) (-1479.419) [-1483.242] (-1473.276) * (-1479.934) [-1477.283] (-1498.281) (-1488.149) -- 0:00:26
901500 -- (-1497.134) (-1488.823) (-1487.547) [-1475.064] * (-1482.078) (-1500.242) (-1499.599) [-1486.627] -- 0:00:26
902000 -- (-1486.628) (-1478.413) (-1491.711) [-1479.361] * (-1491.229) (-1472.644) (-1475.394) [-1477.306] -- 0:00:26
902500 -- (-1489.144) (-1481.349) (-1480.867) [-1483.386] * (-1478.444) (-1479.442) [-1483.027] (-1496.310) -- 0:00:26
903000 -- (-1476.906) [-1483.321] (-1478.512) (-1477.394) * [-1480.343] (-1484.663) (-1474.011) (-1489.856) -- 0:00:26
903500 -- [-1473.844] (-1488.124) (-1477.491) (-1486.561) * (-1487.177) (-1481.415) (-1497.036) [-1475.263] -- 0:00:26
904000 -- (-1480.516) [-1482.413] (-1486.809) (-1473.898) * (-1497.067) (-1470.597) (-1486.525) [-1475.347] -- 0:00:26
904500 -- (-1486.491) (-1483.680) [-1480.433] (-1473.904) * (-1483.886) [-1475.482] (-1485.069) (-1496.594) -- 0:00:25
905000 -- (-1487.685) (-1484.321) [-1482.694] (-1476.892) * (-1479.912) (-1479.332) (-1489.626) [-1480.860] -- 0:00:25
Average standard deviation of split frequencies: 0.010307
905500 -- (-1486.787) (-1482.141) (-1487.865) [-1475.543] * (-1475.923) (-1484.762) (-1493.057) [-1480.056] -- 0:00:25
906000 -- [-1477.480] (-1482.688) (-1471.869) (-1475.617) * (-1484.412) (-1499.871) [-1480.326] (-1479.759) -- 0:00:25
906500 -- (-1484.292) (-1479.796) [-1481.789] (-1486.052) * (-1467.432) [-1487.885] (-1487.889) (-1480.543) -- 0:00:25
907000 -- (-1476.415) (-1488.839) (-1484.820) [-1478.209] * (-1481.770) (-1488.715) [-1481.238] (-1479.037) -- 0:00:25
907500 -- (-1476.040) (-1482.705) [-1494.247] (-1488.959) * (-1487.881) [-1490.715] (-1480.788) (-1487.946) -- 0:00:25
908000 -- [-1471.068] (-1490.128) (-1489.930) (-1482.151) * (-1490.550) [-1488.892] (-1495.404) (-1489.698) -- 0:00:24
908500 -- (-1491.004) (-1482.372) (-1481.440) [-1478.317] * (-1468.623) (-1505.018) (-1482.418) [-1476.430] -- 0:00:24
909000 -- (-1489.851) [-1476.897] (-1480.218) (-1479.826) * (-1485.220) (-1485.492) (-1483.326) [-1482.620] -- 0:00:24
909500 -- [-1477.670] (-1491.292) (-1500.933) (-1481.720) * [-1480.249] (-1491.887) (-1481.494) (-1481.085) -- 0:00:24
910000 -- [-1475.194] (-1482.782) (-1485.337) (-1476.580) * (-1486.693) (-1486.999) [-1480.307] (-1492.970) -- 0:00:24
Average standard deviation of split frequencies: 0.010254
910500 -- [-1479.801] (-1480.496) (-1484.399) (-1483.477) * [-1480.218] (-1481.256) (-1479.949) (-1490.319) -- 0:00:24
911000 -- (-1476.948) (-1485.768) (-1492.950) [-1475.093] * (-1487.614) [-1476.370] (-1477.461) (-1485.797) -- 0:00:24
911500 -- (-1501.719) [-1470.285] (-1505.563) (-1489.376) * (-1490.997) (-1484.282) (-1485.464) [-1484.534] -- 0:00:23
912000 -- (-1475.169) [-1481.123] (-1515.666) (-1497.193) * (-1481.316) (-1490.915) [-1489.283] (-1478.306) -- 0:00:23
912500 -- (-1480.633) (-1488.854) [-1481.422] (-1500.839) * [-1472.100] (-1494.927) (-1474.327) (-1489.673) -- 0:00:23
913000 -- (-1475.525) [-1475.302] (-1488.180) (-1488.372) * (-1478.663) (-1480.384) (-1483.326) [-1475.694] -- 0:00:23
913500 -- (-1479.651) [-1478.148] (-1501.173) (-1474.538) * (-1478.280) [-1483.289] (-1498.761) (-1478.082) -- 0:00:23
914000 -- (-1486.892) (-1477.971) (-1487.721) [-1474.526] * (-1474.773) (-1489.957) (-1487.833) [-1489.611] -- 0:00:23
914500 -- (-1469.864) (-1491.424) (-1487.323) [-1472.842] * (-1483.101) (-1486.091) (-1479.572) [-1481.293] -- 0:00:23
915000 -- [-1475.071] (-1483.753) (-1486.637) (-1490.545) * (-1480.796) [-1487.920] (-1478.667) (-1486.497) -- 0:00:23
Average standard deviation of split frequencies: 0.010097
915500 -- (-1479.001) (-1502.120) (-1486.234) [-1469.620] * (-1479.248) (-1485.283) [-1480.133] (-1494.790) -- 0:00:22
916000 -- [-1481.284] (-1480.753) (-1492.645) (-1486.363) * (-1484.473) (-1481.427) [-1480.418] (-1475.834) -- 0:00:22
916500 -- (-1483.467) [-1471.449] (-1484.166) (-1491.900) * (-1487.574) [-1470.412] (-1487.258) (-1493.217) -- 0:00:22
917000 -- (-1484.637) (-1479.125) (-1482.037) [-1479.737] * (-1485.221) [-1481.508] (-1479.070) (-1476.014) -- 0:00:22
917500 -- (-1487.995) [-1471.386] (-1487.445) (-1476.527) * [-1486.051] (-1490.679) (-1495.510) (-1483.887) -- 0:00:22
918000 -- (-1500.766) (-1487.013) [-1483.766] (-1492.713) * (-1488.071) [-1485.317] (-1499.850) (-1476.869) -- 0:00:22
918500 -- (-1485.413) (-1496.606) (-1487.372) [-1487.140] * (-1478.208) (-1495.846) (-1494.360) [-1479.526] -- 0:00:22
919000 -- (-1492.681) [-1476.241] (-1480.298) (-1493.692) * (-1480.637) (-1493.853) [-1473.262] (-1491.960) -- 0:00:21
919500 -- (-1490.417) (-1487.232) [-1481.237] (-1479.763) * (-1484.813) [-1480.925] (-1481.360) (-1482.091) -- 0:00:21
920000 -- (-1487.412) (-1489.704) (-1484.626) [-1487.924] * (-1489.999) (-1480.479) (-1497.963) [-1485.667] -- 0:00:21
Average standard deviation of split frequencies: 0.010021
920500 -- (-1494.497) (-1489.117) [-1478.900] (-1472.874) * (-1490.646) [-1470.159] (-1499.029) (-1487.978) -- 0:00:21
921000 -- [-1476.445] (-1503.458) (-1487.526) (-1479.674) * [-1482.938] (-1475.983) (-1512.585) (-1498.468) -- 0:00:21
921500 -- (-1479.485) (-1492.522) (-1486.365) [-1479.383] * (-1489.377) (-1480.023) (-1491.046) [-1477.485] -- 0:00:21
922000 -- (-1483.811) (-1475.484) (-1492.622) [-1477.547] * (-1483.124) [-1484.329] (-1482.958) (-1472.136) -- 0:00:21
922500 -- (-1490.951) (-1494.039) (-1481.055) [-1486.362] * [-1477.191] (-1498.387) (-1479.365) (-1486.567) -- 0:00:21
923000 -- (-1474.462) (-1490.589) (-1495.516) [-1476.264] * (-1474.724) [-1474.558] (-1479.158) (-1501.220) -- 0:00:20
923500 -- (-1475.874) (-1492.267) [-1483.253] (-1474.364) * (-1497.441) [-1481.228] (-1484.639) (-1483.536) -- 0:00:20
924000 -- (-1487.092) (-1484.892) (-1479.182) [-1474.284] * (-1486.545) [-1478.096] (-1473.263) (-1491.043) -- 0:00:20
924500 -- (-1486.765) (-1484.275) (-1479.687) [-1473.767] * (-1477.778) [-1483.227] (-1490.690) (-1481.167) -- 0:00:20
925000 -- (-1473.099) (-1487.439) (-1484.808) [-1489.703] * (-1479.916) (-1489.188) [-1474.785] (-1490.290) -- 0:00:20
Average standard deviation of split frequencies: 0.009745
925500 -- (-1482.053) [-1482.058] (-1473.737) (-1486.156) * (-1478.742) (-1505.473) [-1469.218] (-1479.323) -- 0:00:20
926000 -- (-1488.019) [-1480.103] (-1486.003) (-1474.729) * (-1502.452) (-1481.052) (-1483.548) [-1492.320] -- 0:00:20
926500 -- (-1485.031) (-1479.554) (-1483.613) [-1473.231] * (-1488.257) (-1484.130) [-1483.092] (-1488.976) -- 0:00:19
927000 -- (-1472.431) [-1484.904] (-1479.416) (-1487.325) * (-1476.736) (-1482.740) (-1482.226) [-1481.641] -- 0:00:19
927500 -- (-1491.203) (-1490.606) (-1477.685) [-1480.177] * (-1491.983) (-1475.875) (-1484.679) [-1489.113] -- 0:00:19
928000 -- (-1484.075) [-1475.727] (-1474.549) (-1487.928) * [-1479.540] (-1484.620) (-1488.903) (-1498.644) -- 0:00:19
928500 -- (-1476.084) [-1477.006] (-1487.333) (-1482.971) * [-1486.102] (-1483.863) (-1485.333) (-1488.509) -- 0:00:19
929000 -- (-1493.485) [-1479.633] (-1490.633) (-1479.249) * [-1474.756] (-1483.663) (-1474.622) (-1499.805) -- 0:00:19
929500 -- [-1487.809] (-1481.106) (-1497.039) (-1492.310) * (-1484.336) (-1492.548) (-1491.047) [-1477.253] -- 0:00:19
930000 -- (-1488.269) [-1474.658] (-1488.656) (-1480.956) * (-1491.819) (-1478.393) (-1485.306) [-1477.342] -- 0:00:18
Average standard deviation of split frequencies: 0.009841
930500 -- (-1479.479) (-1485.456) (-1482.394) [-1472.369] * (-1485.539) [-1476.373] (-1480.252) (-1474.388) -- 0:00:18
931000 -- (-1501.564) (-1486.004) [-1470.441] (-1483.178) * (-1486.005) [-1480.975] (-1495.839) (-1486.692) -- 0:00:18
931500 -- (-1497.382) [-1475.758] (-1489.464) (-1475.908) * [-1483.731] (-1479.986) (-1485.443) (-1480.767) -- 0:00:18
932000 -- (-1492.093) [-1476.609] (-1478.057) (-1494.744) * [-1476.307] (-1484.959) (-1494.250) (-1484.102) -- 0:00:18
932500 -- (-1491.219) (-1476.478) (-1484.138) [-1489.440] * [-1476.274] (-1481.893) (-1490.582) (-1479.308) -- 0:00:18
933000 -- [-1479.421] (-1485.544) (-1479.204) (-1487.123) * (-1497.736) (-1478.814) (-1492.710) [-1479.564] -- 0:00:18
933500 -- (-1481.534) (-1487.804) [-1479.294] (-1484.592) * (-1485.200) (-1483.916) [-1479.442] (-1476.944) -- 0:00:18
934000 -- [-1478.774] (-1493.149) (-1481.174) (-1484.480) * (-1476.271) [-1479.738] (-1484.023) (-1486.919) -- 0:00:17
934500 -- [-1485.821] (-1499.975) (-1483.870) (-1480.987) * (-1478.961) (-1487.459) [-1483.337] (-1484.839) -- 0:00:17
935000 -- [-1480.282] (-1472.589) (-1480.772) (-1480.063) * [-1475.776] (-1485.573) (-1486.423) (-1480.867) -- 0:00:17
Average standard deviation of split frequencies: 0.009377
935500 -- (-1481.797) (-1479.340) (-1487.459) [-1484.372] * (-1478.013) (-1481.133) (-1480.171) [-1487.583] -- 0:00:17
936000 -- (-1487.543) [-1479.903] (-1485.984) (-1474.068) * (-1488.672) (-1475.128) (-1495.987) [-1482.736] -- 0:00:17
936500 -- (-1503.843) (-1470.755) (-1475.906) [-1480.458] * [-1481.537] (-1482.600) (-1486.846) (-1481.743) -- 0:00:17
937000 -- (-1495.631) [-1479.321] (-1495.054) (-1489.991) * (-1473.239) [-1479.797] (-1495.252) (-1484.148) -- 0:00:17
937500 -- (-1483.008) (-1502.946) [-1483.087] (-1482.136) * [-1474.019] (-1484.208) (-1483.428) (-1494.691) -- 0:00:16
938000 -- [-1472.401] (-1482.023) (-1486.390) (-1476.691) * [-1477.954] (-1493.672) (-1473.747) (-1485.616) -- 0:00:16
938500 -- (-1478.982) (-1495.103) [-1474.787] (-1490.866) * (-1475.974) (-1489.161) [-1478.024] (-1511.323) -- 0:00:16
939000 -- (-1476.633) (-1490.210) [-1477.060] (-1482.528) * (-1473.695) (-1484.432) [-1479.228] (-1496.456) -- 0:00:16
939500 -- (-1485.887) (-1479.063) [-1480.525] (-1497.446) * (-1480.553) [-1473.549] (-1492.761) (-1503.625) -- 0:00:16
940000 -- (-1481.370) [-1472.223] (-1491.010) (-1489.114) * (-1480.824) [-1475.692] (-1488.213) (-1493.983) -- 0:00:16
Average standard deviation of split frequencies: 0.009331
940500 -- [-1482.456] (-1480.249) (-1483.533) (-1477.530) * (-1478.115) [-1475.699] (-1501.008) (-1491.858) -- 0:00:16
941000 -- [-1475.052] (-1480.894) (-1490.911) (-1476.162) * (-1488.301) [-1469.018] (-1487.155) (-1484.102) -- 0:00:15
941500 -- (-1483.717) (-1480.697) [-1477.974] (-1480.074) * (-1478.434) [-1472.737] (-1492.129) (-1497.886) -- 0:00:15
942000 -- (-1496.883) (-1493.424) [-1475.635] (-1491.437) * (-1493.168) (-1474.272) (-1473.499) [-1481.050] -- 0:00:15
942500 -- (-1492.342) (-1486.578) (-1494.311) [-1477.501] * (-1496.197) (-1483.353) (-1476.444) [-1493.235] -- 0:00:15
943000 -- (-1502.614) (-1485.838) [-1480.199] (-1474.221) * (-1476.913) (-1476.814) (-1491.522) [-1486.525] -- 0:00:15
943500 -- (-1486.580) (-1480.155) (-1483.509) [-1478.116] * (-1491.241) [-1481.289] (-1482.004) (-1477.792) -- 0:00:15
944000 -- (-1482.838) (-1485.606) [-1477.665] (-1495.645) * (-1489.148) (-1481.410) (-1484.551) [-1489.781] -- 0:00:15
944500 -- (-1483.141) (-1487.495) (-1483.069) [-1479.131] * (-1487.000) [-1474.263] (-1483.806) (-1492.331) -- 0:00:15
945000 -- (-1495.419) (-1486.346) [-1477.550] (-1479.706) * (-1478.022) [-1478.565] (-1491.279) (-1474.103) -- 0:00:14
Average standard deviation of split frequencies: 0.009159
945500 -- (-1491.053) (-1486.571) (-1485.051) [-1474.743] * (-1497.418) [-1484.302] (-1491.202) (-1484.681) -- 0:00:14
946000 -- [-1475.154] (-1486.708) (-1483.578) (-1481.691) * (-1491.839) (-1486.643) (-1487.411) [-1484.847] -- 0:00:14
946500 -- [-1480.943] (-1481.817) (-1489.571) (-1494.782) * [-1477.641] (-1495.372) (-1488.626) (-1474.176) -- 0:00:14
947000 -- (-1488.063) (-1482.111) (-1478.006) [-1476.390] * (-1495.657) [-1473.506] (-1476.955) (-1485.534) -- 0:00:14
947500 -- (-1495.100) (-1482.389) [-1473.861] (-1478.838) * (-1477.265) [-1495.233] (-1485.763) (-1472.445) -- 0:00:14
948000 -- [-1477.879] (-1479.303) (-1480.673) (-1484.198) * (-1478.288) (-1481.252) (-1480.715) [-1470.267] -- 0:00:14
948500 -- [-1483.746] (-1478.681) (-1495.216) (-1488.670) * [-1477.927] (-1482.346) (-1480.877) (-1487.341) -- 0:00:13
949000 -- (-1478.272) [-1475.724] (-1501.650) (-1503.439) * (-1497.372) (-1484.066) [-1476.544] (-1499.284) -- 0:00:13
949500 -- [-1481.523] (-1486.073) (-1489.753) (-1500.048) * [-1478.864] (-1472.198) (-1486.011) (-1483.012) -- 0:00:13
950000 -- [-1481.227] (-1484.967) (-1490.765) (-1479.957) * [-1470.526] (-1481.463) (-1493.844) (-1491.108) -- 0:00:13
Average standard deviation of split frequencies: 0.009233
950500 -- (-1482.443) [-1475.483] (-1489.136) (-1497.452) * (-1477.096) (-1488.451) (-1496.224) [-1476.613] -- 0:00:13
951000 -- (-1481.743) [-1474.431] (-1501.107) (-1498.281) * [-1472.946] (-1486.163) (-1484.311) (-1491.278) -- 0:00:13
951500 -- (-1470.784) (-1481.497) [-1481.889] (-1497.047) * (-1473.911) [-1489.700] (-1496.591) (-1488.038) -- 0:00:13
952000 -- (-1467.735) [-1473.232] (-1485.189) (-1513.057) * (-1478.797) (-1486.270) (-1483.784) [-1473.342] -- 0:00:13
952500 -- (-1477.625) [-1473.979] (-1481.555) (-1490.547) * (-1479.986) (-1498.415) [-1477.418] (-1484.613) -- 0:00:12
953000 -- [-1477.131] (-1487.534) (-1486.786) (-1498.600) * [-1479.892] (-1488.520) (-1483.606) (-1480.927) -- 0:00:12
953500 -- (-1485.955) (-1484.613) (-1478.233) [-1478.621] * (-1491.701) (-1497.944) (-1488.640) [-1483.040] -- 0:00:12
954000 -- (-1490.035) (-1477.572) [-1482.655] (-1479.771) * (-1487.954) [-1486.483] (-1482.513) (-1483.468) -- 0:00:12
954500 -- (-1478.818) (-1484.084) (-1493.854) [-1481.731] * [-1481.311] (-1486.181) (-1498.574) (-1474.770) -- 0:00:12
955000 -- (-1491.014) (-1502.278) (-1488.729) [-1475.194] * [-1483.091] (-1474.450) (-1491.669) (-1492.786) -- 0:00:12
Average standard deviation of split frequencies: 0.008923
955500 -- (-1477.770) (-1497.032) (-1483.998) [-1471.378] * (-1491.726) [-1474.867] (-1497.329) (-1480.964) -- 0:00:12
956000 -- (-1477.105) (-1496.571) [-1486.030] (-1470.529) * [-1496.906] (-1480.223) (-1486.228) (-1491.697) -- 0:00:11
956500 -- (-1480.794) (-1497.366) (-1477.402) [-1471.412] * [-1475.956] (-1502.716) (-1492.750) (-1484.183) -- 0:00:11
957000 -- [-1472.295] (-1487.355) (-1475.179) (-1485.350) * (-1468.710) [-1479.370] (-1493.464) (-1482.126) -- 0:00:11
957500 -- (-1487.157) (-1480.947) [-1472.948] (-1490.717) * (-1481.314) (-1489.465) (-1502.575) [-1479.691] -- 0:00:11
958000 -- (-1487.095) (-1490.887) (-1490.253) [-1482.454] * (-1496.229) [-1483.255] (-1482.267) (-1486.612) -- 0:00:11
958500 -- [-1480.941] (-1493.249) (-1473.956) (-1479.652) * [-1479.637] (-1483.474) (-1485.970) (-1487.361) -- 0:00:11
959000 -- (-1476.184) [-1475.753] (-1491.971) (-1478.255) * [-1478.944] (-1478.672) (-1483.651) (-1487.224) -- 0:00:11
959500 -- (-1486.503) [-1483.703] (-1492.347) (-1479.876) * [-1479.549] (-1483.077) (-1491.647) (-1474.168) -- 0:00:10
960000 -- (-1490.944) [-1483.840] (-1503.667) (-1476.986) * [-1481.394] (-1489.844) (-1488.063) (-1489.002) -- 0:00:10
Average standard deviation of split frequencies: 0.008599
960500 -- [-1481.106] (-1493.603) (-1490.666) (-1479.189) * (-1472.393) [-1477.771] (-1492.116) (-1482.823) -- 0:00:10
961000 -- (-1489.664) (-1474.435) [-1476.254] (-1483.106) * (-1490.851) (-1486.898) [-1488.996] (-1492.860) -- 0:00:10
961500 -- (-1477.366) (-1483.514) (-1468.987) [-1485.300] * [-1478.808] (-1475.404) (-1501.637) (-1487.607) -- 0:00:10
962000 -- [-1478.051] (-1496.636) (-1481.432) (-1488.509) * [-1479.441] (-1479.588) (-1484.335) (-1488.148) -- 0:00:10
962500 -- (-1479.918) (-1476.819) [-1475.242] (-1487.119) * [-1479.405] (-1479.044) (-1480.401) (-1494.406) -- 0:00:10
963000 -- (-1482.837) (-1484.196) [-1485.842] (-1501.701) * [-1479.100] (-1479.309) (-1485.514) (-1503.146) -- 0:00:10
963500 -- (-1484.292) (-1486.817) [-1477.607] (-1485.151) * (-1481.589) [-1494.857] (-1480.960) (-1495.327) -- 0:00:09
964000 -- (-1478.966) (-1491.088) (-1491.498) [-1480.071] * [-1481.409] (-1482.045) (-1489.802) (-1488.130) -- 0:00:09
964500 -- [-1475.087] (-1489.292) (-1475.753) (-1489.910) * [-1476.826] (-1489.678) (-1491.447) (-1491.621) -- 0:00:09
965000 -- [-1477.762] (-1476.720) (-1487.670) (-1495.552) * [-1474.027] (-1483.637) (-1506.957) (-1487.060) -- 0:00:09
Average standard deviation of split frequencies: 0.008552
965500 -- [-1485.009] (-1487.156) (-1487.227) (-1479.066) * (-1482.716) [-1472.529] (-1487.716) (-1480.117) -- 0:00:09
966000 -- [-1476.851] (-1496.667) (-1476.742) (-1497.902) * (-1481.011) (-1478.997) (-1480.120) [-1471.929] -- 0:00:09
966500 -- (-1481.195) (-1482.567) [-1474.911] (-1484.712) * (-1490.594) (-1482.951) [-1480.343] (-1479.399) -- 0:00:09
967000 -- (-1482.282) [-1472.317] (-1488.473) (-1479.782) * (-1496.245) (-1499.094) [-1475.626] (-1488.635) -- 0:00:08
967500 -- (-1492.356) (-1492.311) [-1472.851] (-1474.997) * (-1491.807) [-1477.165] (-1477.631) (-1495.983) -- 0:00:08
968000 -- (-1486.645) (-1491.601) (-1483.927) [-1476.605] * (-1476.300) (-1482.847) (-1485.591) [-1476.128] -- 0:00:08
968500 -- (-1484.467) [-1478.396] (-1483.099) (-1476.044) * (-1476.320) (-1486.329) (-1491.208) [-1482.989] -- 0:00:08
969000 -- (-1488.587) [-1470.122] (-1488.963) (-1475.606) * (-1490.773) (-1478.231) (-1483.311) [-1485.522] -- 0:00:08
969500 -- (-1491.886) (-1491.102) (-1488.983) [-1471.957] * [-1478.657] (-1472.641) (-1483.788) (-1483.101) -- 0:00:08
970000 -- (-1488.258) (-1496.218) (-1480.032) [-1484.731] * [-1482.774] (-1480.820) (-1493.114) (-1487.060) -- 0:00:08
Average standard deviation of split frequencies: 0.008834
970500 -- (-1495.528) (-1493.370) (-1500.279) [-1484.567] * (-1493.275) (-1486.077) (-1474.620) [-1483.285] -- 0:00:07
971000 -- (-1482.721) (-1494.109) (-1500.954) [-1475.097] * (-1485.410) (-1505.553) [-1477.615] (-1483.984) -- 0:00:07
971500 -- (-1480.696) (-1492.034) (-1492.978) [-1471.637] * (-1488.578) (-1480.143) [-1470.270] (-1487.105) -- 0:00:07
972000 -- (-1490.028) (-1489.428) [-1480.003] (-1481.733) * (-1475.568) (-1473.852) [-1480.937] (-1491.629) -- 0:00:07
972500 -- (-1471.655) (-1486.756) [-1473.973] (-1481.332) * (-1480.130) (-1485.094) (-1482.912) [-1478.579] -- 0:00:07
973000 -- (-1473.913) [-1489.527] (-1483.629) (-1491.416) * (-1483.993) (-1481.095) [-1485.525] (-1486.590) -- 0:00:07
973500 -- [-1473.108] (-1482.858) (-1478.946) (-1475.634) * (-1503.330) (-1481.673) [-1478.825] (-1478.165) -- 0:00:07
974000 -- (-1499.581) (-1480.162) [-1478.302] (-1487.244) * (-1485.204) [-1477.118] (-1477.768) (-1485.200) -- 0:00:07
974500 -- (-1483.501) [-1482.303] (-1493.812) (-1477.559) * (-1488.252) (-1480.644) (-1488.407) [-1469.005] -- 0:00:06
975000 -- (-1475.273) (-1489.915) (-1487.531) [-1483.656] * (-1488.652) [-1472.584] (-1480.233) (-1486.725) -- 0:00:06
Average standard deviation of split frequencies: 0.008763
975500 -- (-1483.015) [-1484.053] (-1478.732) (-1492.539) * (-1478.188) [-1488.339] (-1483.292) (-1480.482) -- 0:00:06
976000 -- (-1471.426) (-1493.211) (-1483.204) [-1487.821] * [-1483.908] (-1488.101) (-1486.983) (-1475.777) -- 0:00:06
976500 -- (-1489.391) (-1488.416) (-1488.243) [-1474.670] * (-1483.332) (-1487.789) (-1485.301) [-1487.014] -- 0:00:06
977000 -- (-1479.479) (-1478.420) (-1483.769) [-1480.632] * (-1491.676) [-1481.936] (-1483.761) (-1484.415) -- 0:00:06
977500 -- (-1480.504) [-1481.621] (-1503.918) (-1484.768) * (-1482.880) [-1477.555] (-1486.512) (-1482.060) -- 0:00:06
978000 -- (-1480.949) [-1473.792] (-1484.382) (-1477.064) * (-1488.722) (-1486.317) (-1476.965) [-1472.529] -- 0:00:05
978500 -- [-1478.073] (-1477.152) (-1479.964) (-1494.047) * (-1496.449) (-1490.004) [-1480.018] (-1483.711) -- 0:00:05
979000 -- (-1486.400) (-1488.462) (-1486.225) [-1469.611] * (-1487.335) (-1497.254) (-1479.953) [-1480.873] -- 0:00:05
979500 -- (-1499.852) (-1504.136) (-1489.062) [-1471.847] * (-1485.949) (-1481.083) (-1473.337) [-1486.295] -- 0:00:05
980000 -- (-1500.181) (-1501.346) (-1481.096) [-1473.354] * (-1482.328) (-1475.358) [-1476.493] (-1487.437) -- 0:00:05
Average standard deviation of split frequencies: 0.008584
980500 -- [-1486.905] (-1493.033) (-1482.119) (-1478.882) * [-1479.479] (-1476.945) (-1478.007) (-1496.128) -- 0:00:05
981000 -- (-1485.503) (-1495.460) [-1477.185] (-1470.728) * (-1491.769) [-1479.527] (-1486.251) (-1505.185) -- 0:00:05
981500 -- (-1486.208) [-1489.772] (-1482.611) (-1479.755) * (-1486.063) [-1483.923] (-1485.866) (-1497.297) -- 0:00:05
982000 -- [-1476.952] (-1487.093) (-1489.095) (-1497.232) * (-1486.553) (-1492.328) [-1477.604] (-1490.829) -- 0:00:04
982500 -- [-1473.445] (-1478.216) (-1483.145) (-1488.985) * (-1485.012) [-1477.880] (-1479.308) (-1500.458) -- 0:00:04
983000 -- [-1479.088] (-1489.996) (-1471.936) (-1479.862) * (-1481.925) [-1478.374] (-1475.814) (-1505.437) -- 0:00:04
983500 -- (-1489.317) [-1473.762] (-1482.680) (-1492.755) * (-1482.778) (-1473.310) [-1472.113] (-1487.903) -- 0:00:04
984000 -- [-1478.138] (-1495.490) (-1481.218) (-1499.533) * [-1473.106] (-1490.158) (-1483.585) (-1487.833) -- 0:00:04
984500 -- [-1493.891] (-1489.284) (-1501.523) (-1482.713) * [-1481.307] (-1485.770) (-1483.452) (-1489.077) -- 0:00:04
985000 -- (-1476.949) [-1481.762] (-1476.881) (-1477.799) * (-1485.240) (-1500.529) [-1484.827] (-1488.898) -- 0:00:04
Average standard deviation of split frequencies: 0.008629
985500 -- (-1481.362) (-1479.343) (-1480.771) [-1473.425] * [-1484.725] (-1495.643) (-1485.349) (-1493.581) -- 0:00:03
986000 -- (-1477.752) (-1506.109) (-1483.115) [-1476.855] * [-1477.692] (-1514.992) (-1478.545) (-1491.843) -- 0:00:03
986500 -- (-1483.201) (-1484.276) (-1486.967) [-1475.461] * (-1474.951) [-1485.044] (-1489.700) (-1496.505) -- 0:00:03
987000 -- (-1494.332) [-1476.540] (-1500.250) (-1493.221) * (-1486.788) (-1480.710) [-1480.611] (-1479.756) -- 0:00:03
987500 -- (-1474.675) [-1470.491] (-1486.345) (-1502.369) * (-1475.866) [-1481.769] (-1482.019) (-1488.643) -- 0:00:03
988000 -- [-1484.331] (-1489.401) (-1482.237) (-1495.288) * (-1485.622) (-1480.714) [-1472.168] (-1501.555) -- 0:00:03
988500 -- (-1484.803) [-1481.247] (-1481.700) (-1486.981) * (-1482.302) [-1474.478] (-1484.070) (-1493.600) -- 0:00:03
989000 -- (-1479.262) (-1489.585) (-1477.021) [-1480.625] * (-1474.806) (-1487.666) (-1486.036) [-1486.511] -- 0:00:02
989500 -- (-1499.350) (-1491.424) (-1475.236) [-1474.304] * (-1484.252) (-1491.373) [-1480.123] (-1488.628) -- 0:00:02
990000 -- [-1474.017] (-1481.001) (-1482.524) (-1496.884) * [-1478.858] (-1486.912) (-1480.975) (-1475.119) -- 0:00:02
Average standard deviation of split frequencies: 0.009336
990500 -- [-1483.204] (-1480.771) (-1484.702) (-1492.814) * (-1483.142) (-1488.401) (-1493.147) [-1485.977] -- 0:00:02
991000 -- [-1483.806] (-1485.947) (-1489.186) (-1487.078) * [-1471.879] (-1494.465) (-1483.344) (-1488.397) -- 0:00:02
991500 -- (-1503.631) (-1482.394) (-1479.216) [-1480.475] * (-1492.663) (-1494.376) [-1475.856] (-1476.988) -- 0:00:02
992000 -- (-1485.849) [-1481.284] (-1482.764) (-1474.572) * [-1481.875] (-1476.750) (-1475.095) (-1485.251) -- 0:00:02
992500 -- [-1469.486] (-1488.705) (-1481.202) (-1482.121) * (-1478.581) (-1488.929) (-1490.732) [-1478.405] -- 0:00:02
993000 -- [-1491.443] (-1493.305) (-1492.518) (-1472.811) * (-1486.393) (-1498.970) (-1485.643) [-1484.417] -- 0:00:01
993500 -- (-1482.458) (-1477.734) (-1484.698) [-1481.816] * [-1476.261] (-1480.947) (-1482.788) (-1479.165) -- 0:00:01
994000 -- (-1479.428) (-1488.037) (-1477.910) [-1491.762] * [-1480.053] (-1488.120) (-1503.463) (-1489.908) -- 0:00:01
994500 -- [-1481.202] (-1490.828) (-1479.000) (-1490.986) * (-1477.795) [-1479.135] (-1485.463) (-1493.195) -- 0:00:01
995000 -- (-1481.868) [-1492.578] (-1479.484) (-1480.215) * (-1466.440) [-1470.660] (-1492.922) (-1486.608) -- 0:00:01
Average standard deviation of split frequencies: 0.009015
995500 -- (-1489.365) (-1476.722) [-1473.769] (-1497.355) * [-1475.359] (-1484.012) (-1492.340) (-1494.010) -- 0:00:01
996000 -- [-1492.559] (-1478.101) (-1478.895) (-1493.239) * (-1486.159) (-1484.328) [-1476.503] (-1479.569) -- 0:00:01
996500 -- (-1482.579) [-1475.057] (-1484.801) (-1483.074) * [-1482.008] (-1480.249) (-1487.250) (-1484.318) -- 0:00:00
997000 -- (-1483.146) (-1485.477) [-1475.456] (-1478.201) * (-1474.829) [-1488.863] (-1477.652) (-1474.993) -- 0:00:00
997500 -- (-1476.316) (-1479.977) [-1472.550] (-1491.026) * [-1478.192] (-1500.878) (-1486.647) (-1486.368) -- 0:00:00
998000 -- (-1488.312) (-1479.492) [-1479.146] (-1483.709) * (-1481.252) (-1488.738) (-1487.965) [-1483.125] -- 0:00:00
998500 -- (-1491.902) (-1479.164) (-1479.747) [-1485.116] * [-1481.894] (-1486.971) (-1487.003) (-1491.873) -- 0:00:00
999000 -- [-1473.008] (-1482.991) (-1473.988) (-1487.210) * [-1471.889] (-1499.000) (-1481.382) (-1471.830) -- 0:00:00
999500 -- (-1484.018) (-1478.312) (-1481.355) [-1485.826] * [-1478.812] (-1475.775) (-1481.037) (-1497.466) -- 0:00:00
1000000 -- [-1474.731] (-1497.706) (-1476.839) (-1485.051) * (-1470.809) (-1488.243) [-1480.853] (-1492.854) -- 0:00:00
Average standard deviation of split frequencies: 0.008794
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1474.730812 -- 27.205538
Chain 1 -- -1474.730820 -- 27.205538
Chain 2 -- -1497.705602 -- 25.104690
Chain 2 -- -1497.705594 -- 25.104690
Chain 3 -- -1476.839364 -- 27.492374
Chain 3 -- -1476.839366 -- 27.492374
Chain 4 -- -1485.050891 -- 24.071044
Chain 4 -- -1485.050889 -- 24.071044
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1470.808559 -- 25.986253
Chain 1 -- -1470.808559 -- 25.986253
Chain 2 -- -1488.243160 -- 24.281931
Chain 2 -- -1488.243162 -- 24.281931
Chain 3 -- -1480.852636 -- 23.660370
Chain 3 -- -1480.852645 -- 23.660370
Chain 4 -- -1492.854177 -- 23.944687
Chain 4 -- -1492.854169 -- 23.944687
Analysis completed in 4 mins 31 seconds
Analysis used 270.93 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1461.47
Likelihood of best state for "cold" chain of run 2 was -1462.49
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
57.3 % ( 48 %) Dirichlet(Revmat{all})
72.8 % ( 60 %) Slider(Revmat{all})
27.0 % ( 32 %) Dirichlet(Pi{all})
28.6 % ( 29 %) Slider(Pi{all})
35.5 % ( 24 %) Multiplier(Alpha{1,2})
48.6 % ( 22 %) Multiplier(Alpha{3})
40.6 % ( 29 %) Slider(Pinvar{all})
34.6 % ( 38 %) ExtSPR(Tau{all},V{all})
13.2 % ( 13 %) ExtTBR(Tau{all},V{all})
44.0 % ( 47 %) NNI(Tau{all},V{all})
34.0 % ( 34 %) ParsSPR(Tau{all},V{all})
27.1 % ( 24 %) Multiplier(V{all})
55.9 % ( 59 %) Nodeslider(V{all})
26.7 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
57.4 % ( 47 %) Dirichlet(Revmat{all})
72.4 % ( 64 %) Slider(Revmat{all})
27.2 % ( 26 %) Dirichlet(Pi{all})
28.5 % ( 22 %) Slider(Pi{all})
36.2 % ( 26 %) Multiplier(Alpha{1,2})
48.2 % ( 31 %) Multiplier(Alpha{3})
41.0 % ( 21 %) Slider(Pinvar{all})
34.6 % ( 27 %) ExtSPR(Tau{all},V{all})
13.2 % ( 9 %) ExtTBR(Tau{all},V{all})
43.7 % ( 54 %) NNI(Tau{all},V{all})
33.7 % ( 37 %) ParsSPR(Tau{all},V{all})
27.1 % ( 30 %) Multiplier(V{all})
55.9 % ( 56 %) Nodeslider(V{all})
26.6 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.69 0.44 0.26
2 | 167043 0.71 0.47
3 | 166807 166754 0.72
4 | 165991 166793 166612
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.69 0.44 0.26
2 | 166238 0.71 0.46
3 | 167056 167040 0.72
4 | 166518 166462 166686
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1475.65
| 2 |
| 2 |
| |
| 1 1 1 |
| 11 2 21 12 1 1 |
| 1 * 2 1 |
| 1 2 1 1 1 |
| 2 2 12 1 2 1 2 2 1 21 21 |
| 1 1 2 2 111 2 2 22* 1 1 2 11 11 2 2|
| 1 2 1 21 1 1 * 1 1 2 *2 |
|1 2 2 1 1 2 1 21 11 2 22 * 21 2 |
|221 2 2 2 2 2 1 1 2 2 2 2 2 1|
| 1 22 2 2 |
| 1 1 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1481.97
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1471.16 -1490.39
2 -1470.48 -1495.08
--------------------------------------
TOTAL -1470.77 -1494.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.403169 0.008361 0.244051 0.582413 0.392317 1337.32 1419.16 1.000
r(A<->C){all} 0.038332 0.000385 0.002582 0.074501 0.035372 810.84 914.61 1.000
r(A<->G){all} 0.273954 0.005556 0.140000 0.422116 0.269295 603.38 631.21 1.000
r(A<->T){all} 0.117096 0.002359 0.025616 0.208425 0.111109 617.58 707.69 1.000
r(C<->G){all} 0.016841 0.000199 0.000025 0.043797 0.013573 697.55 1045.66 1.003
r(C<->T){all} 0.329072 0.006110 0.183904 0.490241 0.323133 420.15 491.99 1.000
r(G<->T){all} 0.224705 0.004705 0.097021 0.361446 0.218151 546.30 548.83 1.000
pi(A){all} 0.282464 0.000273 0.251466 0.315721 0.282592 848.48 967.22 1.000
pi(C){all} 0.311878 0.000292 0.279574 0.345157 0.311299 1317.17 1322.66 1.000
pi(G){all} 0.225431 0.000233 0.195145 0.253978 0.224970 1186.47 1191.87 1.000
pi(T){all} 0.180226 0.000198 0.152509 0.207730 0.179871 1235.00 1254.41 1.000
alpha{1,2} 0.134427 0.001056 0.077437 0.195588 0.129330 1107.56 1273.70 1.000
alpha{3} 1.864624 0.511070 0.725502 3.373885 1.747059 1156.47 1302.96 1.000
pinvar{all} 0.753254 0.001375 0.680777 0.822836 0.756370 1348.77 1408.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ...********
13 -- .....***.**
14 -- .....**....
15 -- .....******
16 -- ...**......
17 -- .....**..**
18 -- .*.********
19 -- .**........
20 -- ..*********
21 -- .........**
22 -- ...*****.**
23 -- .......*..*
24 -- .....**..*.
25 -- ...*.******
26 -- .....**...*
27 -- .......*.**
28 -- .....***..*
29 -- ...*.***.**
30 -- .......*.*.
31 -- .....***.*.
32 -- .....***...
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2521 0.839773 0.004240 0.836775 0.842771 2
13 2510 0.836109 0.005653 0.832112 0.840107 2
14 2456 0.818121 0.002827 0.816123 0.820120 2
15 2111 0.703198 0.000471 0.702865 0.703531 2
16 1827 0.608594 0.024968 0.590939 0.626249 2
17 950 0.316456 0.005653 0.312458 0.320453 2
18 935 0.311459 0.009893 0.304464 0.318454 2
19 928 0.309127 0.006595 0.304464 0.313791 2
20 892 0.297135 0.017901 0.284477 0.309793 2
21 734 0.244504 0.005653 0.240506 0.248501 2
22 716 0.238508 0.001884 0.237175 0.239840 2
23 596 0.198534 0.009422 0.191872 0.205197 2
24 585 0.194870 0.002355 0.193205 0.196536 2
25 496 0.165223 0.010364 0.157895 0.172552 2
26 485 0.161559 0.012719 0.152565 0.170553 2
27 404 0.134577 0.018844 0.121252 0.147901 2
28 388 0.129247 0.009422 0.122585 0.135909 2
29 382 0.127249 0.015075 0.116589 0.137908 2
30 371 0.123584 0.006124 0.119254 0.127915 2
31 346 0.115256 0.009422 0.108594 0.121919 2
32 319 0.106262 0.005182 0.102598 0.109927 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.006490 0.000026 0.000001 0.016546 0.005318 1.001 2
length{all}[2] 0.006429 0.000025 0.000004 0.016089 0.005276 1.000 2
length{all}[3] 0.009701 0.000036 0.000493 0.021384 0.008475 1.000 2
length{all}[4] 0.006414 0.000027 0.000009 0.016765 0.005172 1.001 2
length{all}[5] 0.013644 0.000058 0.002333 0.028631 0.012155 1.000 2
length{all}[6] 0.019864 0.000111 0.003034 0.040218 0.018123 1.000 2
length{all}[7] 0.023557 0.000136 0.004691 0.046193 0.021551 1.000 2
length{all}[8] 0.041367 0.000273 0.015712 0.075449 0.038640 1.000 2
length{all}[9] 0.074544 0.000855 0.026967 0.131877 0.069707 1.001 2
length{all}[10] 0.090859 0.001048 0.034760 0.148374 0.085668 1.000 2
length{all}[11] 0.027984 0.000164 0.006819 0.053157 0.025523 1.000 2
length{all}[12] 0.010184 0.000050 0.000009 0.023313 0.008599 1.000 2
length{all}[13] 0.022699 0.000194 0.000253 0.048605 0.020208 1.000 2
length{all}[14] 0.012421 0.000072 0.000063 0.028154 0.010637 1.000 2
length{all}[15] 0.019793 0.000173 0.000345 0.045791 0.017219 1.000 2
length{all}[16] 0.007178 0.000033 0.000006 0.018796 0.005757 1.000 2
length{all}[17] 0.009381 0.000054 0.000000 0.024767 0.007912 0.999 2
length{all}[18] 0.003784 0.000014 0.000001 0.010805 0.002568 1.000 2
length{all}[19] 0.003703 0.000014 0.000003 0.011591 0.002475 1.000 2
length{all}[20] 0.003719 0.000014 0.000001 0.010819 0.002586 0.999 2
length{all}[21] 0.007261 0.000050 0.000005 0.021220 0.004949 0.999 2
length{all}[22] 0.010433 0.000060 0.000204 0.025757 0.008311 1.000 2
length{all}[23] 0.007590 0.000051 0.000028 0.022262 0.005508 1.000 2
length{all}[24] 0.006479 0.000048 0.000000 0.019890 0.004259 0.999 2
length{all}[25] 0.005541 0.000027 0.000002 0.015458 0.004166 0.999 2
length{all}[26] 0.005771 0.000034 0.000004 0.016901 0.003929 0.999 2
length{all}[27] 0.006528 0.000045 0.000002 0.020043 0.004617 0.999 2
length{all}[28] 0.006659 0.000046 0.000018 0.019557 0.004566 1.001 2
length{all}[29] 0.006189 0.000028 0.000041 0.016814 0.004768 1.002 2
length{all}[30] 0.006704 0.000050 0.000025 0.019790 0.004394 0.997 2
length{all}[31] 0.006109 0.000036 0.000031 0.016487 0.004258 1.011 2
length{all}[32] 0.006509 0.000039 0.000006 0.019093 0.004321 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008794
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
| /-------------- C4 (4)
+ /--------------------61-------------------+
| | \-------------- C5 (5)
| |
| | /-------------- C6 (6)
| | /------82-----+
| | | \-------------- C7 (7)
\------84-----+ |
| |---------------------------- C8 (8)
| /------84-----+
| | |---------------------------- C10 (10)
| | |
\------70-----+ \---------------------------- C11 (11)
|
\------------------------------------------ C9 (9)
Phylogram (based on average branch lengths):
/--- C1 (1)
|
|--- C2 (2)
|
|----- C3 (3)
|
| /-- C4 (4)
+ /--+
| | \------ C5 (5)
| |
| | /---------- C6 (6)
| | /-----+
| | | \------------ C7 (7)
\----+ |
| |--------------------- C8 (8)
| /---------+
| | |---------------------------------------------- C10 (10)
| | |
\--------+ \-------------- C11 (11)
|
\------------------------------------- C9 (9)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1306 trees sampled):
50 % credible set contains 148 trees
90 % credible set contains 1006 trees
95 % credible set contains 1156 trees
99 % credible set contains 1276 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 717
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
103 patterns at 239 / 239 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
100528 bytes for conP
14008 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
301584 bytes for conP, adjusted
0.004464 0.003378 0.009082 0.007847 0.005118 0.003858 0.012966 0.011260 0.013228 0.010740 0.017827 0.025154 0.042436 0.078348 0.027915 0.054500 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -1549.358463
Iterating by ming2
Initial: fx= 1549.358463
x= 0.00446 0.00338 0.00908 0.00785 0.00512 0.00386 0.01297 0.01126 0.01323 0.01074 0.01783 0.02515 0.04244 0.07835 0.02792 0.05450 0.30000 1.30000
1 h-m-p 0.0000 0.0003 234.3519 +YCCC 1547.392376 3 0.0001 29 | 0/18
2 h-m-p 0.0000 0.0001 283.0904 +YYCCCC 1545.313687 5 0.0001 59 | 0/18
3 h-m-p 0.0000 0.0000 632.7340 +YYCCCC 1544.169512 5 0.0000 89 | 0/18
4 h-m-p 0.0000 0.0001 2492.5798 +CYCCC 1536.254150 4 0.0001 118 | 0/18
5 h-m-p 0.0000 0.0001 1384.0250 +YCYYYCCCCC 1525.863348 9 0.0001 154 | 0/18
6 h-m-p 0.0000 0.0000 3618.5118 +YYYYYCCCC 1520.739061 8 0.0000 187 | 0/18
7 h-m-p 0.0000 0.0001 2337.7648 YCCCC 1518.004814 4 0.0000 215 | 0/18
8 h-m-p 0.0000 0.0000 1417.1991 +YCYCCC 1516.111995 5 0.0000 245 | 0/18
9 h-m-p 0.0000 0.0002 553.3632 +YYCCC 1511.957683 4 0.0001 273 | 0/18
10 h-m-p 0.0000 0.0000 2879.1252 CCCCC 1509.939547 4 0.0000 302 | 0/18
11 h-m-p 0.0000 0.0002 390.1827 CCCC 1508.946923 3 0.0001 329 | 0/18
12 h-m-p 0.0002 0.0012 110.4127 CCCCC 1507.940780 4 0.0003 358 | 0/18
13 h-m-p 0.0002 0.0013 155.6661 YCCC 1507.441799 3 0.0001 384 | 0/18
14 h-m-p 0.0001 0.0012 251.5123 +YCCYCC 1500.774108 5 0.0010 415 | 0/18
15 h-m-p 0.0000 0.0001 4997.4853 +YYYCCCCC 1494.312315 7 0.0000 448 | 0/18
16 h-m-p 0.0000 0.0000 14771.5545 ++ 1488.919246 m 0.0000 469 | 0/18
17 h-m-p 0.0000 0.0000 944.6561
h-m-p: 7.59846070e-20 3.79923035e-19 9.44656085e+02 1488.919246
.. | 0/18
18 h-m-p 0.0000 0.0001 14509.7504 YCYYYCCCCC 1479.143240 9 0.0000 522 | 0/18
19 h-m-p 0.0000 0.0001 558.9795 +YYYYYYC 1468.841144 6 0.0001 550 | 0/18
20 h-m-p 0.0000 0.0000 778.9796 +YCCCC 1467.018266 4 0.0000 579 | 0/18
21 h-m-p 0.0000 0.0001 682.6128 YCCC 1464.848578 3 0.0000 605 | 0/18
22 h-m-p 0.0000 0.0001 463.2986 YCCCC 1462.852156 4 0.0000 633 | 0/18
23 h-m-p 0.0000 0.0001 266.1452 YCYCCC 1461.430588 5 0.0001 662 | 0/18
24 h-m-p 0.0000 0.0001 341.4043 CCCC 1460.905239 3 0.0000 689 | 0/18
25 h-m-p 0.0000 0.0006 217.9357 +CCYCCC 1455.192422 5 0.0004 721 | 0/18
26 h-m-p 0.0000 0.0001 3434.7461 +YYYYCCC 1436.983776 6 0.0001 751 | 0/18
27 h-m-p 0.0001 0.0003 99.9324 CCCC 1436.778395 3 0.0001 778 | 0/18
28 h-m-p 0.0001 0.0008 55.1102 YCC 1436.731327 2 0.0000 802 | 0/18
29 h-m-p 0.0001 0.0015 39.6847 YC 1436.653264 1 0.0002 824 | 0/18
30 h-m-p 0.0001 0.0019 71.6090 +YC 1436.425275 1 0.0003 847 | 0/18
31 h-m-p 0.0002 0.0015 108.8769 YCCC 1435.838719 3 0.0005 873 | 0/18
32 h-m-p 0.0001 0.0004 869.8939 YCCC 1434.758910 3 0.0001 899 | 0/18
33 h-m-p 0.0001 0.0005 991.8222 YCCCC 1432.577251 4 0.0002 927 | 0/18
34 h-m-p 0.0002 0.0012 194.4123 YYC 1432.216334 2 0.0002 950 | 0/18
35 h-m-p 0.0013 0.0072 32.1338 YC 1432.181454 1 0.0002 972 | 0/18
36 h-m-p 0.0062 0.2746 0.8381 ++CYCCC 1429.305338 4 0.1757 1003 | 0/18
37 h-m-p 0.3527 1.7635 0.4067 CCYC 1428.210172 3 0.3585 1047 | 0/18
38 h-m-p 0.2828 1.4138 0.1746 +YCYCCC 1426.909908 5 0.7653 1095 | 0/18
39 h-m-p 0.5483 2.7415 0.0620 CC 1426.453078 1 0.8280 1136 | 0/18
40 h-m-p 0.9231 4.6153 0.0445 CCC 1426.140600 2 1.0518 1179 | 0/18
41 h-m-p 0.7193 3.5963 0.0094 CCCC 1425.925562 3 0.9934 1224 | 0/18
42 h-m-p 1.3162 6.5811 0.0036 CCC 1425.653293 2 1.6841 1267 | 0/18
43 h-m-p 0.2927 8.0000 0.0205 +YC 1425.567481 1 1.9431 1308 | 0/18
44 h-m-p 1.2360 8.0000 0.0322 CYC 1425.545880 2 1.4108 1350 | 0/18
45 h-m-p 1.6000 8.0000 0.0094 YC 1425.543541 1 1.1473 1390 | 0/18
46 h-m-p 1.6000 8.0000 0.0038 C 1425.543068 0 1.3942 1429 | 0/18
47 h-m-p 1.6000 8.0000 0.0009 YC 1425.542789 1 2.7206 1469 | 0/18
48 h-m-p 1.6000 8.0000 0.0003 ++ 1425.541692 m 8.0000 1508 | 0/18
49 h-m-p 1.6000 8.0000 0.0005 CC 1425.540334 1 2.2352 1549 | 0/18
50 h-m-p 0.3916 8.0000 0.0026 +C 1425.539854 0 1.6493 1589 | 0/18
51 h-m-p 1.6000 8.0000 0.0002 Y 1425.539850 0 1.2161 1628 | 0/18
52 h-m-p 1.6000 8.0000 0.0000 Y 1425.539850 0 0.9967 1667 | 0/18
53 h-m-p 0.4480 8.0000 0.0000 +C 1425.539850 0 1.6587 1707 | 0/18
54 h-m-p 1.6000 8.0000 0.0000 Y 1425.539850 0 1.2394 1746 | 0/18
55 h-m-p 1.6000 8.0000 0.0000 C 1425.539850 0 0.4000 1785 | 0/18
56 h-m-p 0.4660 8.0000 0.0000 C 1425.539850 0 0.1165 1824 | 0/18
57 h-m-p 0.1428 8.0000 0.0000 ---------------.. | 0/18
58 h-m-p 0.0160 8.0000 0.0020 ----C 1425.539850 0 0.0000 1919 | 0/18
59 h-m-p 0.0160 8.0000 0.0008 -------------.. | 0/18
60 h-m-p 0.0160 8.0000 0.0012 ------------- | 0/18
61 h-m-p 0.0160 8.0000 0.0012 -------------
Out..
lnL = -1425.539850
2070 lfun, 2070 eigenQcodon, 33120 P(t)
Time used: 0:10
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
0.004464 0.003378 0.009082 0.007847 0.005118 0.003858 0.012966 0.011260 0.013228 0.010740 0.017827 0.025154 0.042436 0.078348 0.027915 0.054500 1.903864 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.210373
np = 19
lnL0 = -1437.762324
Iterating by ming2
Initial: fx= 1437.762324
x= 0.00446 0.00338 0.00908 0.00785 0.00512 0.00386 0.01297 0.01126 0.01323 0.01074 0.01783 0.02515 0.04244 0.07835 0.02792 0.05450 1.90386 0.81675 0.13654
1 h-m-p 0.0000 0.0004 229.5921 +YCCCC 1436.188510 4 0.0001 51 | 0/19
2 h-m-p 0.0000 0.0001 221.5746 +YYCCCC 1434.475235 5 0.0001 101 | 0/19
3 h-m-p 0.0000 0.0001 450.9563 +YYCCCC 1433.445186 5 0.0000 151 | 0/19
4 h-m-p 0.0000 0.0000 2187.2189 +YYYYYC 1427.788201 5 0.0000 198 | 0/19
5 h-m-p 0.0000 0.0000 3327.8811 YCCCC 1426.114148 4 0.0000 246 | 0/19
6 h-m-p 0.0000 0.0001 270.5658 YCCCC 1425.391384 4 0.0001 294 | 0/19
7 h-m-p 0.0001 0.0007 46.1159 YCC 1425.305706 2 0.0001 338 | 0/19
8 h-m-p 0.0001 0.0015 52.0715 CYC 1425.264685 2 0.0001 382 | 0/19
9 h-m-p 0.0000 0.0008 88.7268 +YYC 1425.120536 2 0.0001 426 | 0/19
10 h-m-p 0.0001 0.0010 93.5734 CC 1424.996069 1 0.0001 469 | 0/19
11 h-m-p 0.0003 0.0017 44.5482 YYC 1424.916918 2 0.0002 512 | 0/19
12 h-m-p 0.0003 0.0016 20.1529 YC 1424.910409 1 0.0001 554 | 0/19
13 h-m-p 0.0002 0.0125 6.2819 CC 1424.904652 1 0.0003 597 | 0/19
14 h-m-p 0.0001 0.0096 13.4027 CC 1424.897563 1 0.0002 640 | 0/19
15 h-m-p 0.0004 0.0071 6.7409 YC 1424.892408 1 0.0003 682 | 0/19
16 h-m-p 0.0001 0.0118 13.6815 YC 1424.879743 1 0.0003 724 | 0/19
17 h-m-p 0.0002 0.0474 18.8121 ++YCCC 1424.356076 3 0.0089 772 | 0/19
18 h-m-p 0.0004 0.0025 377.7339 YCCCC 1423.079200 4 0.0011 820 | 0/19
19 h-m-p 0.0013 0.0064 22.2110 CC 1423.061153 1 0.0003 863 | 0/19
20 h-m-p 0.0086 3.3272 0.7412 +++CCCCC 1421.891450 4 0.7012 915 | 0/19
21 h-m-p 0.7572 3.7858 0.0381 CC 1421.674560 1 0.7572 958 | 0/19
22 h-m-p 1.6000 8.0000 0.0029 YCC 1421.610432 2 1.1945 1002 | 0/19
23 h-m-p 0.9066 8.0000 0.0038 CC 1421.597707 1 1.1479 1045 | 0/19
24 h-m-p 1.6000 8.0000 0.0011 YC 1421.594604 1 0.8139 1087 | 0/19
25 h-m-p 0.3227 8.0000 0.0027 +YC 1421.594046 1 0.8796 1130 | 0/19
26 h-m-p 1.6000 8.0000 0.0005 Y 1421.593986 0 0.6413 1171 | 0/19
27 h-m-p 0.3683 8.0000 0.0008 Y 1421.593981 0 0.7479 1212 | 0/19
28 h-m-p 1.6000 8.0000 0.0002 Y 1421.593980 0 0.8861 1253 | 0/19
29 h-m-p 1.6000 8.0000 0.0000 Y 1421.593980 0 0.6525 1294 | 0/19
30 h-m-p 0.4414 8.0000 0.0000 Y 1421.593980 0 0.8276 1335 | 0/19
31 h-m-p 1.6000 8.0000 0.0000 Y 1421.593980 0 1.2762 1376 | 0/19
32 h-m-p 1.6000 8.0000 0.0000 Y 1421.593980 0 1.6000 1417 | 0/19
33 h-m-p 1.6000 8.0000 0.0000 ------------C 1421.593980 0 0.0000 1470
Out..
lnL = -1421.593980
1471 lfun, 4413 eigenQcodon, 47072 P(t)
Time used: 0:23
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
initial w for M2:NSpselection reset.
0.004464 0.003378 0.009082 0.007847 0.005118 0.003858 0.012966 0.011260 0.013228 0.010740 0.017827 0.025154 0.042436 0.078348 0.027915 0.054500 2.000512 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.209106
np = 21
lnL0 = -1482.293931
Iterating by ming2
Initial: fx= 1482.293931
x= 0.00446 0.00338 0.00908 0.00785 0.00512 0.00386 0.01297 0.01126 0.01323 0.01074 0.01783 0.02515 0.04244 0.07835 0.02792 0.05450 2.00051 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0005 229.3687 +YYCCC 1481.094606 4 0.0001 54 | 0/21
2 h-m-p 0.0000 0.0001 142.9951 YCYCCC 1480.564986 5 0.0001 107 | 0/21
3 h-m-p 0.0001 0.0004 90.7099 CCC 1480.286181 2 0.0001 156 | 0/21
4 h-m-p 0.0000 0.0003 243.9731 CCCC 1479.932706 3 0.0001 207 | 0/21
5 h-m-p 0.0001 0.0008 128.5051 CYCC 1479.574985 3 0.0001 257 | 0/21
6 h-m-p 0.0001 0.0006 163.6616 YCCC 1478.638047 3 0.0003 307 | 0/21
7 h-m-p 0.0000 0.0002 973.3610 CYC 1477.958517 2 0.0000 355 | 0/21
8 h-m-p 0.0001 0.0005 755.8432 ++ 1468.420670 m 0.0005 400 | 1/21
9 h-m-p 0.0002 0.0009 301.2069 CCC 1468.382977 2 0.0000 449 | 1/21
10 h-m-p 0.0000 0.0001 1248.0257 CCC 1468.320917 2 0.0000 497 | 1/21
11 h-m-p 0.0001 0.0044 168.0835 +YCCC 1467.750247 3 0.0008 547 | 1/21
12 h-m-p 0.0001 0.0007 567.3718 CYCCC 1467.175249 4 0.0002 598 | 1/21
13 h-m-p 0.0001 0.0007 335.4820 YYC 1466.978171 2 0.0001 644 | 1/21
14 h-m-p 0.0005 0.0067 81.3991 CCC 1466.628210 2 0.0008 692 | 1/21
15 h-m-p 0.0004 0.0020 96.5917 YCCC 1466.499928 3 0.0002 741 | 1/21
16 h-m-p 0.0003 0.0014 65.4716 CCCCC 1466.213428 4 0.0004 793 | 1/21
17 h-m-p 0.0004 0.0167 66.9583 ++YYYCCCCC 1458.352456 7 0.0069 850 | 1/21
18 h-m-p 0.0003 0.0014 345.3679 +YYCCCC 1450.593048 5 0.0009 903 | 1/21
19 h-m-p 0.0287 0.1436 8.6442 +YYYCCC 1438.281667 5 0.1048 955 | 1/21
20 h-m-p 0.1966 0.9829 2.4075 YYCCC 1430.809693 4 0.2692 1005 | 0/21
21 h-m-p 0.0012 0.0062 282.5039 CYCCC 1430.307102 4 0.0003 1056 | 0/21
22 h-m-p 0.0276 0.4861 2.7491 +++ 1425.464183 m 0.4861 1102 | 1/21
23 h-m-p 0.1451 0.7257 2.5807 YYC 1424.915867 2 0.1149 1149 | 1/21
24 h-m-p 0.2512 1.2558 0.5095 CYCCC 1423.868758 4 0.4493 1200 | 1/21
25 h-m-p 0.4190 2.0951 0.3832 CCCC 1423.227379 3 0.5852 1250 | 1/21
26 h-m-p 0.3205 1.6027 0.2534 CCCC 1422.707071 3 0.5711 1300 | 1/21
27 h-m-p 0.3485 7.2486 0.4153 YCCC 1422.282917 3 0.7285 1349 | 1/21
28 h-m-p 1.6000 8.0000 0.1479 CCC 1421.893659 2 1.5263 1397 | 1/21
29 h-m-p 0.9241 5.8207 0.2443 CCC 1421.732036 2 0.9539 1445 | 1/21
30 h-m-p 1.6000 8.0000 0.1426 YCC 1421.635083 2 1.0193 1492 | 1/21
31 h-m-p 1.6000 8.0000 0.0661 YC 1421.601931 1 0.9470 1537 | 1/21
32 h-m-p 1.6000 8.0000 0.0209 YC 1421.595821 1 0.7475 1582 | 1/21
33 h-m-p 1.6000 8.0000 0.0031 YC 1421.594849 1 1.1071 1627 | 1/21
34 h-m-p 1.6000 8.0000 0.0016 YC 1421.594337 1 1.2543 1672 | 1/21
35 h-m-p 0.8903 8.0000 0.0023 YC 1421.594040 1 1.5110 1717 | 1/21
36 h-m-p 1.6000 8.0000 0.0012 Y 1421.593990 0 1.1059 1761 | 1/21
37 h-m-p 1.1909 8.0000 0.0011 Y 1421.593981 0 0.8668 1805 | 1/21
38 h-m-p 1.6000 8.0000 0.0003 Y 1421.593980 0 1.1857 1849 | 1/21
39 h-m-p 1.6000 8.0000 0.0000 Y 1421.593980 0 0.9399 1893 | 1/21
40 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/21
41 h-m-p 0.0156 7.7944 0.0054 -------------
Out..
lnL = -1421.593980
2007 lfun, 8028 eigenQcodon, 96336 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1432.064847 S = -1382.661155 -40.472291
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 103 patterns 0:51
did 20 / 103 patterns 0:51
did 30 / 103 patterns 0:51
did 40 / 103 patterns 0:52
did 50 / 103 patterns 0:52
did 60 / 103 patterns 0:52
did 70 / 103 patterns 0:52
did 80 / 103 patterns 0:52
did 90 / 103 patterns 0:52
did 100 / 103 patterns 0:52
did 103 / 103 patterns 0:52
Time used: 0:52
Model 3: discrete
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
0.004464 0.003378 0.009082 0.007847 0.005118 0.003858 0.012966 0.011260 0.013228 0.010740 0.017827 0.025154 0.042436 0.078348 0.027915 0.054500 2.000520 0.923969 0.634343 0.038819 0.097146 0.135697
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.253078
np = 22
lnL0 = -1425.714003
Iterating by ming2
Initial: fx= 1425.714003
x= 0.00446 0.00338 0.00908 0.00785 0.00512 0.00386 0.01297 0.01126 0.01323 0.01074 0.01783 0.02515 0.04244 0.07835 0.02792 0.05450 2.00052 0.92397 0.63434 0.03882 0.09715 0.13570
1 h-m-p 0.0000 0.0003 177.1159 +CYC 1425.071842 2 0.0000 53 | 0/22
2 h-m-p 0.0000 0.0001 114.5087 CYCCC 1424.867226 4 0.0000 107 | 0/22
3 h-m-p 0.0001 0.0005 51.0878 CYC 1424.781468 2 0.0001 157 | 0/22
4 h-m-p 0.0000 0.0004 121.9588 CCC 1424.682420 2 0.0000 208 | 0/22
5 h-m-p 0.0001 0.0004 95.7125 YC 1424.469144 1 0.0002 256 | 0/22
6 h-m-p 0.0000 0.0001 255.1577 ++ 1424.148153 m 0.0001 303 | 1/22
7 h-m-p 0.0002 0.0016 44.6758 CC 1424.135220 1 0.0001 352 | 1/22
8 h-m-p 0.0001 0.0009 26.6063 C 1424.123690 0 0.0001 398 | 1/22
9 h-m-p 0.0000 0.0017 91.8296 +YC 1424.094179 1 0.0001 446 | 1/22
10 h-m-p 0.0002 0.0025 43.1250 YC 1424.079440 1 0.0001 493 | 1/22
11 h-m-p 0.0001 0.0028 27.7588 CC 1424.055434 1 0.0002 541 | 1/22
12 h-m-p 0.0001 0.0011 41.7182 YCC 1424.039038 2 0.0001 590 | 1/22
13 h-m-p 0.0001 0.0056 43.3613 +CC 1423.980952 1 0.0003 639 | 1/22
14 h-m-p 0.0002 0.0039 53.8895 YCCC 1423.856991 3 0.0004 690 | 1/22
15 h-m-p 0.0003 0.0032 92.5804 +CCC 1423.307196 2 0.0011 741 | 1/22
16 h-m-p 0.0000 0.0002 893.1582 +YCCC 1422.613959 3 0.0001 793 | 1/22
17 h-m-p 0.0002 0.0010 63.3131 CCC 1422.533342 2 0.0003 843 | 1/22
18 h-m-p 0.0003 0.0017 28.2102 CC 1422.523906 1 0.0001 891 | 1/22
19 h-m-p 0.0005 0.0068 5.8113 ++ 1422.471671 m 0.0068 937 | 2/22
20 h-m-p 0.0214 1.2397 1.6821 +YCCC 1421.920579 3 0.2035 989 | 1/22
21 h-m-p 0.0062 0.0317 55.0856 YC 1421.896100 1 0.0008 1035 | 1/22
22 h-m-p 0.0411 0.2054 0.6584 ++ 1421.465099 m 0.2054 1081 | 2/22
23 h-m-p 0.1540 1.5821 0.8773 YCCC 1421.172223 3 0.3285 1132 | 2/22
24 h-m-p 0.5664 2.8320 0.2761 CCCC 1421.017468 3 0.5950 1183 | 2/22
25 h-m-p 1.4541 8.0000 0.1130 YC 1421.000786 1 0.7041 1229 | 2/22
26 h-m-p 1.1054 8.0000 0.0720 YC 1420.994770 1 0.4765 1275 | 2/22
27 h-m-p 1.1752 8.0000 0.0292 C 1420.990913 0 1.2279 1320 | 2/22
28 h-m-p 1.6000 8.0000 0.0128 YC 1420.990346 1 0.9944 1366 | 2/22
29 h-m-p 1.6000 8.0000 0.0040 YC 1420.990282 1 0.9746 1412 | 2/22
30 h-m-p 1.6000 8.0000 0.0009 Y 1420.990276 0 0.7707 1457 | 2/22
31 h-m-p 1.6000 8.0000 0.0002 Y 1420.990276 0 0.9217 1502 | 2/22
32 h-m-p 1.6000 8.0000 0.0000 Y 1420.990276 0 1.2192 1547 | 2/22
33 h-m-p 1.6000 8.0000 0.0000 C 1420.990276 0 0.4808 1592 | 2/22
34 h-m-p 0.8489 8.0000 0.0000 C 1420.990276 0 0.2759 1637 | 2/22
35 h-m-p 0.3881 8.0000 0.0000 ---------------.. | 2/22
36 h-m-p 0.0076 3.8070 0.0030 -------------
Out..
lnL = -1420.990276
1752 lfun, 7008 eigenQcodon, 84096 P(t)
Time used: 1:16
Model 7: beta
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
0.004464 0.003378 0.009082 0.007847 0.005118 0.003858 0.012966 0.011260 0.013228 0.010740 0.017827 0.025154 0.042436 0.078348 0.027915 0.054500 1.936639 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.591276
np = 19
lnL0 = -1453.854230
Iterating by ming2
Initial: fx= 1453.854230
x= 0.00446 0.00338 0.00908 0.00785 0.00512 0.00386 0.01297 0.01126 0.01323 0.01074 0.01783 0.02515 0.04244 0.07835 0.02792 0.05450 1.93664 1.09130 1.18071
1 h-m-p 0.0000 0.0003 190.1983 +CYC 1453.108911 2 0.0000 47 | 0/19
2 h-m-p 0.0000 0.0001 116.8802 CYCCC 1452.861395 4 0.0000 95 | 0/19
3 h-m-p 0.0001 0.0008 54.1761 CYC 1452.753661 2 0.0001 139 | 0/19
4 h-m-p 0.0000 0.0003 123.0351 CCC 1452.642175 2 0.0001 184 | 0/19
5 h-m-p 0.0001 0.0007 86.1981 YCCC 1452.478815 3 0.0001 230 | 0/19
6 h-m-p 0.0001 0.0016 137.6015 YCCC 1452.228338 3 0.0001 276 | 0/19
7 h-m-p 0.0000 0.0002 336.5974 YCCCC 1451.871044 4 0.0001 324 | 0/19
8 h-m-p 0.0001 0.0014 436.0744 +YCCCC 1448.196025 4 0.0006 373 | 0/19
9 h-m-p 0.0001 0.0003 2722.9618 YCYCCC 1442.956657 5 0.0001 422 | 0/19
10 h-m-p 0.0000 0.0001 5157.1004 YCYCCC 1438.712641 5 0.0001 471 | 0/19
11 h-m-p 0.0000 0.0001 6232.2019 CYCCC 1436.379358 4 0.0000 519 | 0/19
12 h-m-p 0.0005 0.0027 37.0137 YC 1436.294864 1 0.0003 561 | 0/19
13 h-m-p 0.0001 0.0035 69.1493 CCC 1436.238209 2 0.0001 606 | 0/19
14 h-m-p 0.0001 0.0027 58.1545 YC 1436.110209 1 0.0003 648 | 0/19
15 h-m-p 0.0001 0.0015 176.9757 +YYCCCCC 1435.510595 6 0.0005 700 | 0/19
16 h-m-p 0.0001 0.0010 589.5673 +YYYCC 1433.386082 4 0.0005 747 | 0/19
17 h-m-p 0.0001 0.0004 3419.6258 YCCC 1430.803891 3 0.0001 793 | 0/19
18 h-m-p 0.0001 0.0003 2338.5591 YCCCCC 1428.214488 5 0.0002 843 | 0/19
19 h-m-p 0.2231 1.1304 1.5756 YCCCC 1424.677133 4 0.5475 891 | 0/19
20 h-m-p 0.7042 3.5211 0.2094 CYC 1423.413250 2 0.5967 935 | 0/19
21 h-m-p 0.4705 4.1542 0.2655 CCCC 1422.717228 3 0.6800 982 | 0/19
22 h-m-p 0.4140 2.0929 0.4361 CYC 1422.591629 2 0.3884 1026 | 0/19
23 h-m-p 1.1892 5.9461 0.1242 CYC 1422.467010 2 1.1080 1070 | 0/19
24 h-m-p 1.6000 8.0000 0.0203 CCC 1422.395648 2 1.4167 1115 | 0/19
25 h-m-p 1.4279 8.0000 0.0201 CYC 1422.338650 2 1.5687 1159 | 0/19
26 h-m-p 0.5052 8.0000 0.0626 +YCC 1422.291172 2 1.7487 1204 | 0/19
27 h-m-p 0.9703 8.0000 0.1127 +CCC 1422.181050 2 4.5800 1250 | 0/19
28 h-m-p 1.1190 6.6221 0.4615 +YYYCCC 1421.660641 5 3.9924 1299 | 0/19
29 h-m-p 0.0588 0.2940 4.0747 CYCYC 1421.524861 4 0.1162 1346 | 0/19
30 h-m-p 0.0800 0.4001 0.9933 YYCCCCC 1421.425458 6 0.0903 1397 | 0/19
31 h-m-p 0.5996 8.0000 0.1497 YCCC 1421.166103 3 1.0005 1443 | 0/19
32 h-m-p 1.1683 5.8417 0.1254 YYC 1421.142522 2 0.8878 1486 | 0/19
33 h-m-p 1.6000 8.0000 0.0342 YC 1421.138681 1 0.7397 1528 | 0/19
34 h-m-p 1.6000 8.0000 0.0080 YC 1421.138326 1 1.0982 1570 | 0/19
35 h-m-p 1.6000 8.0000 0.0016 Y 1421.138298 0 1.0725 1611 | 0/19
36 h-m-p 1.6000 8.0000 0.0001 Y 1421.138297 0 1.0192 1652 | 0/19
37 h-m-p 0.9988 8.0000 0.0001 C 1421.138297 0 0.9988 1693 | 0/19
38 h-m-p 1.6000 8.0000 0.0000 C 1421.138297 0 0.3216 1734 | 0/19
39 h-m-p 0.3299 8.0000 0.0000 Y 1421.138297 0 0.3299 1775 | 0/19
40 h-m-p 0.5679 8.0000 0.0000 -C 1421.138297 0 0.0355 1817 | 0/19
41 h-m-p 0.1545 8.0000 0.0000 -Y 1421.138297 0 0.0097 1859
Out..
lnL = -1421.138297
1860 lfun, 20460 eigenQcodon, 297600 P(t)
Time used: 2:43
Model 8: beta&w>1
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
initial w for M8:NSbetaw>1 reset.
0.004464 0.003378 0.009082 0.007847 0.005118 0.003858 0.012966 0.011260 0.013228 0.010740 0.017827 0.025154 0.042436 0.078348 0.027915 0.054500 1.941634 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.254814
np = 21
lnL0 = -1442.167892
Iterating by ming2
Initial: fx= 1442.167892
x= 0.00446 0.00338 0.00908 0.00785 0.00512 0.00386 0.01297 0.01126 0.01323 0.01074 0.01783 0.02515 0.04244 0.07835 0.02792 0.05450 1.94163 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0006 335.3036 ++YCCCC 1437.484000 4 0.0001 56 | 0/21
2 h-m-p 0.0000 0.0002 300.6102 +YYYCCC 1432.364033 5 0.0001 109 | 0/21
3 h-m-p 0.0000 0.0000 726.0136 +YYCCCC 1430.937115 5 0.0000 163 | 0/21
4 h-m-p 0.0000 0.0001 555.1348 +YCC 1428.419367 2 0.0001 212 | 0/21
5 h-m-p 0.0000 0.0000 266.3130 ++ 1427.907772 m 0.0000 257 | 1/21
6 h-m-p 0.0000 0.0002 131.3041 +YYCCC 1427.072891 4 0.0001 309 | 1/21
7 h-m-p 0.0000 0.0002 316.3011 CCCC 1426.341298 3 0.0001 359 | 1/21
8 h-m-p 0.0001 0.0003 171.3407 CCC 1425.769381 2 0.0001 407 | 1/21
9 h-m-p 0.0001 0.0004 129.4143 CCCC 1425.406459 3 0.0001 457 | 1/21
10 h-m-p 0.0000 0.0002 114.2699 CC 1425.309014 1 0.0000 503 | 1/21
11 h-m-p 0.0000 0.0006 132.9620 +YCC 1425.077517 2 0.0001 551 | 1/21
12 h-m-p 0.0001 0.0006 72.7235 CYCCC 1424.880328 4 0.0002 602 | 1/21
13 h-m-p 0.0001 0.0019 133.8194 +YCCC 1424.433504 3 0.0003 652 | 1/21
14 h-m-p 0.0003 0.0020 104.9155 CCCCC 1423.861714 4 0.0004 704 | 1/21
15 h-m-p 0.0007 0.0036 52.7026 -YCC 1423.824099 2 0.0001 752 | 1/21
16 h-m-p 0.0008 0.0166 5.1628 CC 1423.819287 1 0.0003 798 | 1/21
17 h-m-p 0.0007 0.0457 2.4320 YC 1423.812688 1 0.0013 843 | 1/21
18 h-m-p 0.0002 0.0277 15.4122 +++YCCC 1423.472335 3 0.0092 895 | 1/21
19 h-m-p 0.0003 0.0024 499.1870 +YYYCCCCC 1421.867810 7 0.0012 951 | 1/21
20 h-m-p 0.7746 3.8729 0.5666 YCCC 1421.616532 3 0.4370 1000 | 1/21
21 h-m-p 0.8347 4.6891 0.2967 CCCC 1421.421001 3 1.0110 1050 | 1/21
22 h-m-p 0.3202 1.6012 0.6759 YCCCCC 1421.335641 5 0.4066 1103 | 1/21
23 h-m-p 0.2352 1.1759 0.9518 CYCYC 1421.174407 4 0.4208 1153 | 1/21
24 h-m-p 1.6000 8.0000 0.0286 YCC 1421.141512 2 0.8636 1200 | 1/21
25 h-m-p 1.6000 8.0000 0.0134 CC 1421.139259 1 0.6150 1246 | 1/21
26 h-m-p 0.7376 8.0000 0.0111 C 1421.138823 0 0.7728 1290 | 1/21
27 h-m-p 0.7681 8.0000 0.0112 YC 1421.138771 1 0.4848 1335 | 1/21
28 h-m-p 1.6000 8.0000 0.0026 Y 1421.138760 0 0.6660 1379 | 1/21
29 h-m-p 1.6000 8.0000 0.0002 Y 1421.138759 0 0.9562 1423 | 1/21
30 h-m-p 0.6145 8.0000 0.0004 Y 1421.138758 0 1.2196 1467 | 1/21
31 h-m-p 0.6341 8.0000 0.0007 +Y 1421.138758 0 4.2158 1512 | 1/21
32 h-m-p 0.7262 8.0000 0.0040 ++ 1421.138748 m 8.0000 1556 | 1/21
33 h-m-p 0.4430 8.0000 0.0729 ++C 1421.138643 0 6.1982 1602 | 1/21
34 h-m-p 0.3802 1.9009 0.3693 ++ 1421.138387 m 1.9009 1646 | 2/21
35 h-m-p 0.7912 8.0000 0.0015 C 1421.138309 0 1.0498 1690 | 2/21
36 h-m-p 1.6000 8.0000 0.0002 Y 1421.138308 0 0.8743 1733 | 2/21
37 h-m-p 1.6000 8.0000 0.0000 Y 1421.138308 0 0.6854 1776 | 2/21
38 h-m-p 1.6000 8.0000 0.0000 --C 1421.138308 0 0.0250 1821 | 2/21
39 h-m-p 0.0160 8.0000 0.0000 -----C 1421.138308 0 0.0000 1869
Out..
lnL = -1421.138308
1870 lfun, 22440 eigenQcodon, 329120 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1433.449607 S = -1383.006838 -42.249592
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 103 patterns 4:18
did 20 / 103 patterns 4:18
did 30 / 103 patterns 4:18
did 40 / 103 patterns 4:19
did 50 / 103 patterns 4:19
did 60 / 103 patterns 4:19
did 70 / 103 patterns 4:19
did 80 / 103 patterns 4:19
did 90 / 103 patterns 4:20
did 100 / 103 patterns 4:20
did 103 / 103 patterns 4:20
Time used: 4:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=11, Len=239
D_melanogaster_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_sechellia_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_simulans_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_yakuba_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_erecta_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_biarmipes_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_suzukii_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
D_eugracilis_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_ficusphila_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_elegans_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_takahashii_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
************************************************:*
D_melanogaster_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_sechellia_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_simulans_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_yakuba_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_erecta_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_biarmipes_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_suzukii_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_eugracilis_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_ficusphila_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
D_elegans_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_takahashii_Zasp66-PJ YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
**************************************:***********
D_melanogaster_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_sechellia_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_simulans_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_yakuba_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_erecta_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV
D_biarmipes_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_suzukii_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_eugracilis_Zasp66-PJ NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV
D_ficusphila_Zasp66-PJ NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV
D_elegans_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV
D_takahashii_Zasp66-PJ NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV
********* ***************:****::********:******:**
D_melanogaster_Zasp66-PJ QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_sechellia_Zasp66-PJ QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_simulans_Zasp66-PJ QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_yakuba_Zasp66-PJ QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_erecta_Zasp66-PJ QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_biarmipes_Zasp66-PJ QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_suzukii_Zasp66-PJ QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_eugracilis_Zasp66-PJ QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_ficusphila_Zasp66-PJ QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP
D_elegans_Zasp66-PJ QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP
D_takahashii_Zasp66-PJ QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP
*******:************.**:::**********:*************
D_melanogaster_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_sechellia_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_simulans_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_yakuba_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_erecta_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_biarmipes_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_suzukii_Zasp66-PJ ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_eugracilis_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_ficusphila_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_elegans_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
D_takahashii_Zasp66-PJ VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
.**************************************
>D_melanogaster_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA TTGGTGCCACCGAGTAC >D_sechellia_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCATGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA TTGGTGCCACCGAGTAC >D_simulans_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGTTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGA TTGGTGCCACCGAGTAC >D_yakuba_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGACACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAGTAC >D_erecta_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTTCGCCACGAGCGAAAGCAATCGCTTGAAGGAAAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAGTAC >D_biarmipes_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCTACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACGAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG TGCAGACTAAGGTCTATCAGCCGAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTCA TTGGTGCCACCGAGTAC >D_suzukii_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCAACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACGAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG TGCAGACTAAGGTCTATCAGCCGAATAGATTGGTTCCAGGAAAGAAACCA GCTTCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAGTAC >D_eugracilis_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG ATCAACAGTTCCTTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAGGAGGG CGGCTACAGCAGCTATGGCCAATCCTCGCCACAGGAAGTAACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA CGAGAACATACGCCAGAGCGGCTCTTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAGTAC >D_ficusphila_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG ATCAACAGTTCCCTTCGCCACAAGCGACAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATCCAAGAGGAGGG CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAGGTGACCATTCCTG TGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTTTCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAGTAC >D_elegans_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG ATCAACAGTTCCCTTCGCCACGAGCGAAAGCAATCGCTTGAGGGACAGTC CTCTGCATCGTCCTTTGCCAACGAAGCTTAACGGCTATAAGAAAACTGTC CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTACGGCAATGCCGCGCCACAGGAAGTAACCATACCTG TGCAGACTAGGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCATGA TGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAATAC >D_takahashii_Zasp66-PJ ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAGTC CTTTGCATCGTCCTTTGCCATCGAAACTTAACGGCTATAAGCAAACTGTC CAGTACGATCCCAGGAACAGCGATACCTACAGAGCCATTCAAGAAGAGGG CGGCTACAGCAACTATGGCCAGTCCTCGCCACAGGAAGTAACCATTCCTG TGCAGACTAGGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAACCA GTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCACGA CGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGTTA TTGGTGCCACCGAGTAC
>D_melanogaster_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_sechellia_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_simulans_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_yakuba_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_erecta_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKESPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_biarmipes_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_suzukii_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP ASAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_eugracilis_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNSNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSDTYRAIQEEGGYSSYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_ficusphila_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF NSPIGLYSNHNIEDTIRSTVPFATSDSNRLKDSPLHRPLPTKLNGYKKTV QYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_elegans_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLRDSPLHRPLPTKLNGYKKTV QYDPRNSDTYRAIQEEGGYSNYGNAAPQEVTIPVQTRVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY >D_takahashii_Zasp66-PJ MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPSKLNGYKQTV QYDPRNSDTYRAIQEEGGYSNYGQSSPQEVTIPVQTRVYQPNRLVPGKKP VSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATEY
#NEXUS
[ID: 3196902254]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_Zasp66-PJ
D_sechellia_Zasp66-PJ
D_simulans_Zasp66-PJ
D_yakuba_Zasp66-PJ
D_erecta_Zasp66-PJ
D_biarmipes_Zasp66-PJ
D_suzukii_Zasp66-PJ
D_eugracilis_Zasp66-PJ
D_ficusphila_Zasp66-PJ
D_elegans_Zasp66-PJ
D_takahashii_Zasp66-PJ
;
end;
begin trees;
translate
1 D_melanogaster_Zasp66-PJ,
2 D_sechellia_Zasp66-PJ,
3 D_simulans_Zasp66-PJ,
4 D_yakuba_Zasp66-PJ,
5 D_erecta_Zasp66-PJ,
6 D_biarmipes_Zasp66-PJ,
7 D_suzukii_Zasp66-PJ,
8 D_eugracilis_Zasp66-PJ,
9 D_ficusphila_Zasp66-PJ,
10 D_elegans_Zasp66-PJ,
11 D_takahashii_Zasp66-PJ
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.005317788,2:0.005276455,3:0.008475291,((4:0.005171724,5:0.01215468)0.609:0.005757472,(((6:0.01812265,7:0.02155061)0.818:0.01063663,8:0.0386404,10:0.08566842,11:0.02552349)0.836:0.0202076,9:0.06970688)0.703:0.0172186)0.840:0.00859889);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.005317788,2:0.005276455,3:0.008475291,((4:0.005171724,5:0.01215468):0.005757472,(((6:0.01812265,7:0.02155061):0.01063663,8:0.0386404,10:0.08566842,11:0.02552349):0.0202076,9:0.06970688):0.0172186):0.00859889);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1471.16 -1490.39
2 -1470.48 -1495.08
--------------------------------------
TOTAL -1470.77 -1494.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PJ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.403169 0.008361 0.244051 0.582413 0.392317 1337.32 1419.16 1.000
r(A<->C){all} 0.038332 0.000385 0.002582 0.074501 0.035372 810.84 914.61 1.000
r(A<->G){all} 0.273954 0.005556 0.140000 0.422116 0.269295 603.38 631.21 1.000
r(A<->T){all} 0.117096 0.002359 0.025616 0.208425 0.111109 617.58 707.69 1.000
r(C<->G){all} 0.016841 0.000199 0.000025 0.043797 0.013573 697.55 1045.66 1.003
r(C<->T){all} 0.329072 0.006110 0.183904 0.490241 0.323133 420.15 491.99 1.000
r(G<->T){all} 0.224705 0.004705 0.097021 0.361446 0.218151 546.30 548.83 1.000
pi(A){all} 0.282464 0.000273 0.251466 0.315721 0.282592 848.48 967.22 1.000
pi(C){all} 0.311878 0.000292 0.279574 0.345157 0.311299 1317.17 1322.66 1.000
pi(G){all} 0.225431 0.000233 0.195145 0.253978 0.224970 1186.47 1191.87 1.000
pi(T){all} 0.180226 0.000198 0.152509 0.207730 0.179871 1235.00 1254.41 1.000
alpha{1,2} 0.134427 0.001056 0.077437 0.195588 0.129330 1107.56 1273.70 1.000
alpha{3} 1.864624 0.511070 0.725502 3.373885 1.747059 1156.47 1302.96 1.000
pinvar{all} 0.753254 0.001375 0.680777 0.822836 0.756370 1348.77 1408.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/442/Zasp66-PJ/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 239
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 7 7 7 7 7 6 | TAC 15 15 15 15 15 15 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 4 3 3 3 | His CAT 2 3 2 2 2 2 | Arg CGT 3 3 3 4 4 2
CTC 2 2 2 2 2 2 | CCC 8 8 7 8 8 7 | CAC 6 5 6 6 6 6 | CGC 5 5 5 4 4 5
CTA 0 0 0 0 1 0 | CCA 8 8 8 8 8 8 | Gln CAA 5 5 5 5 5 4 | CGA 0 0 0 0 0 1
CTG 4 4 4 4 3 4 | CCG 4 4 4 4 4 5 | CAG 8 8 8 8 8 9 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 4 4 4 4 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 5 5 5 5 5 5 | Ser AGT 2 2 2 2 2 2
ATC 3 4 4 4 4 5 | ACC 6 6 6 6 6 6 | AAC 11 11 11 11 11 11 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 4 4 | Lys AAA 5 5 5 5 5 5 | Arg AGA 3 3 3 3 3 3
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 2 2 | AAG 10 10 10 10 10 10 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 5 5 4 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 3 3 3 5 | Gly GGT 2 2 3 2 2 2
GTC 6 6 6 6 6 7 | GCC 7 7 7 7 7 7 | GAC 7 7 7 8 6 6 | GGC 8 8 7 8 8 8
GTA 3 3 3 3 3 4 | GCA 0 0 0 0 0 0 | Glu GAA 5 5 5 4 6 3 | GGA 3 3 3 3 3 3
GTG 8 8 8 6 6 5 | GCG 2 2 2 2 2 2 | GAG 8 8 8 8 8 9 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 | Ser TCT 0 1 0 0 0 | Tyr TAT 4 3 3 4 3 | Cys TGT 0 0 0 0 0
TTC 5 5 5 5 5 | TCC 6 5 7 5 7 | TAC 14 15 15 14 15 | TGC 1 1 1 1 1
Leu TTA 0 0 0 0 0 | TCA 2 2 2 2 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 5 5 5 4 5 | TCG 3 3 2 2 4 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 2 1 1 | Pro CCT 4 6 4 3 3 | His CAT 2 3 2 3 2 | Arg CGT 2 2 3 2 2
CTC 2 2 1 2 2 | CCC 7 6 8 8 8 | CAC 6 5 7 5 6 | CGC 5 5 4 5 5
CTA 0 0 0 1 0 | CCA 8 8 7 8 9 | Gln CAA 4 5 4 4 5 | CGA 1 1 1 0 1
CTG 4 4 4 4 4 | CCG 4 3 4 4 3 | CAG 9 8 9 8 9 | CGG 1 1 1 2 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 3 3 4 | Thr ACT 4 4 4 4 4 | Asn AAT 5 5 5 6 5 | Ser AGT 2 2 2 2 2
ATC 4 4 5 4 4 | ACC 6 6 6 6 6 | AAC 11 9 10 11 11 | AGC 6 8 6 6 6
ATA 1 1 1 2 1 | ACA 4 5 5 3 4 | Lys AAA 5 5 5 4 4 | Arg AGA 3 3 3 3 3
Met ATG 4 4 4 4 4 | ACG 2 1 1 3 1 | AAG 10 10 10 9 9 | AGG 2 2 2 4 3
----------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 4 4 | Ala GCT 2 1 1 1 1 | Asp GAT 6 3 3 4 3 | Gly GGT 2 2 2 2 2
GTC 6 6 6 6 7 | GCC 7 7 7 8 7 | GAC 6 8 9 7 8 | GGC 8 8 8 8 8
GTA 3 4 2 4 4 | GCA 0 0 0 0 0 | Glu GAA 4 3 1 6 4 | GGA 3 3 3 3 3
GTG 5 5 7 6 5 | GCG 2 2 2 3 2 | GAG 7 9 10 6 8 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.15481 C:0.43096 A:0.16318 G:0.25105
Average T:0.17713 C:0.31102 A:0.28591 G:0.22594
#2: D_sechellia_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.15481 C:0.43096 A:0.16318 G:0.25105
Average T:0.17713 C:0.31102 A:0.28591 G:0.22594
#3: D_simulans_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.15900 C:0.42678 A:0.16318 G:0.25105
Average T:0.17852 C:0.30962 A:0.28591 G:0.22594
#4: D_yakuba_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.16318 C:0.43515 A:0.15900 G:0.24268
Average T:0.17992 C:0.31241 A:0.28452 G:0.22315
#5: D_erecta_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.16318 C:0.42678 A:0.16736 G:0.24268
Average T:0.17992 C:0.30962 A:0.28731 G:0.22315
#6: D_biarmipes_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.16318 C:0.43096 A:0.15481 G:0.25105
Average T:0.17992 C:0.31102 A:0.28312 G:0.22594
#7: D_suzukii_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20502 C:0.25523 A:0.38912 G:0.15063
position 3: T:0.17992 C:0.41841 A:0.15900 G:0.24268
Average T:0.18410 C:0.30823 A:0.28452 G:0.22315
#8: D_eugracilis_Zasp66-PJ
position 1: T:0.16736 C:0.25105 A:0.30544 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38075 G:0.15900
position 3: T:0.17573 C:0.41841 A:0.16736 G:0.23849
Average T:0.18410 C:0.30683 A:0.28452 G:0.22455
#9: D_ficusphila_Zasp66-PJ
position 1: T:0.16736 C:0.25523 A:0.30126 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38912 G:0.15063
position 3: T:0.16318 C:0.43933 A:0.14226 G:0.25523
Average T:0.17992 C:0.31520 A:0.27755 G:0.22734
#10: D_elegans_Zasp66-PJ
position 1: T:0.15481 C:0.25105 A:0.30962 G:0.28452
position 2: T:0.20921 C:0.25105 A:0.38075 G:0.15900
position 3: T:0.16318 C:0.42259 A:0.16736 G:0.24686
Average T:0.17573 C:0.30823 A:0.28591 G:0.23013
#11: D_takahashii_Zasp66-PJ
position 1: T:0.17155 C:0.25523 A:0.29707 G:0.27615
position 2: T:0.20921 C:0.25105 A:0.38494 G:0.15481
position 3: T:0.15063 C:0.44351 A:0.16318 G:0.24268
Average T:0.17713 C:0.31660 A:0.28173 G:0.22455
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 3 | Tyr Y TAT 35 | Cys C TGT 0
TTC 55 | TCC 71 | TAC 163 | TGC 11
Leu L TTA 0 | TCA 15 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 31 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 39 | His H CAT 25 | Arg R CGT 30
CTC 21 | CCC 83 | CAC 64 | CGC 52
CTA 2 | CCA 88 | Gln Q CAA 51 | CGA 5
CTG 43 | CCG 43 | CAG 92 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 42 | Thr T ACT 44 | Asn N AAT 56 | Ser S AGT 22
ATC 45 | ACC 66 | AAC 118 | AGC 68
ATA 12 | ACA 49 | Lys K AAA 53 | Arg R AGA 33
Met M ATG 44 | ACG 16 | AAG 108 | AGG 25
------------------------------------------------------------------------------
Val V GTT 46 | Ala A GCT 12 | Asp D GAT 39 | Gly G GGT 23
GTC 68 | GCC 78 | GAC 79 | GGC 87
GTA 36 | GCA 0 | Glu E GAA 46 | GGA 33
GTG 69 | GCG 23 | GAG 89 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16660 C:0.25181 A:0.30468 G:0.27691
position 2: T:0.20882 C:0.25143 A:0.38722 G:0.15253
position 3: T:0.16280 C:0.42944 A:0.16090 G:0.24686
Average T:0.17941 C:0.31089 A:0.28427 G:0.22543
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Zasp66-PJ
D_sechellia_Zasp66-PJ -1.0000 (0.0000 0.0121)
D_simulans_Zasp66-PJ -1.0000 (0.0000 0.0183)-1.0000 (0.0000 0.0183)
D_yakuba_Zasp66-PJ 0.0743 (0.0018 0.0245) 0.0743 (0.0018 0.0245) 0.0592 (0.0018 0.0307)
D_erecta_Zasp66-PJ 0.0492 (0.0018 0.0370) 0.0492 (0.0018 0.0370) 0.0420 (0.0018 0.0433) 0.3002 (0.0036 0.0121)
D_biarmipes_Zasp66-PJ 0.0220 (0.0018 0.0825) 0.0220 (0.0018 0.0825) 0.0204 (0.0018 0.0892)-1.0000 (0.0000 0.0825) 0.0408 (0.0036 0.0892)
D_suzukii_Zasp66-PJ 0.0570 (0.0055 0.0960) 0.0570 (0.0055 0.0960) 0.0532 (0.0055 0.1028) 0.0408 (0.0036 0.0892) 0.0761 (0.0073 0.0960) 0.0734 (0.0036 0.0496)
D_eugracilis_Zasp66-PJ 0.0570 (0.0055 0.0960) 0.0570 (0.0055 0.0960) 0.0532 (0.0055 0.1028) 0.0408 (0.0036 0.0892) 0.0761 (0.0073 0.0959) 0.0355 (0.0036 0.1027) 0.0965 (0.0073 0.0757)
D_ficusphila_Zasp66-PJ 0.0613 (0.0055 0.0892) 0.0613 (0.0055 0.0892) 0.0570 (0.0055 0.0960) 0.0818 (0.0073 0.0892) 0.0710 (0.0073 0.1028) 0.0666 (0.0073 0.1097) 0.1069 (0.0110 0.1027) 0.0942 (0.0110 0.1166)
D_elegans_Zasp66-PJ 0.1040 (0.0128 0.1234) 0.1173 (0.0128 0.1094) 0.0984 (0.0128 0.1305) 0.0842 (0.0110 0.1305) 0.1343 (0.0147 0.1094) 0.0843 (0.0110 0.1304) 0.1435 (0.0147 0.1024) 0.1069 (0.0147 0.1374) 0.1155 (0.0184 0.1594)
D_takahashii_Zasp66-PJ 0.1057 (0.0073 0.0691) 0.1057 (0.0073 0.0691) 0.0964 (0.0073 0.0757) 0.0791 (0.0055 0.0691) 0.1207 (0.0091 0.0757) 0.0875 (0.0055 0.0625) 0.1633 (0.0091 0.0560) 0.1325 (0.0091 0.0690) 0.1250 (0.0128 0.1026) 0.1256 (0.0128 0.1023)
Model 0: one-ratio
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
check convergence..
lnL(ntime: 16 np: 18): -1425.539850 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004262 0.004258 0.008541 0.008082 0.004768 0.004281 0.012868 0.014752 0.020342 0.008616 0.021642 0.021688 0.047702 0.084271 0.030437 0.057872 1.903864 0.077637
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35438
(1: 0.004262, 2: 0.004258, 3: 0.008541, ((4: 0.004281, 5: 0.012868): 0.004768, (((6: 0.021642, 7: 0.021688): 0.008616, 8: 0.047702, 10: 0.084271, 11: 0.030437): 0.020342, 9: 0.057872): 0.014752): 0.008082);
(D_melanogaster_Zasp66-PJ: 0.004262, D_sechellia_Zasp66-PJ: 0.004258, D_simulans_Zasp66-PJ: 0.008541, ((D_yakuba_Zasp66-PJ: 0.004281, D_erecta_Zasp66-PJ: 0.012868): 0.004768, (((D_biarmipes_Zasp66-PJ: 0.021642, D_suzukii_Zasp66-PJ: 0.021688): 0.008616, D_eugracilis_Zasp66-PJ: 0.047702, D_elegans_Zasp66-PJ: 0.084271, D_takahashii_Zasp66-PJ: 0.030437): 0.020342, D_ficusphila_Zasp66-PJ: 0.057872): 0.014752): 0.008082);
Detailed output identifying parameters
kappa (ts/tv) = 1.90386
omega (dN/dS) = 0.07764
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.004 568.3 148.7 0.0776 0.0004 0.0053 0.2 0.8
12..2 0.004 568.3 148.7 0.0776 0.0004 0.0053 0.2 0.8
12..3 0.009 568.3 148.7 0.0776 0.0008 0.0106 0.5 1.6
12..13 0.008 568.3 148.7 0.0776 0.0008 0.0100 0.4 1.5
13..14 0.005 568.3 148.7 0.0776 0.0005 0.0059 0.3 0.9
14..4 0.004 568.3 148.7 0.0776 0.0004 0.0053 0.2 0.8
14..5 0.013 568.3 148.7 0.0776 0.0012 0.0159 0.7 2.4
13..15 0.015 568.3 148.7 0.0776 0.0014 0.0183 0.8 2.7
15..16 0.020 568.3 148.7 0.0776 0.0020 0.0252 1.1 3.7
16..17 0.009 568.3 148.7 0.0776 0.0008 0.0107 0.5 1.6
17..6 0.022 568.3 148.7 0.0776 0.0021 0.0268 1.2 4.0
17..7 0.022 568.3 148.7 0.0776 0.0021 0.0269 1.2 4.0
16..8 0.048 568.3 148.7 0.0776 0.0046 0.0591 2.6 8.8
16..10 0.084 568.3 148.7 0.0776 0.0081 0.1044 4.6 15.5
16..11 0.030 568.3 148.7 0.0776 0.0029 0.0377 1.7 5.6
15..9 0.058 568.3 148.7 0.0776 0.0056 0.0717 3.2 10.7
tree length for dN: 0.0341
tree length for dS: 0.4392
Time used: 0:10
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
lnL(ntime: 16 np: 19): -1421.593980 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004298 0.004294 0.008614 0.008156 0.004823 0.004279 0.013017 0.015035 0.020547 0.008704 0.021745 0.021774 0.048348 0.085700 0.030750 0.058555 2.000512 0.930979 0.023820
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35864
(1: 0.004298, 2: 0.004294, 3: 0.008614, ((4: 0.004279, 5: 0.013017): 0.004823, (((6: 0.021745, 7: 0.021774): 0.008704, 8: 0.048348, 10: 0.085700, 11: 0.030750): 0.020547, 9: 0.058555): 0.015035): 0.008156);
(D_melanogaster_Zasp66-PJ: 0.004298, D_sechellia_Zasp66-PJ: 0.004294, D_simulans_Zasp66-PJ: 0.008614, ((D_yakuba_Zasp66-PJ: 0.004279, D_erecta_Zasp66-PJ: 0.013017): 0.004823, (((D_biarmipes_Zasp66-PJ: 0.021745, D_suzukii_Zasp66-PJ: 0.021774): 0.008704, D_eugracilis_Zasp66-PJ: 0.048348, D_elegans_Zasp66-PJ: 0.085700, D_takahashii_Zasp66-PJ: 0.030750): 0.020547, D_ficusphila_Zasp66-PJ: 0.058555): 0.015035): 0.008156);
Detailed output identifying parameters
kappa (ts/tv) = 2.00051
dN/dS (w) for site classes (K=2)
p: 0.93098 0.06902
w: 0.02382 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.004 566.8 150.2 0.0912 0.0005 0.0051 0.3 0.8
12..2 0.004 566.8 150.2 0.0912 0.0005 0.0051 0.3 0.8
12..3 0.009 566.8 150.2 0.0912 0.0009 0.0102 0.5 1.5
12..13 0.008 566.8 150.2 0.0912 0.0009 0.0097 0.5 1.5
13..14 0.005 566.8 150.2 0.0912 0.0005 0.0057 0.3 0.9
14..4 0.004 566.8 150.2 0.0912 0.0005 0.0051 0.3 0.8
14..5 0.013 566.8 150.2 0.0912 0.0014 0.0154 0.8 2.3
13..15 0.015 566.8 150.2 0.0912 0.0016 0.0178 0.9 2.7
15..16 0.021 566.8 150.2 0.0912 0.0022 0.0243 1.3 3.7
16..17 0.009 566.8 150.2 0.0912 0.0009 0.0103 0.5 1.5
17..6 0.022 566.8 150.2 0.0912 0.0023 0.0257 1.3 3.9
17..7 0.022 566.8 150.2 0.0912 0.0024 0.0258 1.3 3.9
16..8 0.048 566.8 150.2 0.0912 0.0052 0.0572 3.0 8.6
16..10 0.086 566.8 150.2 0.0912 0.0093 0.1014 5.2 15.2
16..11 0.031 566.8 150.2 0.0912 0.0033 0.0364 1.9 5.5
15..9 0.059 566.8 150.2 0.0912 0.0063 0.0693 3.6 10.4
Time used: 0:23
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
check convergence..
lnL(ntime: 16 np: 21): -1421.593980 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004298 0.004294 0.008614 0.008156 0.004823 0.004279 0.013018 0.015035 0.020547 0.008704 0.021745 0.021774 0.048348 0.085700 0.030749 0.058555 2.000520 0.930978 0.058695 0.023820 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35864
(1: 0.004298, 2: 0.004294, 3: 0.008614, ((4: 0.004279, 5: 0.013018): 0.004823, (((6: 0.021745, 7: 0.021774): 0.008704, 8: 0.048348, 10: 0.085700, 11: 0.030749): 0.020547, 9: 0.058555): 0.015035): 0.008156);
(D_melanogaster_Zasp66-PJ: 0.004298, D_sechellia_Zasp66-PJ: 0.004294, D_simulans_Zasp66-PJ: 0.008614, ((D_yakuba_Zasp66-PJ: 0.004279, D_erecta_Zasp66-PJ: 0.013018): 0.004823, (((D_biarmipes_Zasp66-PJ: 0.021745, D_suzukii_Zasp66-PJ: 0.021774): 0.008704, D_eugracilis_Zasp66-PJ: 0.048348, D_elegans_Zasp66-PJ: 0.085700, D_takahashii_Zasp66-PJ: 0.030749): 0.020547, D_ficusphila_Zasp66-PJ: 0.058555): 0.015035): 0.008156);
Detailed output identifying parameters
kappa (ts/tv) = 2.00052
dN/dS (w) for site classes (K=3)
p: 0.93098 0.05869 0.01033
w: 0.02382 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.004 566.8 150.2 0.0912 0.0005 0.0051 0.3 0.8
12..2 0.004 566.8 150.2 0.0912 0.0005 0.0051 0.3 0.8
12..3 0.009 566.8 150.2 0.0912 0.0009 0.0102 0.5 1.5
12..13 0.008 566.8 150.2 0.0912 0.0009 0.0097 0.5 1.5
13..14 0.005 566.8 150.2 0.0912 0.0005 0.0057 0.3 0.9
14..4 0.004 566.8 150.2 0.0912 0.0005 0.0051 0.3 0.8
14..5 0.013 566.8 150.2 0.0912 0.0014 0.0154 0.8 2.3
13..15 0.015 566.8 150.2 0.0912 0.0016 0.0178 0.9 2.7
15..16 0.021 566.8 150.2 0.0912 0.0022 0.0243 1.3 3.7
16..17 0.009 566.8 150.2 0.0912 0.0009 0.0103 0.5 1.5
17..6 0.022 566.8 150.2 0.0912 0.0023 0.0257 1.3 3.9
17..7 0.022 566.8 150.2 0.0912 0.0024 0.0258 1.3 3.9
16..8 0.048 566.8 150.2 0.0912 0.0052 0.0572 3.0 8.6
16..10 0.086 566.8 150.2 0.0912 0.0093 0.1014 5.2 15.2
16..11 0.031 566.8 150.2 0.0912 0.0033 0.0364 1.9 5.5
15..9 0.059 566.8 150.2 0.0912 0.0063 0.0693 3.6 10.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PJ)
Pr(w>1) post mean +- SE for w
158 E 0.571 1.425 +- 0.752
174 Q 0.578 1.442 +- 0.787
187 K 0.512 1.325 +- 0.688
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.764 0.170 0.041 0.013 0.005 0.003 0.002 0.001 0.001 0.001
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.992
sum of density on p0-p1 = 1.000000
Time used: 0:52
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
check convergence..
lnL(ntime: 16 np: 22): -1420.990276 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004288 0.004283 0.008594 0.008134 0.004807 0.004290 0.012986 0.014952 0.020508 0.008668 0.021716 0.021748 0.048133 0.085258 0.030666 0.058252 1.936639 0.627440 0.209639 0.000001 0.000001 0.497190
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35728
(1: 0.004288, 2: 0.004283, 3: 0.008594, ((4: 0.004290, 5: 0.012986): 0.004807, (((6: 0.021716, 7: 0.021748): 0.008668, 8: 0.048133, 10: 0.085258, 11: 0.030666): 0.020508, 9: 0.058252): 0.014952): 0.008134);
(D_melanogaster_Zasp66-PJ: 0.004288, D_sechellia_Zasp66-PJ: 0.004283, D_simulans_Zasp66-PJ: 0.008594, ((D_yakuba_Zasp66-PJ: 0.004290, D_erecta_Zasp66-PJ: 0.012986): 0.004807, (((D_biarmipes_Zasp66-PJ: 0.021716, D_suzukii_Zasp66-PJ: 0.021748): 0.008668, D_eugracilis_Zasp66-PJ: 0.048133, D_elegans_Zasp66-PJ: 0.085258, D_takahashii_Zasp66-PJ: 0.030666): 0.020508, D_ficusphila_Zasp66-PJ: 0.058252): 0.014952): 0.008134);
Detailed output identifying parameters
kappa (ts/tv) = 1.93664
dN/dS (w) for site classes (K=3)
p: 0.62744 0.20964 0.16292
w: 0.00000 0.00000 0.49719
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.004 567.8 149.2 0.0810 0.0004 0.0052 0.2 0.8
12..2 0.004 567.8 149.2 0.0810 0.0004 0.0052 0.2 0.8
12..3 0.009 567.8 149.2 0.0810 0.0009 0.0105 0.5 1.6
12..13 0.008 567.8 149.2 0.0810 0.0008 0.0100 0.5 1.5
13..14 0.005 567.8 149.2 0.0810 0.0005 0.0059 0.3 0.9
14..4 0.004 567.8 149.2 0.0810 0.0004 0.0053 0.2 0.8
14..5 0.013 567.8 149.2 0.0810 0.0013 0.0159 0.7 2.4
13..15 0.015 567.8 149.2 0.0810 0.0015 0.0183 0.8 2.7
15..16 0.021 567.8 149.2 0.0810 0.0020 0.0251 1.2 3.7
16..17 0.009 567.8 149.2 0.0810 0.0009 0.0106 0.5 1.6
17..6 0.022 567.8 149.2 0.0810 0.0022 0.0266 1.2 4.0
17..7 0.022 567.8 149.2 0.0810 0.0022 0.0266 1.2 4.0
16..8 0.048 567.8 149.2 0.0810 0.0048 0.0589 2.7 8.8
16..10 0.085 567.8 149.2 0.0810 0.0085 0.1044 4.8 15.6
16..11 0.031 567.8 149.2 0.0810 0.0030 0.0375 1.7 5.6
15..9 0.058 567.8 149.2 0.0810 0.0058 0.0713 3.3 10.6
Naive Empirical Bayes (NEB) analysis
Time used: 1:16
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
lnL(ntime: 16 np: 19): -1421.138297 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004282 0.004278 0.008583 0.008125 0.004802 0.004279 0.012968 0.014939 0.020476 0.008661 0.021687 0.021718 0.048092 0.085196 0.030631 0.058233 1.941634 0.065770 0.717353
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35695
(1: 0.004282, 2: 0.004278, 3: 0.008583, ((4: 0.004279, 5: 0.012968): 0.004802, (((6: 0.021687, 7: 0.021718): 0.008661, 8: 0.048092, 10: 0.085196, 11: 0.030631): 0.020476, 9: 0.058233): 0.014939): 0.008125);
(D_melanogaster_Zasp66-PJ: 0.004282, D_sechellia_Zasp66-PJ: 0.004278, D_simulans_Zasp66-PJ: 0.008583, ((D_yakuba_Zasp66-PJ: 0.004279, D_erecta_Zasp66-PJ: 0.012968): 0.004802, (((D_biarmipes_Zasp66-PJ: 0.021687, D_suzukii_Zasp66-PJ: 0.021718): 0.008661, D_eugracilis_Zasp66-PJ: 0.048092, D_elegans_Zasp66-PJ: 0.085196, D_takahashii_Zasp66-PJ: 0.030631): 0.020476, D_ficusphila_Zasp66-PJ: 0.058233): 0.014939): 0.008125);
Detailed output identifying parameters
kappa (ts/tv) = 1.94163
Parameters in M7 (beta):
p = 0.06577 q = 0.71735
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00020 0.00251 0.02196 0.14239 0.64163
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.004 567.7 149.3 0.0809 0.0004 0.0052 0.2 0.8
12..2 0.004 567.7 149.3 0.0809 0.0004 0.0052 0.2 0.8
12..3 0.009 567.7 149.3 0.0809 0.0008 0.0105 0.5 1.6
12..13 0.008 567.7 149.3 0.0809 0.0008 0.0099 0.5 1.5
13..14 0.005 567.7 149.3 0.0809 0.0005 0.0059 0.3 0.9
14..4 0.004 567.7 149.3 0.0809 0.0004 0.0052 0.2 0.8
14..5 0.013 567.7 149.3 0.0809 0.0013 0.0159 0.7 2.4
13..15 0.015 567.7 149.3 0.0809 0.0015 0.0183 0.8 2.7
15..16 0.020 567.7 149.3 0.0809 0.0020 0.0251 1.2 3.7
16..17 0.009 567.7 149.3 0.0809 0.0009 0.0106 0.5 1.6
17..6 0.022 567.7 149.3 0.0809 0.0021 0.0265 1.2 4.0
17..7 0.022 567.7 149.3 0.0809 0.0022 0.0266 1.2 4.0
16..8 0.048 567.7 149.3 0.0809 0.0048 0.0589 2.7 8.8
16..10 0.085 567.7 149.3 0.0809 0.0084 0.1043 4.8 15.6
16..11 0.031 567.7 149.3 0.0809 0.0030 0.0375 1.7 5.6
15..9 0.058 567.7 149.3 0.0809 0.0058 0.0713 3.3 10.6
Time used: 2:43
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 79
lnL(ntime: 16 np: 21): -1421.138308 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004282 0.004278 0.008583 0.008125 0.004802 0.004279 0.012968 0.014939 0.020476 0.008661 0.021687 0.021718 0.048093 0.085197 0.030631 0.058233 1.941634 0.999990 0.065768 0.717396 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35695
(1: 0.004282, 2: 0.004278, 3: 0.008583, ((4: 0.004279, 5: 0.012968): 0.004802, (((6: 0.021687, 7: 0.021718): 0.008661, 8: 0.048093, 10: 0.085197, 11: 0.030631): 0.020476, 9: 0.058233): 0.014939): 0.008125);
(D_melanogaster_Zasp66-PJ: 0.004282, D_sechellia_Zasp66-PJ: 0.004278, D_simulans_Zasp66-PJ: 0.008583, ((D_yakuba_Zasp66-PJ: 0.004279, D_erecta_Zasp66-PJ: 0.012968): 0.004802, (((D_biarmipes_Zasp66-PJ: 0.021687, D_suzukii_Zasp66-PJ: 0.021718): 0.008661, D_eugracilis_Zasp66-PJ: 0.048093, D_elegans_Zasp66-PJ: 0.085197, D_takahashii_Zasp66-PJ: 0.030631): 0.020476, D_ficusphila_Zasp66-PJ: 0.058233): 0.014939): 0.008125);
Detailed output identifying parameters
kappa (ts/tv) = 1.94163
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.06577 q = 0.71740
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00020 0.00251 0.02196 0.14236 0.64158 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.004 567.7 149.3 0.0809 0.0004 0.0052 0.2 0.8
12..2 0.004 567.7 149.3 0.0809 0.0004 0.0052 0.2 0.8
12..3 0.009 567.7 149.3 0.0809 0.0008 0.0105 0.5 1.6
12..13 0.008 567.7 149.3 0.0809 0.0008 0.0099 0.5 1.5
13..14 0.005 567.7 149.3 0.0809 0.0005 0.0059 0.3 0.9
14..4 0.004 567.7 149.3 0.0809 0.0004 0.0052 0.2 0.8
14..5 0.013 567.7 149.3 0.0809 0.0013 0.0159 0.7 2.4
13..15 0.015 567.7 149.3 0.0809 0.0015 0.0183 0.8 2.7
15..16 0.020 567.7 149.3 0.0809 0.0020 0.0251 1.2 3.7
16..17 0.009 567.7 149.3 0.0809 0.0009 0.0106 0.5 1.6
17..6 0.022 567.7 149.3 0.0809 0.0021 0.0265 1.2 4.0
17..7 0.022 567.7 149.3 0.0809 0.0022 0.0266 1.2 4.0
16..8 0.048 567.7 149.3 0.0809 0.0048 0.0589 2.7 8.8
16..10 0.085 567.7 149.3 0.0809 0.0084 0.1043 4.8 15.6
16..11 0.031 567.7 149.3 0.0809 0.0030 0.0375 1.7 5.6
15..9 0.058 567.7 149.3 0.0809 0.0058 0.0713 3.3 10.6
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PJ)
Pr(w>1) post mean +- SE for w
158 E 0.675 1.265 +- 0.680
174 Q 0.678 1.271 +- 0.688
187 K 0.605 1.163 +- 0.676
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.009 0.036 0.090 0.174 0.282 0.408
ws: 0.883 0.096 0.015 0.004 0.001 0.001 0.000 0.000 0.000 0.000
Time used: 4:20
Model 1: NearlyNeutral -1421.59398 Model 2: PositiveSelection -1421.59398 Model 0: one-ratio -1425.53985 Model 3: discrete -1420.990276 Model 7: beta -1421.138297 Model 8: beta&w>1 -1421.138308 Model 0 vs 1 7.891739999999572 Model 2 vs 1 0.0 Model 8 vs 7 2.2000000171829015E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
